[ { "title": "Are surrogates of IGHV gene mutational status useful in B-cell chronic lymphocytic leukemia? The example of Septin-10.", "journal": "Leukemia", "date": "2008", "authors": "Benedetti D, Bomben R, Dal-Bo M, Marconi D, Zucchetto A, Degan M, Forconi F, Del-Poeta G, Gaidano G, Gattei V", "reference": { "type": "PubMed", "id": "17657217", "url": "https://pubmed.ncbi.nlm.nih.gov/17657217" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0V9-1", "protein_name": "Septin-10", "gene_name": "SEPTIN10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0V9", "url": "https://www.uniprot.org/uniprotkb/Q9P0V9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17657217", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a novel role of Septin 10 in paclitaxel-resistance in cancers through a functional genomics screen.", "journal": "Cancer science", "date": "2012", "authors": "Xu M, Takanashi M, Oikawa K, Nishi H, Isaka K, Yoshimoto T, Ohyashiki J, Kuroda M", "reference": { "type": "PubMed", "id": "22320903", "url": "https://pubmed.ncbi.nlm.nih.gov/22320903" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0V9-1", "protein_name": "Septin-10", "gene_name": "SEPTIN10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0V9", "url": "https://www.uniprot.org/uniprotkb/Q9P0V9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22320903", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "miR-124-3p regulates the proliferation and differentiation of retinal progenitor cells through SEPT10.", "journal": "Cell and tissue research", "date": "2023-02-21", "authors": "Shen Bingqiao, Gao Huiqin, Zhang Dandan, Yu Huan, Chen Junjue, Huang Shouyue, Gu Ping, Zhong Yisheng", "reference": { "type": "PubMed", "id": "36802303", "url": "https://pubmed.ncbi.nlm.nih.gov/36802303" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0V9-1", "protein_name": "Septin-10", "gene_name": "SEPTIN10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0V9", "url": "https://www.uniprot.org/uniprotkb/Q9P0V9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36802303", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Exosomal circCLIP1 regulates PM2.5-induced airway obstruction via targeting SEPT10 in vitro.", "journal": "Ecotoxicology and environmental safety", "date": "2023-04-01", "authors": "Zhu Huanhuan, Tang Xiying, Zhang Huilin, Zhou Meiyu, Liu Hanting, Chu Haiyan, Zhang Zhengdong", "reference": { "type": "PubMed", "id": "36950992", "url": "https://pubmed.ncbi.nlm.nih.gov/36950992" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0V9-1", "protein_name": "Septin-10", "gene_name": "SEPTIN10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0V9", "url": "https://www.uniprot.org/uniprotkb/Q9P0V9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36950992", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SEPTIN10-mediated crosstalk between cytoskeletal networks controls mechanotransduction and oncogenic YAP/TAZ signaling.", "journal": "Cancer letters", "date": "2024-03-01", "authors": "Weiler Sofia M E, Bissinger Michaela, Rose Fabian, von Bubnoff Fabian, Lutz Teresa, Ori Alessandro, Schirmacher Peter, Breuhahn Kai", "reference": { "type": "PubMed", "id": "38242197", "url": "https://pubmed.ncbi.nlm.nih.gov/38242197" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0V9-1", "protein_name": "Septin-10", "gene_name": "SEPTIN10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0V9", "url": "https://www.uniprot.org/uniprotkb/Q9P0V9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38242197", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alternatively spliced hBRF variants function at different RNA polymerase III promoters.", "journal": "EMBO J.", "date": "2000", "authors": "McCulloch V, Hardin P, Peng W, Ruppert J M, Lobo-Ruppert S M", "reference": { "type": "PubMed", "id": "10921893", "url": "https://pubmed.ncbi.nlm.nih.gov/10921893" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92994", "url": "https://www.uniprot.org/uniprotkb/Q92994" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10921893", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TFIIIB is phosphorylated, disrupted and selectively released from tRNA promoters during mitosis in vivo.", "journal": "EMBO J.", "date": "2003", "authors": "Fairley Jennifer A, Scott Pamela H, White Robert J", "reference": { "type": "PubMed", "id": "14592981", "url": "https://pubmed.ncbi.nlm.nih.gov/14592981" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92994", "url": "https://www.uniprot.org/uniprotkb/Q92994" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14592981", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct regulation of tRNA and 5S rRNA gene transcription by Polo-like kinase 1.", "journal": "Molecular cell", "date": "2012", "authors": "Fairley JA, Mitchell LE, Berg T, Kenneth NS, von Schubert C, Sillje HH, Medema RH, Nigg EA, White RJ", "reference": { "type": "PubMed", "id": "22281053", "url": "https://pubmed.ncbi.nlm.nih.gov/22281053" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92994", "url": "https://www.uniprot.org/uniprotkb/Q92994" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 450, "end_pos": 450, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q92994", "url": "https://www.uniprot.org/uniprotkb/Q92994" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "iPTMnet", "id": "Q92994", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92994" }, { "database": "PubMed", "id": "22281053", "url": "https://pubmed.ncbi.nlm.nih.gov/22281053" } ], "site_lbl": "Ser450", "uniprot_canonical_ac": "Q92994-1" } ], "record_id": "pubmed.22281053", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BRF1 mutations alter RNA polymerase III-dependent transcription and cause neurodevelopmental anomalies.", "journal": "Genome research", "date": "2015", "authors": "Borck G, Hog F, Dentici ML, Tan PL, Sowada N, Medeira A, Gueneau L, Thiele H, Kousi M, Lepri F, Wenzeck L, Blumenthal I, Radicioni A, Schwarzenberg TL, Mandriani B, Fischetto R, Morris-Rosendahl DJ, Altmuller J, Reymond A, Nurnberg P, Merla G, Dallapiccola B, Katsanis N, Cramer P, Kubisch C", "reference": { "type": "PubMed", "id": "25561519", "url": "https://pubmed.ncbi.nlm.nih.gov/25561519" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92994", "url": "https://www.uniprot.org/uniprotkb/Q92994" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25561519", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comprehensive Analysis of Prognostic and Genetic Signatures for General Transcription Factor III (GTF3) in Clinical Colorectal Cancer Patients Using Bioinformatics Approaches.", "journal": "Current issues in molecular biology", "date": "2021", "authors": "Anuraga G, Tang WC, Phan NN, Ta HDK, Liu YH, Wu YF, Lee KH, Wang CY", "reference": { "type": "PubMed", "id": "33925358", "url": "https://pubmed.ncbi.nlm.nih.gov/33925358" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92664-1", "protein_name": "Transcription factor IIIA", "gene_name": "GTF3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92994", "url": "https://www.uniprot.org/uniprotkb/Q92994" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33925358", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "tRNA biogenesis and specific aminoacyl-tRNA synthetases regulate senescence stability under the control of mTOR.", "journal": "PLoS genetics", "date": "2021", "authors": "Guillon J, Coquelet H, Leman G, Toutain B, Petit C, Henry C, Boissard A, Guette C, Coqueret O", "reference": { "type": "PubMed", "id": "34928935", "url": "https://pubmed.ncbi.nlm.nih.gov/34928935" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92994", "url": "https://www.uniprot.org/uniprotkb/Q92994" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34928935", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel BRF1 mutation in two middle-aged siblings with cerebellofaciodental syndrome.", "journal": "Chinese medical journal", "date": "2022", "authors": "Zhao X, Lan Y, Miao J, Li G, Sun W, Qiu X, Zhu S, Zhu Z", "reference": { "type": "PubMed", "id": "34935685", "url": "https://pubmed.ncbi.nlm.nih.gov/34935685" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92994", "url": "https://www.uniprot.org/uniprotkb/Q92994" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34935685", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TFIIB-related factor 1 is a nucleolar protein that promotes RNA polymerase I-directed transcription and tumour cell growth.", "journal": "Human molecular genetics", "date": "2022-08-04", "authors": "Wang Juan, Chen Qiyue, Wang Xin, Zhao Shasha, Deng Huan, Guo Baoqiang, Zhang Cheng, Song Xiaoye, Deng Wensheng, Zhang Tongcun, Ni Hongwei", "reference": { "type": "PubMed", "id": "35925837", "url": "https://pubmed.ncbi.nlm.nih.gov/35925837" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92994", "url": "https://www.uniprot.org/uniprotkb/Q92994" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35925837", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and function of a human transcription factor TFIIIB subunit that is evolutionarily conserved and contains both TFIIB- and high-mobility-group protein 2-related domains.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "Wang Z, Roeder R G", "reference": { "type": "PubMed", "id": "7624363", "url": "https://pubmed.ncbi.nlm.nih.gov/7624363" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92994", "url": "https://www.uniprot.org/uniprotkb/Q92994" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7624363", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNA polymerase III transcription from the human U6 and adenovirus type 2 VAI promoters has different requirements for human BRF, a subunit of human TFIIIB.", "journal": "Mol. Cell. Biol.", "date": "1996", "authors": "Mital R, Kobayashi R, Hernandez N", "reference": { "type": "PubMed", "id": "8943358", "url": "https://pubmed.ncbi.nlm.nih.gov/8943358" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92994", "url": "https://www.uniprot.org/uniprotkb/Q92994" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8943358", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polymerization defects within human telomerase are distinct from telomerase RNA and TEP1 binding.", "journal": "Mol. Biol. Cell", "date": "2000", "authors": "Beattie T L, Zhou W, Robinson M O, Harrington L", "reference": { "type": "PubMed", "id": "11029039", "url": "https://pubmed.ncbi.nlm.nih.gov/11029039" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99973-1", "protein_name": "Telomerase protein component 1", "gene_name": "TEP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99973", "url": "https://www.uniprot.org/uniprotkb/Q99973" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11029039", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "hsa_circ_0004018 suppresses the progression of liver fibrosis through regulating the hsa-miR-660-3p/TEP1 axis.", "journal": "Aging", "date": "2020", "authors": "Li S, Song F, Lei X, Li J, Li F, Tan H", "reference": { "type": "PubMed", "id": "32584784", "url": "https://pubmed.ncbi.nlm.nih.gov/32584784" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99973-1", "protein_name": "Telomerase protein component 1", "gene_name": "TEP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99973", "url": "https://www.uniprot.org/uniprotkb/Q99973" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32584784", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TEP1 is a risk gene for sporadic cerebral palsy.", "journal": "Journal of genetics and genomics = Yi chuan xue bao", "date": "2021", "authors": "Wang Y, Xu Y, Li H, Tang T, Qiao Y, Cheng Y, Zhang L, Song J, Su Y, Zhang X, Wang J, Shang Q, Song L, Gao C, Zhu D, Wang X, Zhu C, Xing Q", "reference": { "type": "PubMed", "id": "34543729", "url": "https://pubmed.ncbi.nlm.nih.gov/34543729" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99973-1", "protein_name": "Telomerase protein component 1", "gene_name": "TEP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99973", "url": "https://www.uniprot.org/uniprotkb/Q99973" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34543729", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MVP Expression Facilitates Tumor Cell Proliferation and Migration Supporting the Metastasis of Colorectal Cancer Cells.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Pietras P, Lesniczak-Staszak M, Kasprzak A, Andrzejewska M, Jopek K, Sowinski M, Rucinski M, Lyons SM, Ivanov P, Szaflarski W", "reference": { "type": "PubMed", "id": "34829999", "url": "https://pubmed.ncbi.nlm.nih.gov/34829999" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99973-1", "protein_name": "Telomerase protein component 1", "gene_name": "TEP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14764-1", "protein_name": "Major vault protein", "gene_name": "MVP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99973", "url": "https://www.uniprot.org/uniprotkb/Q99973" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34829999", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mammalian telomerase-associated protein.", "journal": "Science", "date": "1997", "authors": "Harrington L, McPhail T, Mar V, Zhou W, Oulton R, Bass M B, Arruda I, Robinson M O", "reference": { "type": "PubMed", "id": "9020079", "url": "https://pubmed.ncbi.nlm.nih.gov/9020079" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99973-1", "protein_name": "Telomerase protein component 1", "gene_name": "TEP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97499-1", "protein_name": "Telomerase protein component 1", "gene_name": "Tep1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99973", "url": "https://www.uniprot.org/uniprotkb/Q99973" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9020079", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human telomerase contains evolutionarily conserved catalytic and structural subunits.", "journal": "Genes Dev.", "date": "1997", "authors": "Harrington L, Zhou W, McPhail T, Oulton R, Yeung DS, Mar V, Bass MB, Robinson MO", "reference": { "type": "PubMed", "id": "9389643", "url": "https://pubmed.ncbi.nlm.nih.gov/9389643" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99973-1", "protein_name": "Telomerase protein component 1", "gene_name": "TEP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99973", "url": "https://www.uniprot.org/uniprotkb/Q99973" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 712, "end_pos": 712, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of telomerase activity. In the absence of TR, no loss of binding to telomeric primers.", "evidence": [ { "database": "UniProtKB", "id": "O14746", "url": "https://www.uniprot.org/uniprotkb/O14746" }, { "database": "PubMed", "id": "17026956", "url": "https://pubmed.ncbi.nlm.nih.gov/17026956" }, { "database": "PubMed", "id": "9389643", "url": "https://pubmed.ncbi.nlm.nih.gov/9389643" }, { "database": "PubMed", "id": "9443919", "url": "https://pubmed.ncbi.nlm.nih.gov/9443919" }, { "database": "PubMed", "id": "17296728", "url": "https://pubmed.ncbi.nlm.nih.gov/17296728" } ], "uniprot_canonical_ac": "O14746-1" }, { "start_pos": 868, "end_pos": 868, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of telomerase activity.", "evidence": [ { "database": "UniProtKB", "id": "O14746", "url": "https://www.uniprot.org/uniprotkb/O14746" }, { "database": "PubMed", "id": "17026956", "url": "https://pubmed.ncbi.nlm.nih.gov/17026956" }, { "database": "PubMed", "id": "9389643", "url": "https://pubmed.ncbi.nlm.nih.gov/9389643" }, { "database": "PubMed", "id": "9443919", "url": "https://pubmed.ncbi.nlm.nih.gov/9443919" }, { "database": "PubMed", "id": "15082768", "url": "https://pubmed.ncbi.nlm.nih.gov/15082768" }, { "database": "PubMed", "id": "15857955", "url": "https://pubmed.ncbi.nlm.nih.gov/15857955" } ], "uniprot_canonical_ac": "O14746-1" }, { "start_pos": 869, "end_pos": 869, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of telomerase activity.", "evidence": [ { "database": "UniProtKB", "id": "O14746", "url": "https://www.uniprot.org/uniprotkb/O14746" }, { "database": "PubMed", "id": "9389643", "url": "https://pubmed.ncbi.nlm.nih.gov/9389643" }, { "database": "PubMed", "id": "9443919", "url": "https://pubmed.ncbi.nlm.nih.gov/9443919" } ], "uniprot_canonical_ac": "O14746-1" } ], "record_id": "pubmed.9389643", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA and genomic cloning of HRC, a human sarcoplasmic reticulum protein, and localization of the gene to human chromosome 19 and mouse chromosome 7.", "journal": "Genomics", "date": "1991", "authors": "Hofmann SL, Topham M, Hsieh CL, Francke U", "reference": { "type": "PubMed", "id": "2037293", "url": "https://pubmed.ncbi.nlm.nih.gov/2037293" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23327-1", "protein_name": "Sarcoplasmic reticulum histidine-rich calcium-binding protein", "gene_name": "HRC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23327", "url": "https://www.uniprot.org/uniprotkb/P23327" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2037293", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of serine96 of histidine-rich calcium-binding protein by the Fam20C kinase functions to prevent cardiac arrhythmia.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2017", "authors": "Pollak AJ, Haghighi K, Kunduri S, Arvanitis DA, Bidwell PA, Liu GS, Singh VP, Gonzalez DJ, Sanoudou D, Wiley SE, Dixon JE, Kranias EG", "reference": { "type": "PubMed", "id": "28784772", "url": "https://pubmed.ncbi.nlm.nih.gov/28784772" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23327-1", "protein_name": "Sarcoplasmic reticulum histidine-rich calcium-binding protein", "gene_name": "HRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IXL6-1", "protein_name": "Extracellular serine/threonine protein kinase FAM20C", "gene_name": "FAM20C", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23327", "url": "https://www.uniprot.org/uniprotkb/P23327" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P23327", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23327" }, { "database": "PubMed", "id": "28784772", "url": "https://pubmed.ncbi.nlm.nih.gov/28784772" } ], "site_lbl": "Ser96", "uniprot_canonical_ac": "P23327-1" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8IXL6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8IXL6" }, { "database": "PubMed", "id": "28784772", "url": "https://pubmed.ncbi.nlm.nih.gov/28784772" } ], "site_lbl": "Ser96", "uniprot_canonical_ac": "Q8IXL6-1" } ], "record_id": "pubmed.28784772", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ser96Ala genetic variant of the human histidine-rich calcium-binding protein is a genetic predictor of recurrence after catheter ablation in patients with paroxysmal atrial fibrillation.", "journal": "PloS one", "date": "2019", "authors": "Amioka M, Nakano Y, Ochi H, Onohara Y, Sairaku A, Tokuyama T, Motoda C, Matsumura H, Tomomori S, Hironobe N, Okubo Y, Okamura S, Chayama K, Kihara Y", "reference": { "type": "PubMed", "id": "30840693", "url": "https://pubmed.ncbi.nlm.nih.gov/30840693" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23327-1", "protein_name": "Sarcoplasmic reticulum histidine-rich calcium-binding protein", "gene_name": "HRC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23327", "url": "https://www.uniprot.org/uniprotkb/P23327" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30840693", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HRC promotes anoikis resistance and metastasis by suppressing endoplasmic reticulum stress in hepatocellular carcinoma.", "journal": "International journal of medical sciences", "date": "2021", "authors": "Xia S, Wu J, Zhou W, Zhang M, Zhao K, Tian D, Liu J, Liao J", "reference": { "type": "PubMed", "id": "34400882", "url": "https://pubmed.ncbi.nlm.nih.gov/34400882" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23327-1", "protein_name": "Sarcoplasmic reticulum histidine-rich calcium-binding protein", "gene_name": "HRC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23327", "url": "https://www.uniprot.org/uniprotkb/P23327" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34400882", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lack of Evidence for the Role of the p.(Ser96Ala) Polymorphism in Histidine-Rich Calcium Binding Protein as a Secondary Hit in Cardiomyopathies.", "journal": "International journal of molecular sciences", "date": "2023-11-03", "authors": "van der Voorn Stephanie M, van Drie Esm\u00e9e, Proost Virginnio, Dimitrova Kristina, Netherlands Acm/Pln Registry , Ernst Robert F, James Cynthia A, Tichnell Crystal, Murray Brittney, Calkins Hugh, Saguner Ardan M, Duru Firat, Ellinor Patrick T, Bezzina Connie R, Jurgens Sean J, van Tintelen J Peter, van Veen Toon A B", "reference": { "type": "PubMed", "id": "37958923", "url": "https://pubmed.ncbi.nlm.nih.gov/37958923" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23327-1", "protein_name": "Sarcoplasmic reticulum histidine-rich calcium-binding protein", "gene_name": "HRC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23327", "url": "https://www.uniprot.org/uniprotkb/P23327" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37958923", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biotin uptake by human proximal tubular epithelial cells: cellular and molecular aspects.", "journal": "American journal of physiology. Renal physiology", "date": "2005-04", "authors": "Balamurugan Krishnaswamy, Vaziri Nosratola D, Said Hamid M", "reference": { "type": "PubMed", "id": "15561972", "url": "https://pubmed.ncbi.nlm.nih.gov/15561972" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15561972", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Membrane targeting and intracellular trafficking of the human sodium-dependent multivitamin transporter in polarized epithelial cells.", "journal": "American journal of physiology. Cell physiology", "date": "2009-04", "authors": "Subramanian Veedamali S, Marchant Jonathan S, Boulware Michael J, Ma Thomas Y, Said Hamid M", "reference": { "type": "PubMed", "id": "19211916", "url": "https://pubmed.ncbi.nlm.nih.gov/19211916" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 567, "end_pos": 635, "sequence_org": "PKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL", "sequence_mut": "", "comment": "Loss of biotin transport. Loss of membrane localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "19211916", "url": "https://pubmed.ncbi.nlm.nih.gov/19211916" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 570, "end_pos": 635, "sequence_org": "LSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL", "sequence_mut": "", "comment": "Loss of biotin transport. Loss of membrane localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "19211916", "url": "https://pubmed.ncbi.nlm.nih.gov/19211916" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 575, "end_pos": 635, "sequence_org": "LSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL", "sequence_mut": "", "comment": "Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "19211916", "url": "https://pubmed.ncbi.nlm.nih.gov/19211916" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 584, "end_pos": 635, "sequence_org": "RSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL", "sequence_mut": "", "comment": "Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "19211916", "url": "https://pubmed.ncbi.nlm.nih.gov/19211916" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 600, "end_pos": 635, "sequence_org": "PRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL", "sequence_mut": "", "comment": "Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "19211916", "url": "https://pubmed.ncbi.nlm.nih.gov/19211916" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 612, "end_pos": 635, "sequence_org": "EAMALDGTAYQGSSSTCILQETSL", "sequence_mut": "", "comment": "Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "19211916", "url": "https://pubmed.ncbi.nlm.nih.gov/19211916" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 616, "end_pos": 635, "sequence_org": "LDGTAYQGSSSTCILQETSL", "sequence_mut": "", "comment": "Loss of apical membrane localization in polarized cells. Basolateral localization in polarized cells.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "19211916", "url": "https://pubmed.ncbi.nlm.nih.gov/19211916" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 620, "end_pos": 635, "sequence_org": "AYQGSSSTCILQETSL", "sequence_mut": "", "comment": "Partial loss (25%) of biotine transport. No change in apical membrane localization in polarized cells.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "19211916", "url": "https://pubmed.ncbi.nlm.nih.gov/19211916" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 624, "end_pos": 635, "sequence_org": "SSSTCILQETSL", "sequence_mut": "", "comment": "Partial loss (25%) of biotine transport. No change in apical membrane localization in polarized cells.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "19211916", "url": "https://pubmed.ncbi.nlm.nih.gov/19211916" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 632, "end_pos": 635, "sequence_org": "ETSL", "sequence_mut": "", "comment": "Partial loss (25%) of biotine transport. No change in apical membrane localization in polarized cells.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "19211916", "url": "https://pubmed.ncbi.nlm.nih.gov/19211916" } ], "uniprot_canonical_ac": "Q9Y289-1" } ], "record_id": "pubmed.19211916", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Surprising substrate versatility in SLC5A6: Na+-coupled I- transport by the human Na+/multivitamin transporter (hSMVT).", "journal": "The Journal of biological chemistry", "date": "2011-01-07", "authors": "de Carvalho Fernanda Delmondes, Quick Matthias", "reference": { "type": "PubMed", "id": "20980265", "url": "https://pubmed.ncbi.nlm.nih.gov/20980265" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20980265", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of the putative N-glycosylation and PKC-phosphorylation sites of the human sodium-dependent multivitamin transporter (hSMVT) in function and regulation.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Ghosal A, Subramanian VS, Said HM", "reference": { "type": "PubMed", "id": "21570947", "url": "https://pubmed.ncbi.nlm.nih.gov/21570947" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "Q9Y289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9Y289#ptm_processing" }, { "id": "21570947", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21570947" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0;GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" }, { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01101", "uniprot_canonical_ac": "Q9Y289-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 489, "start_aa": "Asn", "end_pos": 489, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn489", "evidence": [ { "id": "Q9Y289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9Y289#ptm_processing" }, { "id": "21570947", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21570947" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0;GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" }, { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q9Y289-1" } ], "mutagenesis": [ { "start_pos": 138, "end_pos": 138, "sequence_org": "N", "sequence_mut": "A", "comment": "Reduced protein levels. Decrease in biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "21570947", "url": "https://pubmed.ncbi.nlm.nih.gov/21570947" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 283, "end_pos": 283, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on protein levels or membrane localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "21570947", "url": "https://pubmed.ncbi.nlm.nih.gov/21570947" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 286, "end_pos": 286, "sequence_org": "T", "sequence_mut": "A", "comment": "Resistant to phorbol 12-myristate 13-acetate (PMA)-induced inhibition of biotin transport. No effect on protein levels or membrane localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "21570947", "url": "https://pubmed.ncbi.nlm.nih.gov/21570947" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 489, "end_pos": 489, "sequence_org": "N", "sequence_mut": "A", "comment": "Slight decrease in protein levels. Decrease in biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "21570947", "url": "https://pubmed.ncbi.nlm.nih.gov/21570947" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 498, "end_pos": 498, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "21570947", "url": "https://pubmed.ncbi.nlm.nih.gov/21570947" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 534, "end_pos": 534, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "21570947", "url": "https://pubmed.ncbi.nlm.nih.gov/21570947" } ], "uniprot_canonical_ac": "Q9Y289-1" } ], "phosphorylation": [ { "start_pos": 286, "end_pos": 286, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9Y289", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Y289" }, { "database": "PubMed", "id": "21570947", "url": "https://pubmed.ncbi.nlm.nih.gov/21570947" } ], "site_lbl": "Thr286", "uniprot_canonical_ac": "Q9Y289-1" } ], "record_id": "pubmed.21570947", "abstract": "", "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "Cys(294) is essential for the function of the human sodium-dependent multivitamin transporter.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Ghosal A, Said HM", "reference": { "type": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 104, "end_pos": 104, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 144, "end_pos": 144, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 187, "end_pos": 187, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 294, "end_pos": 294, "sequence_org": "C", "sequence_mut": "A", "comment": "Reduced membrane localization. Decrease in biotin transport (decreased Vmax, no change in Km).", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 294, "end_pos": 294, "sequence_org": "C", "sequence_mut": "M", "comment": "Decrease in biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 294, "end_pos": 294, "sequence_org": "C", "sequence_mut": "S", "comment": "Decrease in biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 309, "end_pos": 309, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 358, "end_pos": 358, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 410, "end_pos": 410, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 443, "end_pos": 443, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 450, "end_pos": 450, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 577, "end_pos": 577, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 583, "end_pos": 583, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 628, "end_pos": 628, "sequence_org": "C", "sequence_mut": "A", "comment": "Decrease in biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 628, "end_pos": 628, "sequence_org": "C", "sequence_mut": "S", "comment": "Decrease in biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 68, "end_pos": 68, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "22015582", "url": "https://pubmed.ncbi.nlm.nih.gov/22015582" } ], "uniprot_canonical_ac": "Q9Y289-1" } ], "record_id": "pubmed.22015582", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Major involvement of Na(+) -dependent multivitamin transporter (SLC5A6/SMVT) in uptake of biotin and pantothenic acid by human brain capillary endothelial cells.", "journal": "Journal of neurochemistry", "date": "2015", "authors": "Uchida Y, Ito K, Ohtsuki S, Kubo Y, Suzuki T, Terasaki T", "reference": { "type": "PubMed", "id": "25809983", "url": "https://pubmed.ncbi.nlm.nih.gov/25809983" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25809983", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of alpha-Lipoic Acid with the Human Na+/Multivitamin Transporter (hSMVT).", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Zehnpfennig B, Wiriyasermkul P, Carlson DA, Quick M", "reference": { "type": "PubMed", "id": "25971966", "url": "https://pubmed.ncbi.nlm.nih.gov/25971966" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25971966", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in SLC5A6 associated with brain, immune, bone, and intestinal dysfunction in a young child.", "journal": "Human genetics", "date": "2017", "authors": "Subramanian VS, Constantinescu AR, Benke PJ, Said HM", "reference": { "type": "PubMed", "id": "27904971", "url": "https://pubmed.ncbi.nlm.nih.gov/27904971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27904971", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lipopolysaccharide inhibits colonic biotin uptake via interference with membrane expression of its transporter: a role for a casein kinase 2-mediated pathway.", "journal": "American journal of physiology. Cell physiology", "date": "2017", "authors": "Lakhan R, Said HM", "reference": { "type": "PubMed", "id": "28052864", "url": "https://pubmed.ncbi.nlm.nih.gov/28052864" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5U4D8-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "Slc5a6", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 128, "end_pos": 128, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "28052864", "url": "https://pubmed.ncbi.nlm.nih.gov/28052864" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 242, "end_pos": 242, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "28052864", "url": "https://pubmed.ncbi.nlm.nih.gov/28052864" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 366, "end_pos": 366, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "28052864", "url": "https://pubmed.ncbi.nlm.nih.gov/28052864" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 627, "end_pos": 627, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "28052864", "url": "https://pubmed.ncbi.nlm.nih.gov/28052864" } ], "uniprot_canonical_ac": "Q9Y289-1" }, { "start_pos": 78, "end_pos": 78, "sequence_org": "T", "sequence_mut": "A", "comment": "Reduced membrane localization. Decrease in biotin transport.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" }, { "database": "PubMed", "id": "28052864", "url": "https://pubmed.ncbi.nlm.nih.gov/28052864" } ], "uniprot_canonical_ac": "Q9Y289-1" } ], "phosphorylation": [ { "start_pos": 78, "end_pos": 78, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9Y289", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Y289" }, { "database": "PubMed", "id": "28052864", "url": "https://pubmed.ncbi.nlm.nih.gov/28052864" } ], "site_lbl": "Thr78", "uniprot_canonical_ac": "Q9Y289-1" } ], "record_id": "pubmed.28052864", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and targeted management of a neurodegenerative disorder caused by biallelic mutations in SLC5A6.", "journal": "NPJ genomic medicine", "date": "2019", "authors": "Byrne AB, Arts P, Polyak SW, Feng J, Schreiber AW, Kassahn KS, Hahn CN, Mordaunt DA, Fletcher JM, Lipsett J, Bratkovic D, Booker GW, Smith NJ, Scott HS", "reference": { "type": "PubMed", "id": "31754459", "url": "https://pubmed.ncbi.nlm.nih.gov/31754459" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31754459", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Integrated profiling identifies SLC5A6 and MFAP2 as novel diagnostic and prognostic biomarkers in gastric cancer patients.", "journal": "International journal of oncology", "date": "2020", "authors": "Sun T, Wang D, Ping Y, Sang Y, Dai Y, Wang Y, Liu Z, Duan X, Tao Z, Liu W", "reference": { "type": "PubMed", "id": "31894266", "url": "https://pubmed.ncbi.nlm.nih.gov/31894266" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31894266", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel biallelic variants expand the SLC5A6-related phenotypic spectrum.", "journal": "European journal of human genetics : EJHG", "date": "2022", "authors": "Holling T, Nampoothiri S, Tarhan B, Schneeberger PE, Vinayan KP, Yesodharan D, Roy AG, Radhakrishnan P, Alawi M, Rhodes L, Girisha KM, Kang PB, Kutsche K", "reference": { "type": "PubMed", "id": "35013551", "url": "https://pubmed.ncbi.nlm.nih.gov/35013551" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35013551", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel SLC5A6 homozygous variant in a family with multivitamin-dependent neurometabolic disorder: Phenotype expansion and long-term follow-up.", "journal": "European journal of medical genetics", "date": "2023-08", "authors": "Montomoli Martino, Vetro Annalisa, Tubili Flavia, Donati Maria Alice, Daniotti Marta, Pochiero Francesca, Rivieri Francesca, Girlando Salvatore, Guerrini Renzo", "reference": { "type": "PubMed", "id": "37391029", "url": "https://pubmed.ncbi.nlm.nih.gov/37391029" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37391029", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel missense variants cause intermediate phenotypes in the phenotypic spectrum of SLC5A6-related disorders.", "journal": "Journal of human genetics", "date": "2024-02", "authors": "Utsuno Yasuhiro, Hamada Keisuke, Hamanaka Kohei, Miyoshi Keita, Tsuchimoto Keiji, Sunada Satoshi, Itai Toshiyuki, Sakamoto Masamune, Tsuchida Naomi, Uchiyama Yuri, Koshimizu Eriko, Fujita Atsushi, Miyatake Satoko, Misawa Kazuharu, Mizuguchi Takeshi, Kato Yasuhito, Saito Kuniaki, Ogata Kazuhiro, Matsumoto Naomichi", "reference": { "type": "PubMed", "id": "38012394", "url": "https://pubmed.ncbi.nlm.nih.gov/38012394" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38012394", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel SLC5A6 mutations lead to B lymphocyte maturation defects with metabolic abnormality rescuable by biotin replenishment.", "journal": "Clinical immunology (Orlando, Fla.)", "date": "2023-12", "authors": "Hsieh Chu-Han, Lee Ju, Sung Hsiang-Hsuan, Huang Ya-Fang, Ding Yu-Sian, Li Chia-Yi, Yen Chia-Liang, Hsu Chao-Kai, Yu Chun-Keung, Hsieh Hsin-Ying, Hughes Michael Warren, Chen Peng-Chieh, Shieh Chi-Chang", "reference": { "type": "PubMed", "id": "38036278", "url": "https://pubmed.ncbi.nlm.nih.gov/38036278" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y289-1", "protein_name": "Sodium-dependent multivitamin transporter", "gene_name": "SLC5A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y289", "url": "https://www.uniprot.org/uniprotkb/Q9Y289" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38036278", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of two extracellular heparin-degrading endosulfatases in mice and humans.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Morimoto-Tomita M, Uchimura K, Werb Z, Hemmerich S, Rosen SD", "reference": { "type": "PubMed", "id": "12368295", "url": "https://pubmed.ncbi.nlm.nih.gov/12368295" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWU6-1", "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "SULF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8CFG0-1", "protein_name": "Extracellular sulfatase Sulf-2", "gene_name": "Sulf2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8IWU5-1", "protein_name": "Extracellular sulfatase Sulf-2", "gene_name": "SULF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8K007-1", "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "Sulf1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWU6", "url": "https://www.uniprot.org/uniprotkb/Q8IWU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 87, "end_pos": 88, "sequence_org": "CC", "sequence_mut": "AA", "comment": "Loss of arylsulfatase activity and loss of ability to modulate apoptosis.", "evidence": [ { "database": "UniProtKB", "id": "Q8IWU6", "url": "https://www.uniprot.org/uniprotkb/Q8IWU6" }, { "database": "PubMed", "id": "12686563", "url": "https://pubmed.ncbi.nlm.nih.gov/12686563" }, { "database": "PubMed", "id": "12368295", "url": "https://pubmed.ncbi.nlm.nih.gov/12368295" } ], "uniprot_canonical_ac": "Q8IWU6-1" }, { "start_pos": 88, "end_pos": 89, "sequence_org": "CC", "sequence_mut": "AA", "comment": "Loss of arylsulfatase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8IWU5", "url": "https://www.uniprot.org/uniprotkb/Q8IWU5" }, { "database": "PubMed", "id": "12368295", "url": "https://pubmed.ncbi.nlm.nih.gov/12368295" } ], "uniprot_canonical_ac": "Q8IWU5-1" } ], "record_id": "pubmed.12368295", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Loss of HSulf-1 up-regulates heparin-binding growth factor signaling in cancer.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lai J, Chien J, Staub J, Avula R, Greene EL, Matthews TA, Smith DI, Kaufmann SH, Roberts LR, Shridhar V", "reference": { "type": "PubMed", "id": "12686563", "url": "https://pubmed.ncbi.nlm.nih.gov/12686563" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWU6-1", "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "SULF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWU6", "url": "https://www.uniprot.org/uniprotkb/Q8IWU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 87, "end_pos": 88, "sequence_org": "CC", "sequence_mut": "AA", "comment": "Loss of arylsulfatase activity and loss of ability to modulate apoptosis.", "evidence": [ { "database": "UniProtKB", "id": "Q8IWU6", "url": "https://www.uniprot.org/uniprotkb/Q8IWU6" }, { "database": "PubMed", "id": "12686563", "url": "https://pubmed.ncbi.nlm.nih.gov/12686563" }, { "database": "PubMed", "id": "12368295", "url": "https://pubmed.ncbi.nlm.nih.gov/12368295" } ], "uniprot_canonical_ac": "Q8IWU6-1" } ], "record_id": "pubmed.12686563", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "hSulf1 Sulfatase promotes apoptosis of hepatocellular cancer cells by decreasing heparin-binding growth factor signaling.", "journal": "Gastroenterology", "date": "2004", "authors": "Lai JP, Chien JR, Moser DR, Staub JK, Aderca I, Montoya DP, Matthews TA, Nagorney DM, Cunningham JM, Smith DI, Greene EL, Shridhar V, Roberts LR", "reference": { "type": "PubMed", "id": "14699503", "url": "https://pubmed.ncbi.nlm.nih.gov/14699503" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWU6-1", "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "SULF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWU6", "url": "https://www.uniprot.org/uniprotkb/Q8IWU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14699503", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Enhanced levels of Hsulf-1 interfere with heparin-binding growth factor signaling in pancreatic cancer.", "journal": "Molecular cancer", "date": "2005", "authors": "Li J, Kleeff J, Abiatari I, Kayed H, Giese NA, Felix K, Giese T, Buchler MW, Friess H", "reference": { "type": "PubMed", "id": "15817123", "url": "https://pubmed.ncbi.nlm.nih.gov/15817123" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWU6-1", "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "SULF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWU6", "url": "https://www.uniprot.org/uniprotkb/Q8IWU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15817123", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HSulf1 and palbociclib exert synergistic antitumor effects on RBpositive triplenegative breast cancer.", "journal": "International journal of oncology", "date": "2020", "authors": "Chen F, Zhang Z, Yu Y, Liu Q, Pu F", "reference": { "type": "PubMed", "id": "32377705", "url": "https://pubmed.ncbi.nlm.nih.gov/32377705" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWU6-1", "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "SULF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWU6", "url": "https://www.uniprot.org/uniprotkb/Q8IWU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 727, "end_pos": 727, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by DYRK2, NLK, NEK6, IRAK1, RPS6KA5, ZIPK/DAPK3 and PKC/PRKCE", "evidence": [ { "database": "UniProtKB", "id": "P40763", "url": "https://www.uniprot.org/uniprotkb/P40763" }, { "database": "iPTMnet", "id": "P40763", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40763" }, { "database": "PubMed", "id": "10446219", "url": "https://pubmed.ncbi.nlm.nih.gov/10446219" }, { "database": "PubMed", "id": "10521505", "url": "https://pubmed.ncbi.nlm.nih.gov/10521505" }, { "database": "PubMed", "id": "11350938", "url": "https://pubmed.ncbi.nlm.nih.gov/11350938" }, { "database": "PubMed", "id": "12576423", "url": "https://pubmed.ncbi.nlm.nih.gov/12576423" }, { "database": "PubMed", "id": "12763138", "url": "https://pubmed.ncbi.nlm.nih.gov/12763138" }, { "database": "PubMed", "id": "14551213", "url": "https://pubmed.ncbi.nlm.nih.gov/14551213" }, { "database": "PubMed", "id": "18491316", "url": "https://pubmed.ncbi.nlm.nih.gov/18491316" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "20058876", "url": "https://pubmed.ncbi.nlm.nih.gov/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "9343414", "url": "https://pubmed.ncbi.nlm.nih.gov/9343414" }, { "database": "PubMed", "id": "9872331", "url": "https://pubmed.ncbi.nlm.nih.gov/9872331" }, { "database": "PubMed", "id": "15096606", "url": "https://pubmed.ncbi.nlm.nih.gov/15096606" }, { "database": "PubMed", "id": "17145757", "url": "https://pubmed.ncbi.nlm.nih.gov/17145757" }, { "database": "PubMed", "id": "10336453", "url": "https://pubmed.ncbi.nlm.nih.gov/10336453" }, { "database": "PubMed", "id": "10537060", "url": "https://pubmed.ncbi.nlm.nih.gov/10537060" }, { "database": "PubMed", "id": "10660304", "url": "https://pubmed.ncbi.nlm.nih.gov/10660304" }, { "database": "PubMed", "id": "10727406", "url": "https://pubmed.ncbi.nlm.nih.gov/10727406" }, { "database": "PubMed", "id": "10845908", "url": "https://pubmed.ncbi.nlm.nih.gov/10845908" }, { "database": "PubMed", "id": "10878008", "url": "https://pubmed.ncbi.nlm.nih.gov/10878008" }, { "database": "PubMed", "id": "11071637", "url": "https://pubmed.ncbi.nlm.nih.gov/11071637" }, { "database": "PubMed", "id": "11150545", "url": "https://pubmed.ncbi.nlm.nih.gov/11150545" }, { "database": "PubMed", "id": "11278353", "url": "https://pubmed.ncbi.nlm.nih.gov/11278353" }, { "database": "PubMed", "id": "11322950", "url": "https://pubmed.ncbi.nlm.nih.gov/11322950" }, { "database": "PubMed", "id": "11335711", "url": "https://pubmed.ncbi.nlm.nih.gov/11335711" }, { "database": "PubMed", "id": "11429693", "url": "https://pubmed.ncbi.nlm.nih.gov/11429693" }, { "database": "PubMed", "id": "11470914", "url": "https://pubmed.ncbi.nlm.nih.gov/11470914" }, { "database": "PubMed", "id": "11553624", "url": "https://pubmed.ncbi.nlm.nih.gov/11553624" }, { "database": "PubMed", "id": "11556393", "url": "https://pubmed.ncbi.nlm.nih.gov/11556393" }, { "database": "PubMed", "id": "11922392", "url": "https://pubmed.ncbi.nlm.nih.gov/11922392" }, { "database": "PubMed", "id": "12130710", "url": "https://pubmed.ncbi.nlm.nih.gov/12130710" }, { "database": "PubMed", "id": "12474230", "url": "https://pubmed.ncbi.nlm.nih.gov/12474230" }, { "database": "PubMed", "id": "12494267", "url": "https://pubmed.ncbi.nlm.nih.gov/12494267" }, { "database": "PubMed", "id": "12562765", "url": "https://pubmed.ncbi.nlm.nih.gov/12562765" }, { "database": "PubMed", "id": "12748293", "url": "https://pubmed.ncbi.nlm.nih.gov/12748293" }, { "database": "PubMed", "id": "12796477", "url": "https://pubmed.ncbi.nlm.nih.gov/12796477" }, { "database": "PubMed", "id": "14963038", "url": "https://pubmed.ncbi.nlm.nih.gov/14963038" }, { "database": "PubMed", "id": "14999683", "url": "https://pubmed.ncbi.nlm.nih.gov/14999683" }, { "database": "PubMed", "id": "15115615", "url": "https://pubmed.ncbi.nlm.nih.gov/15115615" }, { "database": "PubMed", "id": "15155836", "url": "https://pubmed.ncbi.nlm.nih.gov/15155836" }, { "database": "PubMed", "id": "15465816", "url": "https://pubmed.ncbi.nlm.nih.gov/15465816" }, { "database": "PubMed", "id": "15467762", "url": "https://pubmed.ncbi.nlm.nih.gov/15467762" }, { "database": "PubMed", "id": "15522880", "url": "https://pubmed.ncbi.nlm.nih.gov/15522880" }, { "database": "PubMed", "id": "15527783", "url": "https://pubmed.ncbi.nlm.nih.gov/15527783" }, { "database": "PubMed", "id": "15764709", "url": "https://pubmed.ncbi.nlm.nih.gov/15764709" }, { "database": "PubMed", "id": "15864742", "url": "https://pubmed.ncbi.nlm.nih.gov/15864742" }, { "database": "PubMed", "id": "15994929", "url": "https://pubmed.ncbi.nlm.nih.gov/15994929" }, { "database": "PubMed", "id": "16048438", "url": "https://pubmed.ncbi.nlm.nih.gov/16048438" }, { "database": "PubMed", "id": "16219639", "url": "https://pubmed.ncbi.nlm.nih.gov/16219639" }, { "database": "PubMed", "id": "16247467", "url": "https://pubmed.ncbi.nlm.nih.gov/16247467" }, { "database": "PubMed", "id": "16288304", "url": "https://pubmed.ncbi.nlm.nih.gov/16288304" }, { "database": "PubMed", "id": "16401721", "url": "https://pubmed.ncbi.nlm.nih.gov/16401721" }, { "database": "PubMed", "id": "16418226", "url": "https://pubmed.ncbi.nlm.nih.gov/16418226" }, { "database": "PubMed", "id": "16425286", "url": "https://pubmed.ncbi.nlm.nih.gov/16425286" }, { "database": "PubMed", "id": "16651438", "url": "https://pubmed.ncbi.nlm.nih.gov/16651438" }, { "database": "PubMed", "id": "16669628", "url": "https://pubmed.ncbi.nlm.nih.gov/16669628" }, { "database": "PubMed", "id": "16720575", "url": "https://pubmed.ncbi.nlm.nih.gov/16720575" }, { "database": "PubMed", "id": "16801397", "url": "https://pubmed.ncbi.nlm.nih.gov/16801397" }, { "database": "PubMed", "id": "16846476", "url": "https://pubmed.ncbi.nlm.nih.gov/16846476" }, { "database": "PubMed", "id": "16879821", "url": "https://pubmed.ncbi.nlm.nih.gov/16879821" }, { "database": "PubMed", "id": "16951338", "url": "https://pubmed.ncbi.nlm.nih.gov/16951338" }, { "database": "PubMed", "id": "17027757", "url": "https://pubmed.ncbi.nlm.nih.gov/17027757" }, { "database": "PubMed", "id": "17237271", "url": "https://pubmed.ncbi.nlm.nih.gov/17237271" }, { "database": "PubMed", "id": "17258468", "url": "https://pubmed.ncbi.nlm.nih.gov/17258468" }, { "database": "PubMed", "id": "17311011", "url": "https://pubmed.ncbi.nlm.nih.gov/17311011" }, { "database": "PubMed", "id": "17341659", "url": "https://pubmed.ncbi.nlm.nih.gov/17341659" }, { "database": "PubMed", "id": "17543278", "url": "https://pubmed.ncbi.nlm.nih.gov/17543278" }, { "database": "PubMed", "id": "17563747", "url": "https://pubmed.ncbi.nlm.nih.gov/17563747" }, { "database": "PubMed", "id": "17575268", "url": "https://pubmed.ncbi.nlm.nih.gov/17575268" }, { "database": "PubMed", "id": "17703129", "url": "https://pubmed.ncbi.nlm.nih.gov/17703129" }, { "database": "PubMed", "id": "17931419", "url": "https://pubmed.ncbi.nlm.nih.gov/17931419" }, { "database": "PubMed", "id": "17993646", "url": "https://pubmed.ncbi.nlm.nih.gov/17993646" }, { "database": "PubMed", "id": "18037959", "url": "https://pubmed.ncbi.nlm.nih.gov/18037959" }, { "database": "PubMed", "id": "18196976", "url": "https://pubmed.ncbi.nlm.nih.gov/18196976" }, { "database": "PubMed", "id": "18198175", "url": "https://pubmed.ncbi.nlm.nih.gov/18198175" }, { "database": "PubMed", "id": "18204781", "url": "https://pubmed.ncbi.nlm.nih.gov/18204781" }, { "database": "PubMed", "id": "18365011", "url": "https://pubmed.ncbi.nlm.nih.gov/18365011" }, { "database": "PubMed", "id": "18448488", "url": "https://pubmed.ncbi.nlm.nih.gov/18448488" }, { "database": "PubMed", "id": "18463684", "url": "https://pubmed.ncbi.nlm.nih.gov/18463684" }, { "database": "PubMed", "id": "18499896", "url": "https://pubmed.ncbi.nlm.nih.gov/18499896" }, { "database": "PubMed", "id": "18519681", "url": "https://pubmed.ncbi.nlm.nih.gov/18519681" }, { "database": "PubMed", "id": "18525315", "url": "https://pubmed.ncbi.nlm.nih.gov/18525315" }, { "database": "PubMed", "id": "18550668", "url": "https://pubmed.ncbi.nlm.nih.gov/18550668" }, { "database": "PubMed", "id": "18668152", "url": "https://pubmed.ncbi.nlm.nih.gov/18668152" }, { "database": "PubMed", "id": "18755267", "url": "https://pubmed.ncbi.nlm.nih.gov/18755267" }, { "database": "PubMed", "id": "18829527", "url": "https://pubmed.ncbi.nlm.nih.gov/18829527" }, { "database": "PubMed", "id": "18939993", "url": "https://pubmed.ncbi.nlm.nih.gov/18939993" }, { "database": "PubMed", "id": "18995957", "url": "https://pubmed.ncbi.nlm.nih.gov/18995957" }, { "database": "PubMed", "id": "19121623", "url": "https://pubmed.ncbi.nlm.nih.gov/19121623" }, { "database": "PubMed", "id": "19182994", "url": "https://pubmed.ncbi.nlm.nih.gov/19182994" }, { "database": "PubMed", "id": "19427337", "url": "https://pubmed.ncbi.nlm.nih.gov/19427337" }, { "database": "PubMed", "id": "19429262", "url": "https://pubmed.ncbi.nlm.nih.gov/19429262" }, { "database": "PubMed", "id": "19440292", "url": "https://pubmed.ncbi.nlm.nih.gov/19440292" }, { "database": "PubMed", "id": "19723038", "url": "https://pubmed.ncbi.nlm.nih.gov/19723038" }, { "database": "PubMed", "id": "19764570", "url": "https://pubmed.ncbi.nlm.nih.gov/19764570" }, { "database": "PubMed", "id": "19875458", "url": "https://pubmed.ncbi.nlm.nih.gov/19875458" }, { "database": "PubMed", "id": "19885032", "url": "https://pubmed.ncbi.nlm.nih.gov/19885032" }, { "database": "PubMed", "id": "19901082", "url": "https://pubmed.ncbi.nlm.nih.gov/19901082" }, { "database": "PubMed", "id": "20154216", "url": "https://pubmed.ncbi.nlm.nih.gov/20154216" }, { "database": "PubMed", "id": "20156552", "url": "https://pubmed.ncbi.nlm.nih.gov/20156552" }, { "database": "PubMed", "id": "20228845", "url": "https://pubmed.ncbi.nlm.nih.gov/20228845" }, { "database": "PubMed", "id": "20473906", "url": "https://pubmed.ncbi.nlm.nih.gov/20473906" }, { "database": "PubMed", "id": "20516069", "url": "https://pubmed.ncbi.nlm.nih.gov/20516069" }, { "database": "PubMed", "id": "20686606", "url": "https://pubmed.ncbi.nlm.nih.gov/20686606" }, { "database": "PubMed", "id": "20712901", "url": "https://pubmed.ncbi.nlm.nih.gov/20712901" }, { "database": "PubMed", "id": "20877211", "url": "https://pubmed.ncbi.nlm.nih.gov/20877211" }, { "database": "PubMed", "id": "20977777", "url": "https://pubmed.ncbi.nlm.nih.gov/20977777" }, { "database": "PubMed", "id": "20979115", "url": "https://pubmed.ncbi.nlm.nih.gov/20979115" }, { "database": "PubMed", "id": "21159613", "url": "https://pubmed.ncbi.nlm.nih.gov/21159613" }, { "database": "PubMed", "id": "21253577", "url": "https://pubmed.ncbi.nlm.nih.gov/21253577" }, { "database": "PubMed", "id": "21398617", "url": "https://pubmed.ncbi.nlm.nih.gov/21398617" }, { "database": "PubMed", "id": "21490133", "url": "https://pubmed.ncbi.nlm.nih.gov/21490133" }, { "database": "PubMed", "id": "21538419", "url": "https://pubmed.ncbi.nlm.nih.gov/21538419" }, { "database": "PubMed", "id": "21619877", "url": "https://pubmed.ncbi.nlm.nih.gov/21619877" }, { "database": "PubMed", "id": "21625597", "url": "https://pubmed.ncbi.nlm.nih.gov/21625597" }, { "database": "PubMed", "id": "21677772", "url": "https://pubmed.ncbi.nlm.nih.gov/21677772" }, { "database": "PubMed", "id": "21702955", "url": "https://pubmed.ncbi.nlm.nih.gov/21702955" }, { "database": "PubMed", "id": "21783819", "url": "https://pubmed.ncbi.nlm.nih.gov/21783819" }, { "database": "PubMed", "id": "21801384", "url": "https://pubmed.ncbi.nlm.nih.gov/21801384" }, { "database": "PubMed", "id": "21878628", "url": "https://pubmed.ncbi.nlm.nih.gov/21878628" }, { "database": "PubMed", "id": "21906308", "url": "https://pubmed.ncbi.nlm.nih.gov/21906308" }, { "database": "PubMed", "id": "21915376", "url": "https://pubmed.ncbi.nlm.nih.gov/21915376" }, { "database": "PubMed", "id": "21954831", "url": "https://pubmed.ncbi.nlm.nih.gov/21954831" }, { "database": "PubMed", "id": "22110204", "url": "https://pubmed.ncbi.nlm.nih.gov/22110204" }, { "database": "PubMed", "id": "22142222", "url": "https://pubmed.ncbi.nlm.nih.gov/22142222" }, { "database": "PubMed", "id": "22174695", "url": "https://pubmed.ncbi.nlm.nih.gov/22174695" }, { "database": "PubMed", "id": "22179221", "url": "https://pubmed.ncbi.nlm.nih.gov/22179221" }, { "database": "PubMed", "id": "22279540", "url": "https://pubmed.ncbi.nlm.nih.gov/22279540" }, { "database": "PubMed", "id": "22280969", "url": "https://pubmed.ncbi.nlm.nih.gov/22280969" }, { "database": "PubMed", "id": "22349830", "url": "https://pubmed.ncbi.nlm.nih.gov/22349830" }, { "database": "PubMed", "id": "22393233", "url": "https://pubmed.ncbi.nlm.nih.gov/22393233" }, { "database": "PubMed", "id": "22418867", "url": "https://pubmed.ncbi.nlm.nih.gov/22418867" }, { "database": "PubMed", "id": "22581330", "url": "https://pubmed.ncbi.nlm.nih.gov/22581330" }, { "database": "PubMed", "id": "22689141", "url": "https://pubmed.ncbi.nlm.nih.gov/22689141" }, { "database": "PubMed", "id": "22696236", "url": "https://pubmed.ncbi.nlm.nih.gov/22696236" }, { "database": "PubMed", "id": "22791907", "url": "https://pubmed.ncbi.nlm.nih.gov/22791907" }, { "database": "PubMed", "id": "22870139", "url": "https://pubmed.ncbi.nlm.nih.gov/22870139" }, { "database": "PubMed", "id": "22905257", "url": "https://pubmed.ncbi.nlm.nih.gov/22905257" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22922995", "url": "https://pubmed.ncbi.nlm.nih.gov/22922995" }, { "database": "PubMed", "id": "22937084", "url": "https://pubmed.ncbi.nlm.nih.gov/22937084" }, { "database": "PubMed", "id": "23125416", "url": "https://pubmed.ncbi.nlm.nih.gov/23125416" }, { "database": "PubMed", "id": "23226414", "url": "https://pubmed.ncbi.nlm.nih.gov/23226414" }, { "database": "PubMed", "id": "23329648", "url": "https://pubmed.ncbi.nlm.nih.gov/23329648" }, { "database": "PubMed", "id": "23329839", "url": "https://pubmed.ncbi.nlm.nih.gov/23329839" }, { "database": "PubMed", "id": "23352233", "url": "https://pubmed.ncbi.nlm.nih.gov/23352233" }, { "database": "PubMed", "id": "23379788", "url": "https://pubmed.ncbi.nlm.nih.gov/23379788" }, { "database": "PubMed", "id": "23455323", "url": "https://pubmed.ncbi.nlm.nih.gov/23455323" }, { "database": "PubMed", "id": "23614738", "url": "https://pubmed.ncbi.nlm.nih.gov/23614738" }, { "database": "PubMed", "id": "23690956", "url": "https://pubmed.ncbi.nlm.nih.gov/23690956" }, { "database": "PubMed", "id": "23704922", "url": "https://pubmed.ncbi.nlm.nih.gov/23704922" }, { "database": "PubMed", "id": "23740979", "url": "https://pubmed.ncbi.nlm.nih.gov/23740979" }, { "database": "PubMed", "id": "23782265", "url": "https://pubmed.ncbi.nlm.nih.gov/23782265" }, { "database": "PubMed", "id": "23831387", "url": "https://pubmed.ncbi.nlm.nih.gov/23831387" }, { "database": "PubMed", "id": "23928694", "url": "https://pubmed.ncbi.nlm.nih.gov/23928694" }, { "database": "PubMed", "id": "23947369", "url": "https://pubmed.ncbi.nlm.nih.gov/23947369" }, { "database": "PubMed", "id": "24058772", "url": "https://pubmed.ncbi.nlm.nih.gov/24058772" }, { "database": "PubMed", "id": "24069562", "url": "https://pubmed.ncbi.nlm.nih.gov/24069562" }, { "database": "PubMed", "id": "24086494", "url": "https://pubmed.ncbi.nlm.nih.gov/24086494" }, { "database": "PubMed", "id": "24086526", "url": "https://pubmed.ncbi.nlm.nih.gov/24086526" }, { "database": "PubMed", "id": "24090995", "url": "https://pubmed.ncbi.nlm.nih.gov/24090995" }, { "database": "PubMed", "id": "24283803", "url": "https://pubmed.ncbi.nlm.nih.gov/24283803" }, { "database": "PubMed", "id": "24288470", "url": "https://pubmed.ncbi.nlm.nih.gov/24288470" }, { "database": "PubMed", "id": "24312439", "url": "https://pubmed.ncbi.nlm.nih.gov/24312439" }, { "database": "PubMed", "id": "24423131", "url": "https://pubmed.ncbi.nlm.nih.gov/24423131" }, { "database": "PubMed", "id": "24469975", "url": "https://pubmed.ncbi.nlm.nih.gov/24469975" }, { "database": "PubMed", "id": "24487064", "url": "https://pubmed.ncbi.nlm.nih.gov/24487064" }, { "database": "PubMed", "id": "24496235", "url": "https://pubmed.ncbi.nlm.nih.gov/24496235" }, { "database": "PubMed", "id": "24499623", "url": "https://pubmed.ncbi.nlm.nih.gov/24499623" }, { "database": "PubMed", "id": "24533098", "url": "https://pubmed.ncbi.nlm.nih.gov/24533098" }, { "database": "PubMed", "id": "24667661", "url": "https://pubmed.ncbi.nlm.nih.gov/24667661" }, { "database": "PubMed", "id": "24671708", "url": "https://pubmed.ncbi.nlm.nih.gov/24671708" }, { "database": "PubMed", "id": "24703937", "url": "https://pubmed.ncbi.nlm.nih.gov/24703937" }, { "database": "PubMed", "id": "24726840", "url": "https://pubmed.ncbi.nlm.nih.gov/24726840" }, { "database": "PubMed", "id": "24728078", "url": "https://pubmed.ncbi.nlm.nih.gov/24728078" }, { "database": "PubMed", "id": "24799285", "url": "https://pubmed.ncbi.nlm.nih.gov/24799285" }, { "database": "PubMed", "id": "24886617", "url": "https://pubmed.ncbi.nlm.nih.gov/24886617" }, { "database": "PubMed", "id": "24931163", "url": "https://pubmed.ncbi.nlm.nih.gov/24931163" }, { "database": "PubMed", "id": "24954857", "url": "https://pubmed.ncbi.nlm.nih.gov/24954857" }, { "database": "PubMed", "id": "25013907", "url": "https://pubmed.ncbi.nlm.nih.gov/25013907" }, { "database": "PubMed", "id": "25031733", "url": "https://pubmed.ncbi.nlm.nih.gov/25031733" }, { "database": "PubMed", "id": "25047660", "url": "https://pubmed.ncbi.nlm.nih.gov/25047660" }, { "database": "PubMed", "id": "25089666", "url": "https://pubmed.ncbi.nlm.nih.gov/25089666" }, { "database": "PubMed", "id": "25116684", "url": "https://pubmed.ncbi.nlm.nih.gov/25116684" }, { "database": "PubMed", "id": "25153725", "url": "https://pubmed.ncbi.nlm.nih.gov/25153725" }, { "database": "PubMed", "id": "25226283", "url": "https://pubmed.ncbi.nlm.nih.gov/25226283" }, { "database": "PubMed", "id": "25252914", "url": "https://pubmed.ncbi.nlm.nih.gov/25252914" }, { "database": "PubMed", "id": "25280942", "url": "https://pubmed.ncbi.nlm.nih.gov/25280942" }, { "database": "PubMed", "id": "25299776", "url": "https://pubmed.ncbi.nlm.nih.gov/25299776" }, { "database": "PubMed", "id": "25360179", "url": "https://pubmed.ncbi.nlm.nih.gov/25360179" }, { "database": "PubMed", "id": "25375189", "url": "https://pubmed.ncbi.nlm.nih.gov/25375189" }, { "database": "PubMed", "id": "25383546", "url": "https://pubmed.ncbi.nlm.nih.gov/25383546" }, { "database": "PubMed", "id": "25393367", "url": "https://pubmed.ncbi.nlm.nih.gov/25393367" }, { "database": "PubMed", "id": "25452693", "url": "https://pubmed.ncbi.nlm.nih.gov/25452693" }, { "database": "PubMed", "id": "25512602", "url": "https://pubmed.ncbi.nlm.nih.gov/25512602" }, { "database": "PubMed", "id": "25544757", "url": "https://pubmed.ncbi.nlm.nih.gov/25544757" }, { "database": "PubMed", "id": "25584415", "url": "https://pubmed.ncbi.nlm.nih.gov/25584415" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25642823", "url": "https://pubmed.ncbi.nlm.nih.gov/25642823" }, { "database": "PubMed", "id": "25736961", "url": "https://pubmed.ncbi.nlm.nih.gov/25736961" }, { "database": "PubMed", "id": "25740948", "url": "https://pubmed.ncbi.nlm.nih.gov/25740948" }, { "database": "PubMed", "id": "25744297", "url": "https://pubmed.ncbi.nlm.nih.gov/25744297" }, { "database": "PubMed", "id": "25762897", "url": "https://pubmed.ncbi.nlm.nih.gov/25762897" }, { "database": "PubMed", "id": "25789853", "url": "https://pubmed.ncbi.nlm.nih.gov/25789853" }, { "database": "PubMed", "id": "25854938", "url": "https://pubmed.ncbi.nlm.nih.gov/25854938" }, { "database": "PubMed", "id": "25968054", "url": "https://pubmed.ncbi.nlm.nih.gov/25968054" }, { "database": "PubMed", "id": "26028030", "url": "https://pubmed.ncbi.nlm.nih.gov/26028030" }, { "database": "PubMed", "id": "26042668", "url": "https://pubmed.ncbi.nlm.nih.gov/26042668" }, { "database": "PubMed", "id": "26045618", "url": "https://pubmed.ncbi.nlm.nih.gov/26045618" }, { "database": "PubMed", "id": "26055806", "url": "https://pubmed.ncbi.nlm.nih.gov/26055806" }, { "database": "PubMed", "id": "26175331", "url": "https://pubmed.ncbi.nlm.nih.gov/26175331" }, { "database": "PubMed", "id": "26359029", "url": "https://pubmed.ncbi.nlm.nih.gov/26359029" }, { "database": "PubMed", "id": "26376676", "url": "https://pubmed.ncbi.nlm.nih.gov/26376676" }, { "database": "PubMed", "id": "26430964", "url": "https://pubmed.ncbi.nlm.nih.gov/26430964" }, { "database": "PubMed", "id": "26485029", "url": "https://pubmed.ncbi.nlm.nih.gov/26485029" }, { "database": "PubMed", "id": "26575169", "url": "https://pubmed.ncbi.nlm.nih.gov/26575169" }, { "database": "PubMed", "id": "26593962", "url": "https://pubmed.ncbi.nlm.nih.gov/26593962" }, { "database": "PubMed", "id": "26636769", "url": "https://pubmed.ncbi.nlm.nih.gov/26636769" }, { "database": "PubMed", "id": "26657118", "url": "https://pubmed.ncbi.nlm.nih.gov/26657118" }, { "database": "PubMed", "id": "26664907", "url": "https://pubmed.ncbi.nlm.nih.gov/26664907" }, { "database": "PubMed", "id": "26791143", "url": "https://pubmed.ncbi.nlm.nih.gov/26791143" }, { "database": "PubMed", "id": "26792726", "url": "https://pubmed.ncbi.nlm.nih.gov/26792726" }, { "database": "PubMed", "id": "26799670", "url": "https://pubmed.ncbi.nlm.nih.gov/26799670" }, { "database": "PubMed", "id": "26843613", "url": "https://pubmed.ncbi.nlm.nih.gov/26843613" }, { "database": "PubMed", "id": "26898989", "url": "https://pubmed.ncbi.nlm.nih.gov/26898989" }, { "database": "PubMed", "id": "26904961", "url": "https://pubmed.ncbi.nlm.nih.gov/26904961" }, { "database": "PubMed", "id": "26911335", "url": "https://pubmed.ncbi.nlm.nih.gov/26911335" }, { "database": "PubMed", "id": "26918609", "url": "https://pubmed.ncbi.nlm.nih.gov/26918609" }, { "database": "PubMed", "id": "26921179", "url": "https://pubmed.ncbi.nlm.nih.gov/26921179" }, { "database": "PubMed", "id": "26949510", "url": "https://pubmed.ncbi.nlm.nih.gov/26949510" }, { "database": "PubMed", "id": "26959890", "url": "https://pubmed.ncbi.nlm.nih.gov/26959890" }, { "database": "PubMed", "id": "27050371", "url": "https://pubmed.ncbi.nlm.nih.gov/27050371" }, { "database": "PubMed", "id": "27064016", "url": "https://pubmed.ncbi.nlm.nih.gov/27064016" }, { "database": "PubMed", "id": "27080861", "url": "https://pubmed.ncbi.nlm.nih.gov/27080861" }, { "database": "PubMed", "id": "27127727", "url": "https://pubmed.ncbi.nlm.nih.gov/27127727" }, { "database": "PubMed", "id": "27145367", "url": "https://pubmed.ncbi.nlm.nih.gov/27145367" }, { "database": "PubMed", "id": "27185663", "url": "https://pubmed.ncbi.nlm.nih.gov/27185663" }, { "database": "PubMed", "id": "27242913", "url": "https://pubmed.ncbi.nlm.nih.gov/27242913" }, { "database": "PubMed", "id": "27447722", "url": "https://pubmed.ncbi.nlm.nih.gov/27447722" }, { "database": "PubMed", "id": "27458171", "url": "https://pubmed.ncbi.nlm.nih.gov/27458171" }, { "database": "PubMed", "id": "27502076", "url": "https://pubmed.ncbi.nlm.nih.gov/27502076" }, { "database": "PubMed", "id": "27616044", "url": "https://pubmed.ncbi.nlm.nih.gov/27616044" }, { "database": "PubMed", "id": "27658964", "url": "https://pubmed.ncbi.nlm.nih.gov/27658964" }, { "database": "PubMed", "id": "27660268", "url": "https://pubmed.ncbi.nlm.nih.gov/27660268" }, { "database": "PubMed", "id": "27708408", "url": "https://pubmed.ncbi.nlm.nih.gov/27708408" }, { "database": "PubMed", "id": "27748760", "url": "https://pubmed.ncbi.nlm.nih.gov/27748760" }, { "database": "PubMed", "id": "27806334", "url": "https://pubmed.ncbi.nlm.nih.gov/27806334" }, { "database": "PubMed", "id": "27824155", "url": "https://pubmed.ncbi.nlm.nih.gov/27824155" }, { "database": "PubMed", "id": "27840601", "url": "https://pubmed.ncbi.nlm.nih.gov/27840601" }, { "database": "PubMed", "id": "27918421", "url": "https://pubmed.ncbi.nlm.nih.gov/27918421" }, { "database": "PubMed", "id": "28004755", "url": "https://pubmed.ncbi.nlm.nih.gov/28004755" }, { "database": "PubMed", "id": "28030813", "url": "https://pubmed.ncbi.nlm.nih.gov/28030813" }, { "database": "PubMed", "id": "28035720", "url": "https://pubmed.ncbi.nlm.nih.gov/28035720" }, { "database": "PubMed", "id": "28086195", "url": "https://pubmed.ncbi.nlm.nih.gov/28086195" }, { "database": "PubMed", "id": "28130399", "url": "https://pubmed.ncbi.nlm.nih.gov/28130399" }, { "database": "PubMed", "id": "28134252", "url": "https://pubmed.ncbi.nlm.nih.gov/28134252" }, { "database": "PubMed", "id": "28150703", "url": "https://pubmed.ncbi.nlm.nih.gov/28150703" }, { "database": "PubMed", "id": "28157712", "url": "https://pubmed.ncbi.nlm.nih.gov/28157712" }, { "database": "PubMed", "id": "28160777", "url": "https://pubmed.ncbi.nlm.nih.gov/28160777" }, { "database": "PubMed", "id": "28280036", "url": "https://pubmed.ncbi.nlm.nih.gov/28280036" }, { "database": "PubMed", "id": "28350008", "url": "https://pubmed.ncbi.nlm.nih.gov/28350008" }, { "database": "PubMed", "id": "28350087", "url": "https://pubmed.ncbi.nlm.nih.gov/28350087" }, { "database": "PubMed", "id": "28384648", "url": "https://pubmed.ncbi.nlm.nih.gov/28384648" }, { "database": "PubMed", "id": "28397855", "url": "https://pubmed.ncbi.nlm.nih.gov/28397855" }, { "database": "PubMed", "id": "28415760", "url": "https://pubmed.ncbi.nlm.nih.gov/28415760" }, { "database": "PubMed", "id": "28469272", "url": "https://pubmed.ncbi.nlm.nih.gov/28469272" }, { "database": "PubMed", "id": "28515148", "url": "https://pubmed.ncbi.nlm.nih.gov/28515148" }, { "database": "PubMed", "id": "28542650", "url": "https://pubmed.ncbi.nlm.nih.gov/28542650" }, { "database": "PubMed", "id": "28574510", "url": "https://pubmed.ncbi.nlm.nih.gov/28574510" }, { "database": "PubMed", "id": "28640256", "url": "https://pubmed.ncbi.nlm.nih.gov/28640256" }, { "database": "PubMed", "id": "28670112", "url": "https://pubmed.ncbi.nlm.nih.gov/28670112" }, { "database": "PubMed", "id": "28783167", "url": "https://pubmed.ncbi.nlm.nih.gov/28783167" }, { "database": "PubMed", "id": "28881473", "url": "https://pubmed.ncbi.nlm.nih.gov/28881473" }, { "database": "PubMed", "id": "29050266", "url": "https://pubmed.ncbi.nlm.nih.gov/29050266" }, { "database": "PubMed", "id": "29082496", "url": "https://pubmed.ncbi.nlm.nih.gov/29082496" }, { "database": "PubMed", "id": "29088733", "url": "https://pubmed.ncbi.nlm.nih.gov/29088733" }, { "database": "PubMed", "id": "29158850", "url": "https://pubmed.ncbi.nlm.nih.gov/29158850" }, { "database": "PubMed", "id": "29190960", "url": "https://pubmed.ncbi.nlm.nih.gov/29190960" }, { "database": "PubMed", "id": "29212252", "url": "https://pubmed.ncbi.nlm.nih.gov/29212252" }, { "database": "PubMed", "id": "29263930", "url": "https://pubmed.ncbi.nlm.nih.gov/29263930" }, { "database": "PubMed", "id": "29270528", "url": "https://pubmed.ncbi.nlm.nih.gov/29270528" }, { "database": "PubMed", "id": "29309895", "url": "https://pubmed.ncbi.nlm.nih.gov/29309895" }, { "database": "PubMed", "id": "29330478", "url": "https://pubmed.ncbi.nlm.nih.gov/29330478" }, { "database": "PubMed", "id": "29379494", "url": "https://pubmed.ncbi.nlm.nih.gov/29379494" }, { "database": "PubMed", "id": "29423098", "url": "https://pubmed.ncbi.nlm.nih.gov/29423098" }, { "database": "PubMed", "id": "29449694", "url": "https://pubmed.ncbi.nlm.nih.gov/29449694" }, { "database": "PubMed", "id": "29456240", "url": "https://pubmed.ncbi.nlm.nih.gov/29456240" }, { "database": "PubMed", "id": "29464030", "url": "https://pubmed.ncbi.nlm.nih.gov/29464030" }, { "database": "PubMed", "id": "29488000", "url": "https://pubmed.ncbi.nlm.nih.gov/29488000" }, { "database": "PubMed", "id": "29518129", "url": "https://pubmed.ncbi.nlm.nih.gov/29518129" }, { "database": "PubMed", "id": "29571296", "url": "https://pubmed.ncbi.nlm.nih.gov/29571296" }, { "database": "PubMed", "id": "29595328", "url": "https://pubmed.ncbi.nlm.nih.gov/29595328" }, { "database": "PubMed", "id": "29604049", "url": "https://pubmed.ncbi.nlm.nih.gov/29604049" }, { "database": "PubMed", "id": "29630659", "url": "https://pubmed.ncbi.nlm.nih.gov/29630659" }, { "database": "PubMed", "id": "29636527", "url": "https://pubmed.ncbi.nlm.nih.gov/29636527" }, { "database": "PubMed", "id": "29652915", "url": "https://pubmed.ncbi.nlm.nih.gov/29652915" }, { "database": "PubMed", "id": "29666362", "url": "https://pubmed.ncbi.nlm.nih.gov/29666362" }, { "database": "PubMed", "id": "29683208", "url": "https://pubmed.ncbi.nlm.nih.gov/29683208" }, { "database": "PubMed", "id": "29686295", "url": "https://pubmed.ncbi.nlm.nih.gov/29686295" }, { "database": "PubMed", "id": "29774125", "url": "https://pubmed.ncbi.nlm.nih.gov/29774125" }, { "database": "PubMed", "id": "29805309", "url": "https://pubmed.ncbi.nlm.nih.gov/29805309" }, { "database": "PubMed", "id": "29949238", "url": "https://pubmed.ncbi.nlm.nih.gov/29949238" }, { "database": "PubMed", "id": "29995595", "url": "https://pubmed.ncbi.nlm.nih.gov/29995595" }, { "database": "PubMed", "id": "30036966", "url": "https://pubmed.ncbi.nlm.nih.gov/30036966" }, { "database": "PubMed", "id": "30123428", "url": "https://pubmed.ncbi.nlm.nih.gov/30123428" }, { "database": "PubMed", "id": "30127373", "url": "https://pubmed.ncbi.nlm.nih.gov/30127373" }, { "database": "PubMed", "id": "30234199", "url": "https://pubmed.ncbi.nlm.nih.gov/30234199" }, { "database": "PubMed", "id": "30263097", "url": "https://pubmed.ncbi.nlm.nih.gov/30263097" }, { "database": "PubMed", "id": "30286779", "url": "https://pubmed.ncbi.nlm.nih.gov/30286779" }, { "database": "PubMed", "id": "30302278", "url": "https://pubmed.ncbi.nlm.nih.gov/30302278" }, { "database": "PubMed", "id": "30323145", "url": "https://pubmed.ncbi.nlm.nih.gov/30323145" }, { "database": "PubMed", "id": "30375708", "url": "https://pubmed.ncbi.nlm.nih.gov/30375708" }, { "database": "PubMed", "id": "30410767", "url": "https://pubmed.ncbi.nlm.nih.gov/30410767" }, { "database": "PubMed", "id": "30442941", "url": "https://pubmed.ncbi.nlm.nih.gov/30442941" }, { "database": "PubMed", "id": "30470788", "url": "https://pubmed.ncbi.nlm.nih.gov/30470788" }, { "database": "PubMed", "id": "30610554", "url": "https://pubmed.ncbi.nlm.nih.gov/30610554" }, { "database": "PubMed", "id": "30616203", "url": "https://pubmed.ncbi.nlm.nih.gov/30616203" }, { "database": "PubMed", "id": "30675525", "url": "https://pubmed.ncbi.nlm.nih.gov/30675525" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30728072", "url": "https://pubmed.ncbi.nlm.nih.gov/30728072" }, { "database": "PubMed", "id": "30783489", "url": "https://pubmed.ncbi.nlm.nih.gov/30783489" }, { "database": "PubMed", "id": "30846988", "url": "https://pubmed.ncbi.nlm.nih.gov/30846988" }, { "database": "PubMed", "id": "30948493", "url": "https://pubmed.ncbi.nlm.nih.gov/30948493" }, { "database": "PubMed", "id": "31013746", "url": "https://pubmed.ncbi.nlm.nih.gov/31013746" }, { "database": "PubMed", "id": "31025789", "url": "https://pubmed.ncbi.nlm.nih.gov/31025789" }, { "database": "PubMed", "id": "31048139", "url": "https://pubmed.ncbi.nlm.nih.gov/31048139" }, { "database": "PubMed", "id": "31198634", "url": "https://pubmed.ncbi.nlm.nih.gov/31198634" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31226168", "url": "https://pubmed.ncbi.nlm.nih.gov/31226168" }, { "database": "PubMed", "id": "31227842", "url": "https://pubmed.ncbi.nlm.nih.gov/31227842" }, { "database": "PubMed", "id": "31284599", "url": "https://pubmed.ncbi.nlm.nih.gov/31284599" }, { "database": "PubMed", "id": "31304451", "url": "https://pubmed.ncbi.nlm.nih.gov/31304451" }, { "database": "PubMed", "id": "31319869", "url": "https://pubmed.ncbi.nlm.nih.gov/31319869" }, { "database": "PubMed", "id": "31337843", "url": "https://pubmed.ncbi.nlm.nih.gov/31337843" }, { "database": "PubMed", "id": "31398350", "url": "https://pubmed.ncbi.nlm.nih.gov/31398350" }, { "database": "PubMed", "id": "31500219", "url": "https://pubmed.ncbi.nlm.nih.gov/31500219" }, { "database": "PubMed", "id": "31530281", "url": "https://pubmed.ncbi.nlm.nih.gov/31530281" }, { "database": "PubMed", "id": "31611552", "url": "https://pubmed.ncbi.nlm.nih.gov/31611552" }, { "database": "PubMed", "id": "31655629", "url": "https://pubmed.ncbi.nlm.nih.gov/31655629" }, { "database": "PubMed", "id": "31681292", "url": "https://pubmed.ncbi.nlm.nih.gov/31681292" }, { "database": "PubMed", "id": "31760402", "url": "https://pubmed.ncbi.nlm.nih.gov/31760402" }, { "database": "PubMed", "id": "31780735", "url": "https://pubmed.ncbi.nlm.nih.gov/31780735" }, { "database": "PubMed", "id": "31817171", "url": "https://pubmed.ncbi.nlm.nih.gov/31817171" }, { "database": "PubMed", "id": "31817563", "url": "https://pubmed.ncbi.nlm.nih.gov/31817563" }, { "database": "PubMed", "id": "31878046", "url": "https://pubmed.ncbi.nlm.nih.gov/31878046" }, { "database": "PubMed", "id": "31956373", "url": "https://pubmed.ncbi.nlm.nih.gov/31956373" }, { "database": "PubMed", "id": "31980595", "url": "https://pubmed.ncbi.nlm.nih.gov/31980595" }, { "database": "PubMed", "id": "32005799", "url": "https://pubmed.ncbi.nlm.nih.gov/32005799" }, { "database": "PubMed", "id": "32060308", "url": "https://pubmed.ncbi.nlm.nih.gov/32060308" }, { "database": "PubMed", "id": "32171124", "url": "https://pubmed.ncbi.nlm.nih.gov/32171124" }, { "database": "PubMed", "id": "32231398", "url": "https://pubmed.ncbi.nlm.nih.gov/32231398" }, { "database": "PubMed", "id": "32304779", "url": "https://pubmed.ncbi.nlm.nih.gov/32304779" }, { "database": "PubMed", "id": "32319563", "url": "https://pubmed.ncbi.nlm.nih.gov/32319563" }, { "database": "PubMed", "id": "32377705", "url": "https://pubmed.ncbi.nlm.nih.gov/32377705" }, { "database": "PubMed", "id": "32390009", "url": "https://pubmed.ncbi.nlm.nih.gov/32390009" }, { "database": "PubMed", "id": "32491253", "url": "https://pubmed.ncbi.nlm.nih.gov/32491253" }, { "database": "PubMed", "id": "32565533", "url": "https://pubmed.ncbi.nlm.nih.gov/32565533" }, { "database": "PubMed", "id": "32636937", "url": "https://pubmed.ncbi.nlm.nih.gov/32636937" }, { "database": "PubMed", "id": "32716315", "url": "https://pubmed.ncbi.nlm.nih.gov/32716315" }, { "database": "PubMed", "id": "32735617", "url": "https://pubmed.ncbi.nlm.nih.gov/32735617" }, { "database": "PubMed", "id": "32767999", "url": "https://pubmed.ncbi.nlm.nih.gov/32767999" }, { "database": "PubMed", "id": "32774719", "url": "https://pubmed.ncbi.nlm.nih.gov/32774719" }, { "database": "PubMed", "id": "32792856", "url": "https://pubmed.ncbi.nlm.nih.gov/32792856" }, { "database": "PubMed", "id": "32807795", "url": "https://pubmed.ncbi.nlm.nih.gov/32807795" }, { "database": "PubMed", "id": "32972460", "url": "https://pubmed.ncbi.nlm.nih.gov/32972460" }, { "database": "PubMed", "id": "32973302", "url": "https://pubmed.ncbi.nlm.nih.gov/32973302" }, { "database": "PubMed", "id": "33002501", "url": "https://pubmed.ncbi.nlm.nih.gov/33002501" }, { "database": "PubMed", "id": "33040485", "url": "https://pubmed.ncbi.nlm.nih.gov/33040485" }, { "database": "PubMed", "id": "33061855", "url": "https://pubmed.ncbi.nlm.nih.gov/33061855" }, { "database": "PubMed", "id": "33066004", "url": "https://pubmed.ncbi.nlm.nih.gov/33066004" }, { "database": "PubMed", "id": "33098871", "url": "https://pubmed.ncbi.nlm.nih.gov/33098871" }, { "database": "PubMed", "id": "33217668", "url": "https://pubmed.ncbi.nlm.nih.gov/33217668" }, { "database": "PubMed", "id": "33262462", "url": "https://pubmed.ncbi.nlm.nih.gov/33262462" }, { "database": "PubMed", "id": "33279931", "url": "https://pubmed.ncbi.nlm.nih.gov/33279931" }, { "database": "PubMed", "id": "33357429", "url": "https://pubmed.ncbi.nlm.nih.gov/33357429" }, { "database": "PubMed", "id": "33429003", "url": "https://pubmed.ncbi.nlm.nih.gov/33429003" }, { "database": "PubMed", "id": "33446662", "url": "https://pubmed.ncbi.nlm.nih.gov/33446662" }, { "database": "PubMed", "id": "33529218", "url": "https://pubmed.ncbi.nlm.nih.gov/33529218" }, { "database": "PubMed", "id": "33640759", "url": "https://pubmed.ncbi.nlm.nih.gov/33640759" }, { "database": "PubMed", "id": "33660414", "url": "https://pubmed.ncbi.nlm.nih.gov/33660414" }, { "database": "PubMed", "id": "33692335", "url": "https://pubmed.ncbi.nlm.nih.gov/33692335" }, { "database": "PubMed", "id": "33772065", "url": "https://pubmed.ncbi.nlm.nih.gov/33772065" }, { "database": "PubMed", "id": "33782423", "url": "https://pubmed.ncbi.nlm.nih.gov/33782423" }, { "database": "PubMed", "id": "33791043", "url": "https://pubmed.ncbi.nlm.nih.gov/33791043" }, { "database": "PubMed", "id": "33818016", "url": "https://pubmed.ncbi.nlm.nih.gov/33818016" }, { "database": "PubMed", "id": "33968084", "url": "https://pubmed.ncbi.nlm.nih.gov/33968084" }, { "database": "PubMed", "id": "34440160", "url": "https://pubmed.ncbi.nlm.nih.gov/34440160" }, { "database": "PubMed", "id": "34543857", "url": "https://pubmed.ncbi.nlm.nih.gov/34543857" }, { "database": "PubMed", "id": "34908808", "url": "https://pubmed.ncbi.nlm.nih.gov/34908808" }, { "database": "PubMed", "id": "35031324", "url": "https://pubmed.ncbi.nlm.nih.gov/35031324" }, { "database": "PubMed", "id": "35125963", "url": "https://pubmed.ncbi.nlm.nih.gov/35125963" }, { "database": "PubMed", "id": "35566660", "url": "https://pubmed.ncbi.nlm.nih.gov/35566660" }, { "database": "PubMed", "id": "35670018", "url": "https://pubmed.ncbi.nlm.nih.gov/35670018" }, { "database": "PubMed", "id": "35928250", "url": "https://pubmed.ncbi.nlm.nih.gov/35928250" }, { "database": "PubMed", "id": "36017196", "url": "https://pubmed.ncbi.nlm.nih.gov/36017196" }, { "database": "PubMed", "id": "36103247", "url": "https://pubmed.ncbi.nlm.nih.gov/36103247" }, { "database": "PubMed", "id": "36282975", "url": "https://pubmed.ncbi.nlm.nih.gov/36282975" }, { "database": "PubMed", "id": "36443287", "url": "https://pubmed.ncbi.nlm.nih.gov/36443287" }, { "database": "PubMed", "id": "9322921", "url": "https://pubmed.ncbi.nlm.nih.gov/9322921" }, { "database": "PubMed", "id": "9399961", "url": "https://pubmed.ncbi.nlm.nih.gov/9399961" }, { "database": "PubMed", "id": "17875724", "url": "https://pubmed.ncbi.nlm.nih.gov/17875724" }, { "database": "PubMed", "id": "18599021", "url": "https://pubmed.ncbi.nlm.nih.gov/18599021" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "26293184", "url": "https://pubmed.ncbi.nlm.nih.gov/26293184" }, { "database": "PubMed", "id": "31899195", "url": "https://pubmed.ncbi.nlm.nih.gov/31899195" }, { "database": "PubMed", "id": "32797246", "url": "https://pubmed.ncbi.nlm.nih.gov/32797246" } ], "site_lbl": "Ser727", "uniprot_canonical_ac": "P40763-1" } ], "record_id": "pubmed.32377705", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Upregulated sulfatase and downregulated MMP-3 in thoracic aortic aneurysm.", "journal": "Advances in clinical and experimental medicine : official organ Wroclaw Medical University", "date": "2020", "authors": "Matusiewicz M, Rachwalik M, Krzystek-Korpacka M, Bielicki G, Berdowska I, Nowicki R, Gamian A, Jasinski M", "reference": { "type": "PubMed", "id": "32421262", "url": "https://pubmed.ncbi.nlm.nih.gov/32421262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWU6-1", "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "SULF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWU6", "url": "https://www.uniprot.org/uniprotkb/Q8IWU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32421262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LncRNA NEAT1 regulated cell proliferation, invasion, migration and apoptosis by targeting has-miR-376b-3p/SULF1 axis in non-small cell lung cancer.", "journal": "European review for medical and pharmacological sciences", "date": "2020", "authors": "Chen LM, Niu YD, Xiao M, Li XJ, Lin H", "reference": { "type": "PubMed", "id": "32432744", "url": "https://pubmed.ncbi.nlm.nih.gov/32432744" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWU6-1", "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "SULF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWU6", "url": "https://www.uniprot.org/uniprotkb/Q8IWU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32432744", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rs3802278 in 3'-UTR of SULF1 associated with platinum resistance and survival in Chinese epithelial ovarian cancer patients.", "journal": "Journal of chemotherapy (Florence, Italy)", "date": "2021", "authors": "Zeng F, Liu Y, Ouyang Q, Sun Z, Zhang K, Li X, Liu Y", "reference": { "type": "PubMed", "id": "34029511", "url": "https://pubmed.ncbi.nlm.nih.gov/34029511" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWU6-1", "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "SULF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWU6", "url": "https://www.uniprot.org/uniprotkb/Q8IWU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34029511", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EZH2/hSULF1 axis mediates receptor tyrosine kinase signaling to shape cartilage tumor progression.", "journal": "eLife", "date": "2023-01-09", "authors": "Lin Zong-Shin, Chung Chiao-Chen, Liu Yu-Chia, Chang Chu-Han, Liu Hui-Chia, Liang Yung-Yi, Huang Teng-Le, Chen Tsung-Ming, Lee Che-Hsin, Tang Chih-Hsin, Hung Mien-Chie, Chen Ya-Huey", "reference": { "type": "PubMed", "id": "36622753", "url": "https://pubmed.ncbi.nlm.nih.gov/36622753" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWU6-1", "protein_name": "Extracellular sulfatase Sulf-1", "gene_name": "SULF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWU6", "url": "https://www.uniprot.org/uniprotkb/Q8IWU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36622753", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of a sac domain-containing phosphoinositide 5-phosphatase.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Minagawa T, Ijuin T, Mochizuki Y, Takenawa T", "reference": { "type": "PubMed", "id": "11274189", "url": "https://pubmed.ncbi.nlm.nih.gov/11274189" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y2H2", "url": "https://www.uniprot.org/uniprotkb/Q9Y2H2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11274189", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inositol Polyphosphate-5-Phosphatase F (INPP5F) inhibits STAT3 activity and suppresses gliomas tumorigenicity.", "journal": "Scientific reports", "date": "2014", "authors": "Kim HS, Li A, Ahn S, Song H, Zhang W", "reference": { "type": "PubMed", "id": "25476455", "url": "https://pubmed.ncbi.nlm.nih.gov/25476455" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y2H2", "url": "https://www.uniprot.org/uniprotkb/Q9Y2H2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 434, "end_pos": 435, "sequence_org": "EE", "sequence_mut": "AA", "comment": "Inhibits leptin-mediated transactivation of CCND1 promoter. No effect on interaction with INPP5F.", "evidence": [ { "database": "UniProtKB", "id": "P40763", "url": "https://www.uniprot.org/uniprotkb/P40763" }, { "database": "PubMed", "id": "25476455", "url": "https://pubmed.ncbi.nlm.nih.gov/25476455" }, { "database": "PubMed", "id": "17344214", "url": "https://pubmed.ncbi.nlm.nih.gov/17344214" } ], "uniprot_canonical_ac": "P40763-1" } ], "phosphorylation": [ { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FER and PTK6", "evidence": [ { "database": "UniProtKB", "id": "P40763", "url": "https://www.uniprot.org/uniprotkb/P40763" }, { "database": "iPTMnet", "id": "P40763", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40763" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11350938", "url": "https://pubmed.ncbi.nlm.nih.gov/11350938" }, { "database": "PubMed", "id": "11940572", "url": "https://pubmed.ncbi.nlm.nih.gov/11940572" }, { "database": "PubMed", "id": "12244095", "url": "https://pubmed.ncbi.nlm.nih.gov/12244095" }, { "database": "PubMed", "id": "12576423", "url": "https://pubmed.ncbi.nlm.nih.gov/12576423" }, { "database": "PubMed", "id": "12626508", "url": "https://pubmed.ncbi.nlm.nih.gov/12626508" }, { "database": "PubMed", "id": "14551213", "url": "https://pubmed.ncbi.nlm.nih.gov/14551213" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8626374", "url": "https://pubmed.ncbi.nlm.nih.gov/8626374" }, { "database": "IntAct", "id": "P40763", "url": "https://www.ebi.ac.uk/intact/interactors/id:P40763*" }, { "database": "PubMed", "id": "7510216", "url": "https://pubmed.ncbi.nlm.nih.gov/7510216" }, { "database": "PubMed", "id": "8662591", "url": "https://pubmed.ncbi.nlm.nih.gov/8662591" }, { "database": "PubMed", "id": "10446219", "url": "https://pubmed.ncbi.nlm.nih.gov/10446219" }, { "database": "PubMed", "id": "10537060", "url": "https://pubmed.ncbi.nlm.nih.gov/10537060" }, { "database": "PubMed", "id": "10623619", "url": "https://pubmed.ncbi.nlm.nih.gov/10623619" }, { "database": "PubMed", "id": "10660304", "url": "https://pubmed.ncbi.nlm.nih.gov/10660304" }, { "database": "PubMed", "id": "10845908", "url": "https://pubmed.ncbi.nlm.nih.gov/10845908" }, { "database": "PubMed", "id": "11278353", "url": "https://pubmed.ncbi.nlm.nih.gov/11278353" }, { "database": "PubMed", "id": "11278729", "url": "https://pubmed.ncbi.nlm.nih.gov/11278729" }, { "database": "PubMed", "id": "11322950", "url": "https://pubmed.ncbi.nlm.nih.gov/11322950" }, { "database": "PubMed", "id": "11335711", "url": "https://pubmed.ncbi.nlm.nih.gov/11335711" }, { "database": "PubMed", "id": "11378264", "url": "https://pubmed.ncbi.nlm.nih.gov/11378264" }, { "database": "PubMed", "id": "11429693", "url": "https://pubmed.ncbi.nlm.nih.gov/11429693" }, { "database": "PubMed", "id": "11470914", "url": "https://pubmed.ncbi.nlm.nih.gov/11470914" }, { "database": "PubMed", "id": "11553624", "url": "https://pubmed.ncbi.nlm.nih.gov/11553624" }, { "database": "PubMed", "id": "11777539", "url": "https://pubmed.ncbi.nlm.nih.gov/11777539" }, { "database": "PubMed", "id": "12061840", "url": "https://pubmed.ncbi.nlm.nih.gov/12061840" }, { "database": "PubMed", "id": "12208879", "url": "https://pubmed.ncbi.nlm.nih.gov/12208879" }, { "database": "PubMed", "id": "12474230", "url": "https://pubmed.ncbi.nlm.nih.gov/12474230" }, { "database": "PubMed", "id": "12494267", "url": "https://pubmed.ncbi.nlm.nih.gov/12494267" }, { "database": "PubMed", "id": "12670499", "url": "https://pubmed.ncbi.nlm.nih.gov/12670499" }, { "database": "PubMed", "id": "12763138", "url": "https://pubmed.ncbi.nlm.nih.gov/12763138" }, { "database": "PubMed", "id": "12842895", "url": "https://pubmed.ncbi.nlm.nih.gov/12842895" }, { "database": "PubMed", "id": "13678425", "url": "https://pubmed.ncbi.nlm.nih.gov/13678425" }, { "database": "PubMed", "id": "14701810", "url": "https://pubmed.ncbi.nlm.nih.gov/14701810" }, { "database": "PubMed", "id": "14963038", "url": "https://pubmed.ncbi.nlm.nih.gov/14963038" }, { "database": "PubMed", "id": "14996842", "url": "https://pubmed.ncbi.nlm.nih.gov/14996842" }, { "database": "PubMed", "id": "14999683", "url": "https://pubmed.ncbi.nlm.nih.gov/14999683" }, { "database": "PubMed", "id": "15030166", "url": "https://pubmed.ncbi.nlm.nih.gov/15030166" }, { "database": "PubMed", "id": "15143062", "url": "https://pubmed.ncbi.nlm.nih.gov/15143062" }, { "database": "PubMed", "id": "15155836", "url": "https://pubmed.ncbi.nlm.nih.gov/15155836" }, { "database": "PubMed", "id": "15173005", "url": "https://pubmed.ncbi.nlm.nih.gov/15173005" }, { "database": "PubMed", "id": "15174071", "url": "https://pubmed.ncbi.nlm.nih.gov/15174071" }, { "database": "PubMed", "id": "15320963", "url": "https://pubmed.ncbi.nlm.nih.gov/15320963" }, { "database": "PubMed", "id": "15527783", "url": "https://pubmed.ncbi.nlm.nih.gov/15527783" }, { "database": "PubMed", "id": "15705894", "url": "https://pubmed.ncbi.nlm.nih.gov/15705894" }, { "database": "PubMed", "id": "15753368", "url": "https://pubmed.ncbi.nlm.nih.gov/15753368" }, { "database": "PubMed", "id": "15864742", "url": "https://pubmed.ncbi.nlm.nih.gov/15864742" }, { "database": "PubMed", "id": "16048438", "url": "https://pubmed.ncbi.nlm.nih.gov/16048438" }, { "database": "PubMed", "id": "16081048", "url": "https://pubmed.ncbi.nlm.nih.gov/16081048" }, { "database": "PubMed", "id": "16150460", "url": "https://pubmed.ncbi.nlm.nih.gov/16150460" }, { "database": "PubMed", "id": "16247467", "url": "https://pubmed.ncbi.nlm.nih.gov/16247467" }, { "database": "PubMed", "id": "16288304", "url": "https://pubmed.ncbi.nlm.nih.gov/16288304" }, { "database": "PubMed", "id": "16384639", "url": "https://pubmed.ncbi.nlm.nih.gov/16384639" }, { "database": "PubMed", "id": "16401721", "url": "https://pubmed.ncbi.nlm.nih.gov/16401721" }, { "database": "PubMed", "id": "16413037", "url": "https://pubmed.ncbi.nlm.nih.gov/16413037" }, { "database": "PubMed", "id": "16427042", "url": "https://pubmed.ncbi.nlm.nih.gov/16427042" }, { "database": "PubMed", "id": "16455651", "url": "https://pubmed.ncbi.nlm.nih.gov/16455651" }, { "database": "PubMed", "id": "16463269", "url": "https://pubmed.ncbi.nlm.nih.gov/16463269" }, { "database": "PubMed", "id": "16603078", "url": "https://pubmed.ncbi.nlm.nih.gov/16603078" }, { "database": "PubMed", "id": "16613491", "url": "https://pubmed.ncbi.nlm.nih.gov/16613491" }, { "database": "PubMed", "id": "16619044", "url": "https://pubmed.ncbi.nlm.nih.gov/16619044" }, { "database": "PubMed", "id": "16651438", "url": "https://pubmed.ncbi.nlm.nih.gov/16651438" }, { "database": "PubMed", "id": "16669628", "url": "https://pubmed.ncbi.nlm.nih.gov/16669628" }, { "database": "PubMed", "id": "16801397", "url": "https://pubmed.ncbi.nlm.nih.gov/16801397" }, { "database": "PubMed", "id": "16846476", "url": "https://pubmed.ncbi.nlm.nih.gov/16846476" }, { "database": "PubMed", "id": "16849418", "url": "https://pubmed.ncbi.nlm.nih.gov/16849418" }, { "database": "PubMed", "id": "16951338", "url": "https://pubmed.ncbi.nlm.nih.gov/16951338" }, { "database": "PubMed", "id": "17008315", "url": "https://pubmed.ncbi.nlm.nih.gov/17008315" }, { "database": "PubMed", "id": "17173857", "url": "https://pubmed.ncbi.nlm.nih.gov/17173857" }, { "database": "PubMed", "id": "17176261", "url": "https://pubmed.ncbi.nlm.nih.gov/17176261" }, { "database": "PubMed", "id": "17202361", "url": "https://pubmed.ncbi.nlm.nih.gov/17202361" }, { "database": "PubMed", "id": "17204573", "url": "https://pubmed.ncbi.nlm.nih.gov/17204573" }, { "database": "PubMed", "id": "17237271", "url": "https://pubmed.ncbi.nlm.nih.gov/17237271" }, { "database": "PubMed", "id": "17311011", "url": "https://pubmed.ncbi.nlm.nih.gov/17311011" }, { "database": "PubMed", "id": "17341659", "url": "https://pubmed.ncbi.nlm.nih.gov/17341659" }, { "database": "PubMed", "id": "17432718", "url": "https://pubmed.ncbi.nlm.nih.gov/17432718" }, { "database": "PubMed", "id": "17543278", "url": "https://pubmed.ncbi.nlm.nih.gov/17543278" }, { "database": "PubMed", "id": "17575268", "url": "https://pubmed.ncbi.nlm.nih.gov/17575268" }, { "database": "PubMed", "id": "17586727", "url": "https://pubmed.ncbi.nlm.nih.gov/17586727" }, { "database": "PubMed", "id": "17616983", "url": "https://pubmed.ncbi.nlm.nih.gov/17616983" }, { "database": "PubMed", "id": "17670892", "url": "https://pubmed.ncbi.nlm.nih.gov/17670892" }, { "database": "PubMed", "id": "17761947", "url": "https://pubmed.ncbi.nlm.nih.gov/17761947" }, { "database": "PubMed", "id": "17931419", "url": "https://pubmed.ncbi.nlm.nih.gov/17931419" }, { "database": "PubMed", "id": "17967179", "url": "https://pubmed.ncbi.nlm.nih.gov/17967179" }, { "database": "PubMed", "id": "18196976", "url": "https://pubmed.ncbi.nlm.nih.gov/18196976" }, { "database": "PubMed", "id": "18198175", "url": "https://pubmed.ncbi.nlm.nih.gov/18198175" }, { "database": "PubMed", "id": "18203738", "url": "https://pubmed.ncbi.nlm.nih.gov/18203738" }, { "database": "PubMed", "id": "18204781", "url": "https://pubmed.ncbi.nlm.nih.gov/18204781" }, { "database": "PubMed", "id": "18353781", "url": "https://pubmed.ncbi.nlm.nih.gov/18353781" }, { "database": "PubMed", "id": "18365011", "url": "https://pubmed.ncbi.nlm.nih.gov/18365011" }, { "database": "PubMed", "id": "18463684", "url": "https://pubmed.ncbi.nlm.nih.gov/18463684" }, { "database": "PubMed", "id": "18498667", "url": "https://pubmed.ncbi.nlm.nih.gov/18498667" }, { "database": "PubMed", "id": "18519681", "url": "https://pubmed.ncbi.nlm.nih.gov/18519681" }, { "database": "PubMed", "id": "18525315", "url": "https://pubmed.ncbi.nlm.nih.gov/18525315" }, { "database": "PubMed", "id": "18544087", "url": "https://pubmed.ncbi.nlm.nih.gov/18544087" }, { "database": "PubMed", "id": "18550668", "url": "https://pubmed.ncbi.nlm.nih.gov/18550668" }, { "database": "PubMed", "id": "18593565", "url": "https://pubmed.ncbi.nlm.nih.gov/18593565" }, { "database": "PubMed", "id": "18612371", "url": "https://pubmed.ncbi.nlm.nih.gov/18612371" }, { "database": "PubMed", "id": "18755267", "url": "https://pubmed.ncbi.nlm.nih.gov/18755267" }, { "database": "PubMed", "id": "18755494", "url": "https://pubmed.ncbi.nlm.nih.gov/18755494" }, { "database": "PubMed", "id": "18779368", "url": "https://pubmed.ncbi.nlm.nih.gov/18779368" }, { "database": "PubMed", "id": "18790750", "url": "https://pubmed.ncbi.nlm.nih.gov/18790750" }, { "database": "PubMed", "id": "18939995", "url": "https://pubmed.ncbi.nlm.nih.gov/18939995" }, { "database": "PubMed", "id": "18941632", "url": "https://pubmed.ncbi.nlm.nih.gov/18941632" }, { "database": "PubMed", "id": "18995957", "url": "https://pubmed.ncbi.nlm.nih.gov/18995957" }, { "database": "PubMed", "id": "19001435", "url": "https://pubmed.ncbi.nlm.nih.gov/19001435" }, { "database": "PubMed", "id": "19025606", "url": "https://pubmed.ncbi.nlm.nih.gov/19025606" }, { "database": "PubMed", "id": "19118003", "url": "https://pubmed.ncbi.nlm.nih.gov/19118003" }, { "database": "PubMed", "id": "19182994", "url": "https://pubmed.ncbi.nlm.nih.gov/19182994" }, { "database": "PubMed", "id": "19201396", "url": "https://pubmed.ncbi.nlm.nih.gov/19201396" }, { "database": "PubMed", "id": "19232485", "url": "https://pubmed.ncbi.nlm.nih.gov/19232485" }, { "database": "PubMed", "id": "19351839", "url": "https://pubmed.ncbi.nlm.nih.gov/19351839" }, { "database": "PubMed", "id": "19421230", "url": "https://pubmed.ncbi.nlm.nih.gov/19421230" }, { "database": "PubMed", "id": "19440292", "url": "https://pubmed.ncbi.nlm.nih.gov/19440292" }, { "database": "PubMed", "id": "19506034", "url": "https://pubmed.ncbi.nlm.nih.gov/19506034" }, { "database": "PubMed", "id": "19595669", "url": "https://pubmed.ncbi.nlm.nih.gov/19595669" }, { "database": "PubMed", "id": "19623660", "url": "https://pubmed.ncbi.nlm.nih.gov/19623660" }, { "database": "PubMed", "id": "19712481", "url": "https://pubmed.ncbi.nlm.nih.gov/19712481" }, { "database": "PubMed", "id": "19723038", "url": "https://pubmed.ncbi.nlm.nih.gov/19723038" }, { "database": "PubMed", "id": "19741197", "url": "https://pubmed.ncbi.nlm.nih.gov/19741197" }, { "database": "PubMed", "id": "19744341", "url": "https://pubmed.ncbi.nlm.nih.gov/19744341" }, { "database": "PubMed", "id": "19754877", "url": "https://pubmed.ncbi.nlm.nih.gov/19754877" }, { "database": "PubMed", "id": "19764570", "url": "https://pubmed.ncbi.nlm.nih.gov/19764570" }, { "database": "PubMed", "id": "19808903", "url": "https://pubmed.ncbi.nlm.nih.gov/19808903" }, { "database": "PubMed", "id": "19821497", "url": "https://pubmed.ncbi.nlm.nih.gov/19821497" }, { "database": "PubMed", "id": "19901082", "url": "https://pubmed.ncbi.nlm.nih.gov/19901082" }, { "database": "PubMed", "id": "19903761", "url": "https://pubmed.ncbi.nlm.nih.gov/19903761" }, { "database": "PubMed", "id": "19903771", "url": "https://pubmed.ncbi.nlm.nih.gov/19903771" }, { "database": "PubMed", "id": "19995546", "url": "https://pubmed.ncbi.nlm.nih.gov/19995546" }, { "database": "PubMed", "id": "20072652", "url": "https://pubmed.ncbi.nlm.nih.gov/20072652" }, { "database": "PubMed", "id": "20156552", "url": "https://pubmed.ncbi.nlm.nih.gov/20156552" }, { "database": "PubMed", "id": "20169197", "url": "https://pubmed.ncbi.nlm.nih.gov/20169197" }, { "database": "PubMed", "id": "20228845", "url": "https://pubmed.ncbi.nlm.nih.gov/20228845" }, { "database": "PubMed", "id": "20233902", "url": "https://pubmed.ncbi.nlm.nih.gov/20233902" }, { "database": "PubMed", "id": "20351777", "url": "https://pubmed.ncbi.nlm.nih.gov/20351777" }, { "database": "PubMed", "id": "20371721", "url": "https://pubmed.ncbi.nlm.nih.gov/20371721" }, { "database": "PubMed", "id": "20455003", "url": "https://pubmed.ncbi.nlm.nih.gov/20455003" }, { "database": "PubMed", "id": "20507639", "url": "https://pubmed.ncbi.nlm.nih.gov/20507639" }, { "database": "PubMed", "id": "20534983", "url": "https://pubmed.ncbi.nlm.nih.gov/20534983" }, { "database": "PubMed", "id": "20576164", "url": "https://pubmed.ncbi.nlm.nih.gov/20576164" }, { "database": "PubMed", "id": "20589525", "url": "https://pubmed.ncbi.nlm.nih.gov/20589525" }, { "database": "PubMed", "id": "20712901", "url": "https://pubmed.ncbi.nlm.nih.gov/20712901" }, { "database": "PubMed", "id": "20724373", "url": "https://pubmed.ncbi.nlm.nih.gov/20724373" }, { "database": "PubMed", "id": "20808823", "url": "https://pubmed.ncbi.nlm.nih.gov/20808823" }, { "database": "PubMed", "id": "20840775", "url": "https://pubmed.ncbi.nlm.nih.gov/20840775" }, { "database": "PubMed", "id": "20851386", "url": "https://pubmed.ncbi.nlm.nih.gov/20851386" }, { "database": "PubMed", "id": "20877211", "url": "https://pubmed.ncbi.nlm.nih.gov/20877211" }, { "database": "PubMed", "id": "20959517", "url": "https://pubmed.ncbi.nlm.nih.gov/20959517" }, { "database": "PubMed", "id": "20977777", "url": "https://pubmed.ncbi.nlm.nih.gov/20977777" }, { "database": "PubMed", "id": "21098725", "url": "https://pubmed.ncbi.nlm.nih.gov/21098725" }, { "database": "PubMed", "id": "21122157", "url": "https://pubmed.ncbi.nlm.nih.gov/21122157" }, { "database": "PubMed", "id": "21163886", "url": "https://pubmed.ncbi.nlm.nih.gov/21163886" }, { "database": "PubMed", "id": "21253577", "url": "https://pubmed.ncbi.nlm.nih.gov/21253577" }, { "database": "PubMed", "id": "21254404", "url": "https://pubmed.ncbi.nlm.nih.gov/21254404" }, { "database": "PubMed", "id": "21311975", "url": "https://pubmed.ncbi.nlm.nih.gov/21311975" }, { "database": "PubMed", "id": "21360612", "url": "https://pubmed.ncbi.nlm.nih.gov/21360612" }, { "database": "PubMed", "id": "21369699", "url": "https://pubmed.ncbi.nlm.nih.gov/21369699" }, { "database": "PubMed", "id": "21388555", "url": "https://pubmed.ncbi.nlm.nih.gov/21388555" }, { "database": "PubMed", "id": "21435102", "url": "https://pubmed.ncbi.nlm.nih.gov/21435102" }, { "database": "PubMed", "id": "21443800", "url": "https://pubmed.ncbi.nlm.nih.gov/21443800" }, { "database": "PubMed", "id": "21486470", "url": "https://pubmed.ncbi.nlm.nih.gov/21486470" }, { "database": "PubMed", "id": "21490133", "url": "https://pubmed.ncbi.nlm.nih.gov/21490133" }, { "database": "PubMed", "id": "21524651", "url": "https://pubmed.ncbi.nlm.nih.gov/21524651" }, { "database": "PubMed", "id": "21526200", "url": "https://pubmed.ncbi.nlm.nih.gov/21526200" }, { "database": "PubMed", "id": "21538419", "url": "https://pubmed.ncbi.nlm.nih.gov/21538419" }, { "database": "PubMed", "id": "21625473", "url": "https://pubmed.ncbi.nlm.nih.gov/21625473" }, { "database": "PubMed", "id": "21625522", "url": "https://pubmed.ncbi.nlm.nih.gov/21625522" }, { "database": "PubMed", "id": "21625597", "url": "https://pubmed.ncbi.nlm.nih.gov/21625597" }, { "database": "PubMed", "id": "21654841", "url": "https://pubmed.ncbi.nlm.nih.gov/21654841" }, { "database": "PubMed", "id": "21655185", "url": "https://pubmed.ncbi.nlm.nih.gov/21655185" }, { "database": "PubMed", "id": "21677772", "url": "https://pubmed.ncbi.nlm.nih.gov/21677772" }, { "database": "PubMed", "id": "21685938", "url": "https://pubmed.ncbi.nlm.nih.gov/21685938" }, { "database": "PubMed", "id": "21689417", "url": "https://pubmed.ncbi.nlm.nih.gov/21689417" }, { "database": "PubMed", "id": "21690253", "url": "https://pubmed.ncbi.nlm.nih.gov/21690253" }, { "database": "PubMed", "id": "21694723", "url": "https://pubmed.ncbi.nlm.nih.gov/21694723" }, { "database": "PubMed", "id": "21730976", "url": "https://pubmed.ncbi.nlm.nih.gov/21730976" }, { "database": "PubMed", "id": "21738667", "url": "https://pubmed.ncbi.nlm.nih.gov/21738667" }, { "database": "PubMed", "id": "21785467", "url": "https://pubmed.ncbi.nlm.nih.gov/21785467" }, { "database": "PubMed", "id": "21799891", "url": "https://pubmed.ncbi.nlm.nih.gov/21799891" }, { "database": "PubMed", "id": "21801384", "url": "https://pubmed.ncbi.nlm.nih.gov/21801384" }, { "database": "PubMed", "id": "21840932", "url": "https://pubmed.ncbi.nlm.nih.gov/21840932" }, { "database": "PubMed", "id": "21906308", "url": "https://pubmed.ncbi.nlm.nih.gov/21906308" }, { "database": "PubMed", "id": "21915376", "url": "https://pubmed.ncbi.nlm.nih.gov/21915376" }, { "database": "PubMed", "id": "21931595", "url": "https://pubmed.ncbi.nlm.nih.gov/21931595" }, { "database": "PubMed", "id": "21954831", "url": "https://pubmed.ncbi.nlm.nih.gov/21954831" }, { "database": "PubMed", "id": "22016776", "url": "https://pubmed.ncbi.nlm.nih.gov/22016776" }, { "database": "PubMed", "id": "22110204", "url": "https://pubmed.ncbi.nlm.nih.gov/22110204" }, { "database": "PubMed", "id": "22142222", "url": "https://pubmed.ncbi.nlm.nih.gov/22142222" }, { "database": "PubMed", "id": "22174695", "url": "https://pubmed.ncbi.nlm.nih.gov/22174695" }, { "database": "PubMed", "id": "22174819", "url": "https://pubmed.ncbi.nlm.nih.gov/22174819" }, { "database": "PubMed", "id": "22179221", "url": "https://pubmed.ncbi.nlm.nih.gov/22179221" }, { "database": "PubMed", "id": "22210382", "url": "https://pubmed.ncbi.nlm.nih.gov/22210382" }, { "database": "PubMed", "id": "22259633", "url": "https://pubmed.ncbi.nlm.nih.gov/22259633" }, { "database": "PubMed", "id": "22279540", "url": "https://pubmed.ncbi.nlm.nih.gov/22279540" }, { "database": "PubMed", "id": "22280969", "url": "https://pubmed.ncbi.nlm.nih.gov/22280969" }, { "database": "PubMed", "id": "22313388", "url": "https://pubmed.ncbi.nlm.nih.gov/22313388" }, { "database": "PubMed", "id": "22315522", "url": "https://pubmed.ncbi.nlm.nih.gov/22315522" }, { "database": "PubMed", "id": "22349830", "url": "https://pubmed.ncbi.nlm.nih.gov/22349830" }, { "database": "PubMed", "id": "22351606", "url": "https://pubmed.ncbi.nlm.nih.gov/22351606" }, { "database": "PubMed", "id": "22359610", "url": "https://pubmed.ncbi.nlm.nih.gov/22359610" }, { "database": "PubMed", "id": "22366233", "url": "https://pubmed.ncbi.nlm.nih.gov/22366233" }, { "database": "PubMed", "id": "22370645", "url": "https://pubmed.ncbi.nlm.nih.gov/22370645" }, { "database": "PubMed", "id": "22374428", "url": "https://pubmed.ncbi.nlm.nih.gov/22374428" }, { "database": "PubMed", "id": "22406995", "url": "https://pubmed.ncbi.nlm.nih.gov/22406995" }, { "database": "PubMed", "id": "22418867", "url": "https://pubmed.ncbi.nlm.nih.gov/22418867" }, { "database": "PubMed", "id": "22450744", "url": "https://pubmed.ncbi.nlm.nih.gov/22450744" }, { "database": "PubMed", "id": "22461519", "url": "https://pubmed.ncbi.nlm.nih.gov/22461519" }, { "database": "PubMed", "id": "22465052", "url": "https://pubmed.ncbi.nlm.nih.gov/22465052" }, { "database": "PubMed", "id": "22484976", "url": "https://pubmed.ncbi.nlm.nih.gov/22484976" }, { "database": "PubMed", "id": "22504904", "url": "https://pubmed.ncbi.nlm.nih.gov/22504904" }, { "database": "PubMed", "id": "22522613", "url": "https://pubmed.ncbi.nlm.nih.gov/22522613" }, { "database": "PubMed", "id": "22581261", "url": "https://pubmed.ncbi.nlm.nih.gov/22581261" }, { "database": "PubMed", "id": "22642622", "url": "https://pubmed.ncbi.nlm.nih.gov/22642622" }, { "database": "PubMed", "id": "22677902", "url": "https://pubmed.ncbi.nlm.nih.gov/22677902" }, { "database": "PubMed", "id": "22754353", "url": "https://pubmed.ncbi.nlm.nih.gov/22754353" }, { "database": "PubMed", "id": "22799634", "url": "https://pubmed.ncbi.nlm.nih.gov/22799634" }, { "database": "PubMed", "id": "22801507", "url": "https://pubmed.ncbi.nlm.nih.gov/22801507" }, { "database": "PubMed", "id": "22824293", "url": "https://pubmed.ncbi.nlm.nih.gov/22824293" }, { "database": "PubMed", "id": "22829072", "url": "https://pubmed.ncbi.nlm.nih.gov/22829072" }, { "database": "PubMed", "id": "22870139", "url": "https://pubmed.ncbi.nlm.nih.gov/22870139" }, { "database": "PubMed", "id": "22899991", "url": "https://pubmed.ncbi.nlm.nih.gov/22899991" }, { "database": "PubMed", "id": "22905257", "url": "https://pubmed.ncbi.nlm.nih.gov/22905257" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22922995", "url": "https://pubmed.ncbi.nlm.nih.gov/22922995" }, { "database": "PubMed", "id": "22937084", "url": "https://pubmed.ncbi.nlm.nih.gov/22937084" }, { "database": "PubMed", "id": "22978563", "url": "https://pubmed.ncbi.nlm.nih.gov/22978563" }, { "database": "PubMed", "id": "22984561", "url": "https://pubmed.ncbi.nlm.nih.gov/22984561" }, { "database": "PubMed", "id": "22987802", "url": "https://pubmed.ncbi.nlm.nih.gov/22987802" }, { "database": "PubMed", "id": "23007731", "url": "https://pubmed.ncbi.nlm.nih.gov/23007731" }, { "database": "PubMed", "id": "23056374", "url": "https://pubmed.ncbi.nlm.nih.gov/23056374" }, { "database": "PubMed", "id": "23056515", "url": "https://pubmed.ncbi.nlm.nih.gov/23056515" }, { "database": "PubMed", "id": "23074171", "url": "https://pubmed.ncbi.nlm.nih.gov/23074171" }, { "database": "PubMed", "id": "23094050", "url": "https://pubmed.ncbi.nlm.nih.gov/23094050" }, { "database": "PubMed", "id": "23108098", "url": "https://pubmed.ncbi.nlm.nih.gov/23108098" }, { "database": "PubMed", "id": "23125416", "url": "https://pubmed.ncbi.nlm.nih.gov/23125416" }, { "database": "PubMed", "id": "23166634", "url": "https://pubmed.ncbi.nlm.nih.gov/23166634" }, { "database": "PubMed", "id": "23189171", "url": "https://pubmed.ncbi.nlm.nih.gov/23189171" }, { "database": "PubMed", "id": "23226414", "url": "https://pubmed.ncbi.nlm.nih.gov/23226414" }, { "database": "PubMed", "id": "23251493", "url": "https://pubmed.ncbi.nlm.nih.gov/23251493" }, { "database": "PubMed", "id": "23279849", "url": "https://pubmed.ncbi.nlm.nih.gov/23279849" }, { "database": "PubMed", "id": "23303450", "url": "https://pubmed.ncbi.nlm.nih.gov/23303450" }, { "database": "PubMed", "id": "23318430", "url": "https://pubmed.ncbi.nlm.nih.gov/23318430" }, { "database": "PubMed", "id": "23322008", "url": "https://pubmed.ncbi.nlm.nih.gov/23322008" }, { "database": "PubMed", "id": "23326583", "url": "https://pubmed.ncbi.nlm.nih.gov/23326583" }, { "database": "PubMed", "id": "23350355", "url": "https://pubmed.ncbi.nlm.nih.gov/23350355" }, { "database": "PubMed", "id": "23372833", "url": "https://pubmed.ncbi.nlm.nih.gov/23372833" }, { "database": "PubMed", "id": "23382914", "url": "https://pubmed.ncbi.nlm.nih.gov/23382914" }, { "database": "PubMed", "id": "23416975", "url": "https://pubmed.ncbi.nlm.nih.gov/23416975" }, { "database": "PubMed", "id": "23434226", "url": "https://pubmed.ncbi.nlm.nih.gov/23434226" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23446809", "url": "https://pubmed.ncbi.nlm.nih.gov/23446809" }, { "database": "PubMed", "id": "23455323", "url": "https://pubmed.ncbi.nlm.nih.gov/23455323" }, { "database": "PubMed", "id": "23496892", "url": "https://pubmed.ncbi.nlm.nih.gov/23496892" }, { "database": "PubMed", "id": "23525442", "url": "https://pubmed.ncbi.nlm.nih.gov/23525442" }, { "database": "PubMed", "id": "23528817", "url": "https://pubmed.ncbi.nlm.nih.gov/23528817" }, { "database": "PubMed", "id": "23614738", "url": "https://pubmed.ncbi.nlm.nih.gov/23614738" }, { "database": "PubMed", "id": "23637829", "url": "https://pubmed.ncbi.nlm.nih.gov/23637829" }, { "database": "PubMed", "id": "23686305", "url": "https://pubmed.ncbi.nlm.nih.gov/23686305" }, { "database": "PubMed", "id": "23686482", "url": "https://pubmed.ncbi.nlm.nih.gov/23686482" }, { "database": "PubMed", "id": "23690956", "url": "https://pubmed.ncbi.nlm.nih.gov/23690956" }, { "database": "PubMed", "id": "23704931", "url": "https://pubmed.ncbi.nlm.nih.gov/23704931" }, { "database": "PubMed", "id": "23740516", "url": "https://pubmed.ncbi.nlm.nih.gov/23740516" }, { "database": "PubMed", "id": "23755918", "url": "https://pubmed.ncbi.nlm.nih.gov/23755918" }, { "database": "PubMed", "id": "23756865", "url": "https://pubmed.ncbi.nlm.nih.gov/23756865" }, { "database": "PubMed", "id": "23774064", "url": "https://pubmed.ncbi.nlm.nih.gov/23774064" }, { "database": "PubMed", "id": "23776396", "url": "https://pubmed.ncbi.nlm.nih.gov/23776396" }, { "database": "PubMed", "id": "23782265", "url": "https://pubmed.ncbi.nlm.nih.gov/23782265" }, { "database": "PubMed", "id": "23831387", "url": "https://pubmed.ncbi.nlm.nih.gov/23831387" }, { "database": "PubMed", "id": "23861822", "url": "https://pubmed.ncbi.nlm.nih.gov/23861822" }, { "database": "PubMed", "id": "23872421", "url": "https://pubmed.ncbi.nlm.nih.gov/23872421" }, { "database": "PubMed", "id": "23874455", "url": "https://pubmed.ncbi.nlm.nih.gov/23874455" }, { "database": "PubMed", "id": "23889739", "url": "https://pubmed.ncbi.nlm.nih.gov/23889739" }, { "database": "PubMed", "id": "23894143", "url": "https://pubmed.ncbi.nlm.nih.gov/23894143" }, { "database": "PubMed", "id": "23903834", "url": "https://pubmed.ncbi.nlm.nih.gov/23903834" }, { "database": "PubMed", "id": "23923048", "url": "https://pubmed.ncbi.nlm.nih.gov/23923048" }, { "database": "PubMed", "id": "23928694", "url": "https://pubmed.ncbi.nlm.nih.gov/23928694" }, { "database": "PubMed", "id": "23936533", "url": "https://pubmed.ncbi.nlm.nih.gov/23936533" }, { "database": "PubMed", "id": "23947369", "url": "https://pubmed.ncbi.nlm.nih.gov/23947369" }, { "database": "PubMed", "id": "23967200", "url": "https://pubmed.ncbi.nlm.nih.gov/23967200" }, { "database": "PubMed", "id": "23991099", "url": "https://pubmed.ncbi.nlm.nih.gov/23991099" }, { "database": "PubMed", "id": "24015205", "url": "https://pubmed.ncbi.nlm.nih.gov/24015205" }, { "database": "PubMed", "id": "24019973", "url": "https://pubmed.ncbi.nlm.nih.gov/24019973" }, { "database": "PubMed", "id": "24043762", "url": "https://pubmed.ncbi.nlm.nih.gov/24043762" }, { "database": "PubMed", "id": "24048798", "url": "https://pubmed.ncbi.nlm.nih.gov/24048798" }, { "database": "PubMed", "id": "24058749", "url": "https://pubmed.ncbi.nlm.nih.gov/24058749" }, { "database": "PubMed", "id": "24058783", "url": "https://pubmed.ncbi.nlm.nih.gov/24058783" }, { "database": "PubMed", "id": "24063605", "url": "https://pubmed.ncbi.nlm.nih.gov/24063605" }, { "database": "PubMed", "id": "24069562", "url": "https://pubmed.ncbi.nlm.nih.gov/24069562" }, { "database": "PubMed", "id": "24086526", "url": "https://pubmed.ncbi.nlm.nih.gov/24086526" }, { "database": "PubMed", "id": "24090995", "url": "https://pubmed.ncbi.nlm.nih.gov/24090995" }, { "database": "PubMed", "id": "24098663", "url": "https://pubmed.ncbi.nlm.nih.gov/24098663" }, { "database": "PubMed", "id": "24129709", "url": "https://pubmed.ncbi.nlm.nih.gov/24129709" }, { "database": "PubMed", "id": "24154873", "url": "https://pubmed.ncbi.nlm.nih.gov/24154873" }, { "database": "PubMed", "id": "24164699", "url": "https://pubmed.ncbi.nlm.nih.gov/24164699" }, { "database": "PubMed", "id": "24165129", "url": "https://pubmed.ncbi.nlm.nih.gov/24165129" }, { "database": "PubMed", "id": "24192293", "url": "https://pubmed.ncbi.nlm.nih.gov/24192293" }, { "database": "PubMed", "id": "24280348", "url": "https://pubmed.ncbi.nlm.nih.gov/24280348" }, { "database": "PubMed", "id": "24288470", "url": "https://pubmed.ncbi.nlm.nih.gov/24288470" }, { "database": "PubMed", "id": "24312439", "url": "https://pubmed.ncbi.nlm.nih.gov/24312439" }, { "database": "PubMed", "id": "24314214", "url": "https://pubmed.ncbi.nlm.nih.gov/24314214" }, { "database": "PubMed", "id": "24317090", "url": "https://pubmed.ncbi.nlm.nih.gov/24317090" }, { "database": "PubMed", "id": "24319264", "url": "https://pubmed.ncbi.nlm.nih.gov/24319264" }, { "database": "PubMed", "id": "24324713", "url": "https://pubmed.ncbi.nlm.nih.gov/24324713" }, { "database": "PubMed", "id": "24348829", "url": "https://pubmed.ncbi.nlm.nih.gov/24348829" }, { "database": "PubMed", "id": "24418169", "url": "https://pubmed.ncbi.nlm.nih.gov/24418169" }, { "database": "PubMed", "id": "24423131", "url": "https://pubmed.ncbi.nlm.nih.gov/24423131" }, { "database": "PubMed", "id": "24499623", "url": "https://pubmed.ncbi.nlm.nih.gov/24499623" }, { "database": "PubMed", "id": "24505404", "url": "https://pubmed.ncbi.nlm.nih.gov/24505404" }, { "database": "PubMed", "id": "24520293", "url": "https://pubmed.ncbi.nlm.nih.gov/24520293" }, { "database": "PubMed", "id": "24533098", "url": "https://pubmed.ncbi.nlm.nih.gov/24533098" }, { "database": "PubMed", "id": "24586249", "url": "https://pubmed.ncbi.nlm.nih.gov/24586249" }, { "database": "PubMed", "id": "24602263", "url": "https://pubmed.ncbi.nlm.nih.gov/24602263" }, { "database": "PubMed", "id": "24615012", "url": "https://pubmed.ncbi.nlm.nih.gov/24615012" }, { "database": "PubMed", "id": "24622734", "url": "https://pubmed.ncbi.nlm.nih.gov/24622734" }, { "database": "PubMed", "id": "24652192", "url": "https://pubmed.ncbi.nlm.nih.gov/24652192" }, { "database": "PubMed", "id": "24661007", "url": "https://pubmed.ncbi.nlm.nih.gov/24661007" }, { "database": "PubMed", "id": "24671465", "url": "https://pubmed.ncbi.nlm.nih.gov/24671465" }, { "database": "PubMed", "id": "24671708", "url": "https://pubmed.ncbi.nlm.nih.gov/24671708" }, { "database": "PubMed", "id": "24687132", "url": "https://pubmed.ncbi.nlm.nih.gov/24687132" }, { "database": "PubMed", "id": "24707243", "url": "https://pubmed.ncbi.nlm.nih.gov/24707243" }, { "database": "PubMed", "id": "24726840", "url": "https://pubmed.ncbi.nlm.nih.gov/24726840" }, { "database": "PubMed", "id": "24736071", "url": "https://pubmed.ncbi.nlm.nih.gov/24736071" }, { "database": "PubMed", "id": "24756126", "url": "https://pubmed.ncbi.nlm.nih.gov/24756126" }, { "database": "PubMed", "id": "24799285", "url": "https://pubmed.ncbi.nlm.nih.gov/24799285" }, { "database": "PubMed", "id": "24846175", "url": "https://pubmed.ncbi.nlm.nih.gov/24846175" }, { "database": "PubMed", "id": "24855827", "url": "https://pubmed.ncbi.nlm.nih.gov/24855827" }, { "database": "PubMed", "id": "24909826", "url": "https://pubmed.ncbi.nlm.nih.gov/24909826" }, { "database": "PubMed", "id": "24930769", "url": "https://pubmed.ncbi.nlm.nih.gov/24930769" }, { "database": "PubMed", "id": "24931163", "url": "https://pubmed.ncbi.nlm.nih.gov/24931163" }, { "database": "PubMed", "id": "24932134", "url": "https://pubmed.ncbi.nlm.nih.gov/24932134" }, { "database": "PubMed", "id": "24945434", "url": "https://pubmed.ncbi.nlm.nih.gov/24945434" }, { "database": "PubMed", "id": "24953430", "url": "https://pubmed.ncbi.nlm.nih.gov/24953430" }, { "database": "PubMed", "id": "24954857", "url": "https://pubmed.ncbi.nlm.nih.gov/24954857" }, { "database": "PubMed", "id": "24970801", "url": "https://pubmed.ncbi.nlm.nih.gov/24970801" }, { "database": "PubMed", "id": "24978112", "url": "https://pubmed.ncbi.nlm.nih.gov/24978112" }, { "database": "PubMed", "id": "25013907", "url": "https://pubmed.ncbi.nlm.nih.gov/25013907" }, { "database": "PubMed", "id": "25016575", "url": "https://pubmed.ncbi.nlm.nih.gov/25016575" }, { "database": "PubMed", "id": "25031733", "url": "https://pubmed.ncbi.nlm.nih.gov/25031733" }, { "database": "PubMed", "id": "25036749", "url": "https://pubmed.ncbi.nlm.nih.gov/25036749" }, { "database": "PubMed", "id": "25040935", "url": "https://pubmed.ncbi.nlm.nih.gov/25040935" }, { "database": "PubMed", "id": "25047660", "url": "https://pubmed.ncbi.nlm.nih.gov/25047660" }, { "database": "PubMed", "id": "25071018", "url": "https://pubmed.ncbi.nlm.nih.gov/25071018" }, { "database": "PubMed", "id": "25072782", "url": "https://pubmed.ncbi.nlm.nih.gov/25072782" }, { "database": "PubMed", "id": "25101566", "url": "https://pubmed.ncbi.nlm.nih.gov/25101566" }, { "database": "PubMed", "id": "25116684", "url": "https://pubmed.ncbi.nlm.nih.gov/25116684" }, { "database": "PubMed", "id": "25200966", "url": "https://pubmed.ncbi.nlm.nih.gov/25200966" }, { "database": "PubMed", "id": "25216529", "url": "https://pubmed.ncbi.nlm.nih.gov/25216529" }, { "database": "PubMed", "id": "25217633", "url": "https://pubmed.ncbi.nlm.nih.gov/25217633" }, { "database": "PubMed", "id": "25226283", "url": "https://pubmed.ncbi.nlm.nih.gov/25226283" }, { "database": "PubMed", "id": "25231320", "url": "https://pubmed.ncbi.nlm.nih.gov/25231320" }, { "database": "PubMed", "id": "25246098", "url": "https://pubmed.ncbi.nlm.nih.gov/25246098" }, { "database": "PubMed", "id": "25252914", "url": "https://pubmed.ncbi.nlm.nih.gov/25252914" }, { "database": "PubMed", "id": "25266665", "url": "https://pubmed.ncbi.nlm.nih.gov/25266665" }, { "database": "PubMed", "id": "25296502", "url": "https://pubmed.ncbi.nlm.nih.gov/25296502" }, { "database": "PubMed", "id": "25299776", "url": "https://pubmed.ncbi.nlm.nih.gov/25299776" }, { "database": "PubMed", "id": "25327561", "url": "https://pubmed.ncbi.nlm.nih.gov/25327561" }, { "database": "PubMed", "id": "25360179", "url": "https://pubmed.ncbi.nlm.nih.gov/25360179" }, { "database": "PubMed", "id": "25373509", "url": "https://pubmed.ncbi.nlm.nih.gov/25373509" }, { "database": "PubMed", "id": "25383546", "url": "https://pubmed.ncbi.nlm.nih.gov/25383546" }, { "database": "PubMed", "id": "25393367", "url": "https://pubmed.ncbi.nlm.nih.gov/25393367" }, { "database": "PubMed", "id": "25401333", "url": "https://pubmed.ncbi.nlm.nih.gov/25401333" }, { "database": "PubMed", "id": "25417721", "url": "https://pubmed.ncbi.nlm.nih.gov/25417721" }, { "database": "PubMed", "id": "25452693", "url": "https://pubmed.ncbi.nlm.nih.gov/25452693" }, { "database": "PubMed", "id": "25476455", "url": "https://pubmed.ncbi.nlm.nih.gov/25476455" }, { "database": "PubMed", "id": "25486864", "url": "https://pubmed.ncbi.nlm.nih.gov/25486864" }, { "database": "PubMed", "id": "25512602", "url": "https://pubmed.ncbi.nlm.nih.gov/25512602" }, { "database": "PubMed", "id": "25539644", "url": "https://pubmed.ncbi.nlm.nih.gov/25539644" }, { "database": "PubMed", "id": "25544757", "url": "https://pubmed.ncbi.nlm.nih.gov/25544757" }, { "database": "PubMed", "id": "25548514", "url": "https://pubmed.ncbi.nlm.nih.gov/25548514" }, { "database": "PubMed", "id": "25561562", "url": "https://pubmed.ncbi.nlm.nih.gov/25561562" }, { "database": "PubMed", "id": "25584415", "url": "https://pubmed.ncbi.nlm.nih.gov/25584415" }, { "database": "PubMed", "id": "25594014", "url": "https://pubmed.ncbi.nlm.nih.gov/25594014" }, { "database": "PubMed", "id": "25597412", "url": "https://pubmed.ncbi.nlm.nih.gov/25597412" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25612622", "url": "https://pubmed.ncbi.nlm.nih.gov/25612622" }, { "database": "PubMed", "id": "25622587", "url": "https://pubmed.ncbi.nlm.nih.gov/25622587" }, { "database": "PubMed", "id": "25661370", "url": "https://pubmed.ncbi.nlm.nih.gov/25661370" }, { "database": "PubMed", "id": "25684140", "url": "https://pubmed.ncbi.nlm.nih.gov/25684140" }, { "database": "PubMed", "id": "25687700", "url": "https://pubmed.ncbi.nlm.nih.gov/25687700" }, { "database": "PubMed", "id": "25699542", "url": "https://pubmed.ncbi.nlm.nih.gov/25699542" }, { "database": "PubMed", "id": "25734337", "url": "https://pubmed.ncbi.nlm.nih.gov/25734337" }, { "database": "PubMed", "id": "25736961", "url": "https://pubmed.ncbi.nlm.nih.gov/25736961" }, { "database": "PubMed", "id": "25744297", "url": "https://pubmed.ncbi.nlm.nih.gov/25744297" }, { "database": "PubMed", "id": "25750173", "url": "https://pubmed.ncbi.nlm.nih.gov/25750173" }, { "database": "PubMed", "id": "25789077", "url": "https://pubmed.ncbi.nlm.nih.gov/25789077" }, { "database": "PubMed", "id": "25793261", "url": "https://pubmed.ncbi.nlm.nih.gov/25793261" }, { "database": "PubMed", "id": "25811798", "url": "https://pubmed.ncbi.nlm.nih.gov/25811798" }, { "database": "PubMed", "id": "25843671", "url": "https://pubmed.ncbi.nlm.nih.gov/25843671" }, { "database": "PubMed", "id": "25849286", "url": "https://pubmed.ncbi.nlm.nih.gov/25849286" }, { "database": "PubMed", "id": "25869100", "url": "https://pubmed.ncbi.nlm.nih.gov/25869100" }, { "database": "PubMed", "id": "25879763", "url": "https://pubmed.ncbi.nlm.nih.gov/25879763" }, { "database": "PubMed", "id": "25881314", "url": "https://pubmed.ncbi.nlm.nih.gov/25881314" }, { "database": "PubMed", "id": "25883212", "url": "https://pubmed.ncbi.nlm.nih.gov/25883212" }, { "database": "PubMed", "id": "25915430", "url": "https://pubmed.ncbi.nlm.nih.gov/25915430" }, { "database": "PubMed", "id": "25928665", "url": "https://pubmed.ncbi.nlm.nih.gov/25928665" }, { "database": "PubMed", "id": "25947346", "url": "https://pubmed.ncbi.nlm.nih.gov/25947346" }, { "database": "PubMed", "id": "25961376", "url": "https://pubmed.ncbi.nlm.nih.gov/25961376" }, { "database": "PubMed", "id": "25968054", "url": "https://pubmed.ncbi.nlm.nih.gov/25968054" }, { "database": "PubMed", "id": "25984943", "url": "https://pubmed.ncbi.nlm.nih.gov/25984943" }, { "database": "PubMed", "id": "26008966", "url": "https://pubmed.ncbi.nlm.nih.gov/26008966" }, { "database": "PubMed", "id": "26028030", "url": "https://pubmed.ncbi.nlm.nih.gov/26028030" }, { "database": "PubMed", "id": "26041409", "url": "https://pubmed.ncbi.nlm.nih.gov/26041409" }, { "database": "PubMed", "id": "26045618", "url": "https://pubmed.ncbi.nlm.nih.gov/26045618" }, { "database": "PubMed", "id": "26051842", "url": "https://pubmed.ncbi.nlm.nih.gov/26051842" }, { "database": "PubMed", "id": "26055806", "url": "https://pubmed.ncbi.nlm.nih.gov/26055806" }, { "database": "PubMed", "id": "26068861", "url": "https://pubmed.ncbi.nlm.nih.gov/26068861" }, { "database": "PubMed", "id": "26084289", "url": "https://pubmed.ncbi.nlm.nih.gov/26084289" }, { "database": "PubMed", "id": "26090459", "url": "https://pubmed.ncbi.nlm.nih.gov/26090459" }, { "database": "PubMed", "id": "26136691", "url": "https://pubmed.ncbi.nlm.nih.gov/26136691" }, { "database": "PubMed", "id": "26138072", "url": "https://pubmed.ncbi.nlm.nih.gov/26138072" }, { "database": "PubMed", "id": "26166037", "url": "https://pubmed.ncbi.nlm.nih.gov/26166037" }, { "database": "PubMed", "id": "26175331", "url": "https://pubmed.ncbi.nlm.nih.gov/26175331" }, { "database": "PubMed", "id": "26212545", "url": "https://pubmed.ncbi.nlm.nih.gov/26212545" }, { "database": "PubMed", "id": "26215634", "url": "https://pubmed.ncbi.nlm.nih.gov/26215634" }, { "database": "PubMed", "id": "26215971", "url": "https://pubmed.ncbi.nlm.nih.gov/26215971" }, { "database": "PubMed", "id": "26279438", "url": "https://pubmed.ncbi.nlm.nih.gov/26279438" }, { "database": "PubMed", "id": "26283544", "url": "https://pubmed.ncbi.nlm.nih.gov/26283544" }, { "database": "PubMed", "id": "26307676", "url": "https://pubmed.ncbi.nlm.nih.gov/26307676" }, { "database": "PubMed", "id": "26329521", "url": "https://pubmed.ncbi.nlm.nih.gov/26329521" }, { "database": "PubMed", "id": "26343524", "url": "https://pubmed.ncbi.nlm.nih.gov/26343524" }, { "database": "PubMed", "id": "26359029", "url": "https://pubmed.ncbi.nlm.nih.gov/26359029" }, { "database": "PubMed", "id": "26376676", "url": "https://pubmed.ncbi.nlm.nih.gov/26376676" }, { "database": "PubMed", "id": "26396689", "url": "https://pubmed.ncbi.nlm.nih.gov/26396689" }, { "database": "PubMed", "id": "26410177", "url": "https://pubmed.ncbi.nlm.nih.gov/26410177" }, { "database": "PubMed", "id": "26418031", "url": "https://pubmed.ncbi.nlm.nih.gov/26418031" }, { "database": "PubMed", "id": "26430964", "url": "https://pubmed.ncbi.nlm.nih.gov/26430964" }, { "database": "PubMed", "id": "26452542", "url": "https://pubmed.ncbi.nlm.nih.gov/26452542" }, { "database": "PubMed", "id": "26459366", "url": "https://pubmed.ncbi.nlm.nih.gov/26459366" }, { "database": "PubMed", "id": "26485029", "url": "https://pubmed.ncbi.nlm.nih.gov/26485029" }, { "database": "PubMed", "id": "26486080", "url": "https://pubmed.ncbi.nlm.nih.gov/26486080" }, { "database": "PubMed", "id": "26528725", "url": "https://pubmed.ncbi.nlm.nih.gov/26528725" }, { "database": "PubMed", "id": "26542452", "url": "https://pubmed.ncbi.nlm.nih.gov/26542452" }, { "database": "PubMed", "id": "26549437", "url": "https://pubmed.ncbi.nlm.nih.gov/26549437" }, { "database": "PubMed", "id": "26549519", "url": "https://pubmed.ncbi.nlm.nih.gov/26549519" }, { "database": "PubMed", "id": "26575169", "url": "https://pubmed.ncbi.nlm.nih.gov/26575169" }, { "database": "PubMed", "id": "26580615", "url": "https://pubmed.ncbi.nlm.nih.gov/26580615" }, { "database": "PubMed", "id": "26610526", "url": "https://pubmed.ncbi.nlm.nih.gov/26610526" }, { "database": "PubMed", "id": "26646010", "url": "https://pubmed.ncbi.nlm.nih.gov/26646010" }, { "database": "PubMed", "id": "26657118", "url": "https://pubmed.ncbi.nlm.nih.gov/26657118" }, { "database": "PubMed", "id": "26664907", "url": "https://pubmed.ncbi.nlm.nih.gov/26664907" }, { "database": "PubMed", "id": "26667266", "url": "https://pubmed.ncbi.nlm.nih.gov/26667266" }, { "database": "PubMed", "id": "26700461", "url": "https://pubmed.ncbi.nlm.nih.gov/26700461" }, { "database": "PubMed", "id": "26755645", "url": "https://pubmed.ncbi.nlm.nih.gov/26755645" }, { "database": "PubMed", "id": "26799670", "url": "https://pubmed.ncbi.nlm.nih.gov/26799670" }, { "database": "PubMed", "id": "26807955", "url": "https://pubmed.ncbi.nlm.nih.gov/26807955" }, { "database": "PubMed", "id": "26843613", "url": "https://pubmed.ncbi.nlm.nih.gov/26843613" }, { "database": "PubMed", "id": "26848618", "url": "https://pubmed.ncbi.nlm.nih.gov/26848618" }, { "database": "PubMed", "id": "26883202", "url": "https://pubmed.ncbi.nlm.nih.gov/26883202" }, { "database": "PubMed", "id": "26883847", "url": "https://pubmed.ncbi.nlm.nih.gov/26883847" }, { "database": "PubMed", "id": "26893174", "url": "https://pubmed.ncbi.nlm.nih.gov/26893174" }, { "database": "PubMed", "id": "26893580", "url": "https://pubmed.ncbi.nlm.nih.gov/26893580" }, { "database": "PubMed", "id": "26898989", "url": "https://pubmed.ncbi.nlm.nih.gov/26898989" }, { "database": "PubMed", "id": "26904942", "url": "https://pubmed.ncbi.nlm.nih.gov/26904942" }, { "database": "PubMed", "id": "26904961", "url": "https://pubmed.ncbi.nlm.nih.gov/26904961" }, { "database": "PubMed", "id": "26909608", "url": "https://pubmed.ncbi.nlm.nih.gov/26909608" }, { "database": "PubMed", "id": "26911335", "url": "https://pubmed.ncbi.nlm.nih.gov/26911335" }, { "database": "PubMed", "id": "26921179", "url": "https://pubmed.ncbi.nlm.nih.gov/26921179" }, { "database": "PubMed", "id": "26926996", "url": "https://pubmed.ncbi.nlm.nih.gov/26926996" }, { "database": "PubMed", "id": "26927669", "url": "https://pubmed.ncbi.nlm.nih.gov/26927669" }, { "database": "PubMed", "id": "26949510", "url": "https://pubmed.ncbi.nlm.nih.gov/26949510" }, { "database": "PubMed", "id": "26956050", "url": "https://pubmed.ncbi.nlm.nih.gov/26956050" }, { "database": "PubMed", "id": "26959890", "url": "https://pubmed.ncbi.nlm.nih.gov/26959890" }, { "database": "PubMed", "id": "26967055", "url": "https://pubmed.ncbi.nlm.nih.gov/26967055" }, { "database": "PubMed", "id": "26974964", "url": "https://pubmed.ncbi.nlm.nih.gov/26974964" }, { "database": "PubMed", "id": "27009358", "url": "https://pubmed.ncbi.nlm.nih.gov/27009358" }, { "database": "PubMed", "id": "27036022", "url": "https://pubmed.ncbi.nlm.nih.gov/27036022" }, { "database": "PubMed", "id": "27050371", "url": "https://pubmed.ncbi.nlm.nih.gov/27050371" }, { "database": "PubMed", "id": "27064016", "url": "https://pubmed.ncbi.nlm.nih.gov/27064016" }, { "database": "PubMed", "id": "27080861", "url": "https://pubmed.ncbi.nlm.nih.gov/27080861" }, { "database": "PubMed", "id": "27107422", "url": "https://pubmed.ncbi.nlm.nih.gov/27107422" }, { "database": "PubMed", "id": "27121055", "url": "https://pubmed.ncbi.nlm.nih.gov/27121055" }, { "database": "PubMed", "id": "27145367", "url": "https://pubmed.ncbi.nlm.nih.gov/27145367" }, { "database": "PubMed", "id": "27151455", "url": "https://pubmed.ncbi.nlm.nih.gov/27151455" }, { "database": "PubMed", "id": "27181202", "url": "https://pubmed.ncbi.nlm.nih.gov/27181202" }, { "database": "PubMed", "id": "27200496", "url": "https://pubmed.ncbi.nlm.nih.gov/27200496" }, { "database": "PubMed", "id": "27216197", "url": "https://pubmed.ncbi.nlm.nih.gov/27216197" }, { "database": "PubMed", "id": "27264264", "url": "https://pubmed.ncbi.nlm.nih.gov/27264264" }, { "database": "PubMed", "id": "27274723", "url": "https://pubmed.ncbi.nlm.nih.gov/27274723" }, { "database": "PubMed", "id": "27279256", "url": "https://pubmed.ncbi.nlm.nih.gov/27279256" }, { "database": "PubMed", "id": "27292026", "url": "https://pubmed.ncbi.nlm.nih.gov/27292026" }, { "database": "PubMed", "id": "27317770", "url": "https://pubmed.ncbi.nlm.nih.gov/27317770" }, { "database": "PubMed", "id": "27323414", "url": "https://pubmed.ncbi.nlm.nih.gov/27323414" }, { "database": "PubMed", "id": "27326257", "url": "https://pubmed.ncbi.nlm.nih.gov/27326257" }, { "database": "PubMed", "id": "27344175", "url": "https://pubmed.ncbi.nlm.nih.gov/27344175" }, { "database": "PubMed", "id": "27362806", "url": "https://pubmed.ncbi.nlm.nih.gov/27362806" }, { "database": "PubMed", "id": "27373978", "url": "https://pubmed.ncbi.nlm.nih.gov/27373978" }, { "database": "PubMed", "id": "27384401", "url": "https://pubmed.ncbi.nlm.nih.gov/27384401" }, { "database": "PubMed", "id": "27418138", "url": "https://pubmed.ncbi.nlm.nih.gov/27418138" }, { "database": "PubMed", "id": "27419630", "url": "https://pubmed.ncbi.nlm.nih.gov/27419630" }, { "database": "PubMed", "id": "27428425", "url": "https://pubmed.ncbi.nlm.nih.gov/27428425" }, { "database": "PubMed", "id": "27456333", "url": "https://pubmed.ncbi.nlm.nih.gov/27456333" }, { "database": "PubMed", "id": "27457246", "url": "https://pubmed.ncbi.nlm.nih.gov/27457246" }, { "database": "PubMed", "id": "27458171", "url": "https://pubmed.ncbi.nlm.nih.gov/27458171" }, { "database": "PubMed", "id": "27462789", "url": "https://pubmed.ncbi.nlm.nih.gov/27462789" }, { "database": "PubMed", "id": "27486258", "url": "https://pubmed.ncbi.nlm.nih.gov/27486258" }, { "database": "PubMed", "id": "27502076", "url": "https://pubmed.ncbi.nlm.nih.gov/27502076" }, { "database": "PubMed", "id": "27537522", "url": "https://pubmed.ncbi.nlm.nih.gov/27537522" }, { "database": "PubMed", "id": "27555284", "url": "https://pubmed.ncbi.nlm.nih.gov/27555284" }, { "database": "PubMed", "id": "27602766", "url": "https://pubmed.ncbi.nlm.nih.gov/27602766" }, { "database": "PubMed", "id": "27616044", "url": "https://pubmed.ncbi.nlm.nih.gov/27616044" }, { "database": "PubMed", "id": "27624867", "url": "https://pubmed.ncbi.nlm.nih.gov/27624867" }, { "database": "PubMed", "id": "27626315", "url": "https://pubmed.ncbi.nlm.nih.gov/27626315" }, { "database": "PubMed", "id": "27658964", "url": "https://pubmed.ncbi.nlm.nih.gov/27658964" }, { "database": "PubMed", "id": "27660268", "url": "https://pubmed.ncbi.nlm.nih.gov/27660268" }, { "database": "PubMed", "id": "27687804", "url": "https://pubmed.ncbi.nlm.nih.gov/27687804" }, { "database": "PubMed", "id": "27694691", "url": "https://pubmed.ncbi.nlm.nih.gov/27694691" }, { "database": "PubMed", "id": "27705908", "url": "https://pubmed.ncbi.nlm.nih.gov/27705908" }, { "database": "PubMed", "id": "27708408", "url": "https://pubmed.ncbi.nlm.nih.gov/27708408" }, { "database": "PubMed", "id": "27732936", "url": "https://pubmed.ncbi.nlm.nih.gov/27732936" }, { "database": "PubMed", "id": "27748760", "url": "https://pubmed.ncbi.nlm.nih.gov/27748760" }, { "database": "PubMed", "id": "27748818", "url": "https://pubmed.ncbi.nlm.nih.gov/27748818" }, { "database": "PubMed", "id": "27806334", "url": "https://pubmed.ncbi.nlm.nih.gov/27806334" }, { "database": "PubMed", "id": "27824155", "url": "https://pubmed.ncbi.nlm.nih.gov/27824155" }, { "database": "PubMed", "id": "27834930", "url": "https://pubmed.ncbi.nlm.nih.gov/27834930" }, { "database": "PubMed", "id": "27845909", "url": "https://pubmed.ncbi.nlm.nih.gov/27845909" }, { "database": "PubMed", "id": "27855189", "url": "https://pubmed.ncbi.nlm.nih.gov/27855189" }, { "database": "PubMed", "id": "27855669", "url": "https://pubmed.ncbi.nlm.nih.gov/27855669" }, { "database": "PubMed", "id": "27861147", "url": "https://pubmed.ncbi.nlm.nih.gov/27861147" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "27864909", "url": "https://pubmed.ncbi.nlm.nih.gov/27864909" }, { "database": "PubMed", "id": "27871173", "url": "https://pubmed.ncbi.nlm.nih.gov/27871173" }, { "database": "PubMed", "id": "27888804", "url": "https://pubmed.ncbi.nlm.nih.gov/27888804" }, { "database": "PubMed", "id": "27903968", "url": "https://pubmed.ncbi.nlm.nih.gov/27903968" }, { "database": "PubMed", "id": "27977009", "url": "https://pubmed.ncbi.nlm.nih.gov/27977009" }, { "database": "PubMed", "id": "28000790", "url": "https://pubmed.ncbi.nlm.nih.gov/28000790" }, { "database": "PubMed", "id": "28004755", "url": "https://pubmed.ncbi.nlm.nih.gov/28004755" }, { "database": "PubMed", "id": "28017654", "url": "https://pubmed.ncbi.nlm.nih.gov/28017654" }, { "database": "PubMed", "id": "28030813", "url": "https://pubmed.ncbi.nlm.nih.gov/28030813" }, { "database": "PubMed", "id": "28035720", "url": "https://pubmed.ncbi.nlm.nih.gov/28035720" }, { "database": "PubMed", "id": "28053540", "url": "https://pubmed.ncbi.nlm.nih.gov/28053540" }, { "database": "PubMed", "id": "28054649", "url": "https://pubmed.ncbi.nlm.nih.gov/28054649" }, { "database": "PubMed", "id": "28055016", "url": "https://pubmed.ncbi.nlm.nih.gov/28055016" }, { "database": "PubMed", "id": "28100038", "url": "https://pubmed.ncbi.nlm.nih.gov/28100038" }, { "database": "PubMed", "id": "28123608", "url": "https://pubmed.ncbi.nlm.nih.gov/28123608" }, { "database": "PubMed", "id": "28125678", "url": "https://pubmed.ncbi.nlm.nih.gov/28125678" }, { "database": "PubMed", "id": "28134252", "url": "https://pubmed.ncbi.nlm.nih.gov/28134252" }, { "database": "PubMed", "id": "28138036", "url": "https://pubmed.ncbi.nlm.nih.gov/28138036" }, { "database": "PubMed", "id": "28150703", "url": "https://pubmed.ncbi.nlm.nih.gov/28150703" }, { "database": "PubMed", "id": "28150717", "url": "https://pubmed.ncbi.nlm.nih.gov/28150717" }, { "database": "PubMed", "id": "28157205", "url": "https://pubmed.ncbi.nlm.nih.gov/28157205" }, { "database": "PubMed", "id": "28157698", "url": "https://pubmed.ncbi.nlm.nih.gov/28157698" }, { "database": "PubMed", "id": "28157712", "url": "https://pubmed.ncbi.nlm.nih.gov/28157712" }, { "database": "PubMed", "id": "28159925", "url": "https://pubmed.ncbi.nlm.nih.gov/28159925" }, { "database": "PubMed", "id": "28160777", "url": "https://pubmed.ncbi.nlm.nih.gov/28160777" }, { "database": "PubMed", "id": "28207963", "url": "https://pubmed.ncbi.nlm.nih.gov/28207963" }, { "database": "PubMed", "id": "28222632", "url": "https://pubmed.ncbi.nlm.nih.gov/28222632" }, { "database": "PubMed", "id": "28223425", "url": "https://pubmed.ncbi.nlm.nih.gov/28223425" }, { "database": "PubMed", "id": "28228214", "url": "https://pubmed.ncbi.nlm.nih.gov/28228214" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28264935", "url": "https://pubmed.ncbi.nlm.nih.gov/28264935" }, { "database": "PubMed", "id": "28276425", "url": "https://pubmed.ncbi.nlm.nih.gov/28276425" }, { "database": "PubMed", "id": "28280036", "url": "https://pubmed.ncbi.nlm.nih.gov/28280036" }, { "database": "PubMed", "id": "28345832", "url": "https://pubmed.ncbi.nlm.nih.gov/28345832" }, { "database": "PubMed", "id": "28350008", "url": "https://pubmed.ncbi.nlm.nih.gov/28350008" }, { "database": "PubMed", "id": "28367059", "url": "https://pubmed.ncbi.nlm.nih.gov/28367059" }, { "database": "PubMed", "id": "28376152", "url": "https://pubmed.ncbi.nlm.nih.gov/28376152" }, { "database": "PubMed", "id": "28384648", "url": "https://pubmed.ncbi.nlm.nih.gov/28384648" }, { "database": "PubMed", "id": "28388577", "url": "https://pubmed.ncbi.nlm.nih.gov/28388577" }, { "database": "PubMed", "id": "28397855", "url": "https://pubmed.ncbi.nlm.nih.gov/28397855" }, { "database": "PubMed", "id": "28415760", "url": "https://pubmed.ncbi.nlm.nih.gov/28415760" }, { "database": "PubMed", "id": "28427199", "url": "https://pubmed.ncbi.nlm.nih.gov/28427199" }, { "database": "PubMed", "id": "28427224", "url": "https://pubmed.ncbi.nlm.nih.gov/28427224" }, { "database": "PubMed", "id": "28430601", "url": "https://pubmed.ncbi.nlm.nih.gov/28430601" }, { "database": "PubMed", "id": "28432285", "url": "https://pubmed.ncbi.nlm.nih.gov/28432285" }, { "database": "PubMed", "id": "28469272", "url": "https://pubmed.ncbi.nlm.nih.gov/28469272" }, { "database": "PubMed", "id": "28483518", "url": "https://pubmed.ncbi.nlm.nih.gov/28483518" }, { "database": "PubMed", "id": "28492557", "url": "https://pubmed.ncbi.nlm.nih.gov/28492557" }, { "database": "PubMed", "id": "28500786", "url": "https://pubmed.ncbi.nlm.nih.gov/28500786" }, { "database": "PubMed", "id": "28503147", "url": "https://pubmed.ncbi.nlm.nih.gov/28503147" }, { "database": "PubMed", "id": "28520923", "url": "https://pubmed.ncbi.nlm.nih.gov/28520923" }, { "database": "PubMed", "id": "28526807", "url": "https://pubmed.ncbi.nlm.nih.gov/28526807" }, { "database": "PubMed", "id": "28526849", "url": "https://pubmed.ncbi.nlm.nih.gov/28526849" }, { "database": "PubMed", "id": "28542650", "url": "https://pubmed.ncbi.nlm.nih.gov/28542650" }, { "database": "PubMed", "id": "28549350", "url": "https://pubmed.ncbi.nlm.nih.gov/28549350" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28560454", "url": "https://pubmed.ncbi.nlm.nih.gov/28560454" }, { "database": "PubMed", "id": "28572601", "url": "https://pubmed.ncbi.nlm.nih.gov/28572601" }, { "database": "PubMed", "id": "28574510", "url": "https://pubmed.ncbi.nlm.nih.gov/28574510" }, { "database": "PubMed", "id": "28588262", "url": "https://pubmed.ncbi.nlm.nih.gov/28588262" }, { "database": "PubMed", "id": "28629363", "url": "https://pubmed.ncbi.nlm.nih.gov/28629363" }, { "database": "PubMed", "id": "28634059", "url": "https://pubmed.ncbi.nlm.nih.gov/28634059" }, { "database": "PubMed", "id": "28636670", "url": "https://pubmed.ncbi.nlm.nih.gov/28636670" }, { "database": "PubMed", "id": "28654902", "url": "https://pubmed.ncbi.nlm.nih.gov/28654902" }, { "database": "PubMed", "id": "28661045", "url": "https://pubmed.ncbi.nlm.nih.gov/28661045" }, { "database": "PubMed", "id": "28664080", "url": "https://pubmed.ncbi.nlm.nih.gov/28664080" }, { "database": "PubMed", "id": "28666623", "url": "https://pubmed.ncbi.nlm.nih.gov/28666623" }, { "database": "PubMed", "id": "28670112", "url": "https://pubmed.ncbi.nlm.nih.gov/28670112" }, { "database": "PubMed", "id": "28672024", "url": "https://pubmed.ncbi.nlm.nih.gov/28672024" }, { "database": "PubMed", "id": "28676732", "url": "https://pubmed.ncbi.nlm.nih.gov/28676732" }, { "database": "PubMed", "id": "28705432", "url": "https://pubmed.ncbi.nlm.nih.gov/28705432" }, { "database": "PubMed", "id": "28720093", "url": "https://pubmed.ncbi.nlm.nih.gov/28720093" }, { "database": "PubMed", "id": "28745314", "url": "https://pubmed.ncbi.nlm.nih.gov/28745314" }, { "database": "PubMed", "id": "28750624", "url": "https://pubmed.ncbi.nlm.nih.gov/28750624" }, { "database": "PubMed", "id": "28757590", "url": "https://pubmed.ncbi.nlm.nih.gov/28757590" }, { "database": "PubMed", "id": "28781685", "url": "https://pubmed.ncbi.nlm.nih.gov/28781685" }, { "database": "PubMed", "id": "28783167", "url": "https://pubmed.ncbi.nlm.nih.gov/28783167" }, { "database": "PubMed", "id": "28785079", "url": "https://pubmed.ncbi.nlm.nih.gov/28785079" }, { "database": "PubMed", "id": "28785380", "url": "https://pubmed.ncbi.nlm.nih.gov/28785380" }, { "database": "PubMed", "id": "28859117", "url": "https://pubmed.ncbi.nlm.nih.gov/28859117" }, { "database": "PubMed", "id": "28881473", "url": "https://pubmed.ncbi.nlm.nih.gov/28881473" }, { "database": "PubMed", "id": "28883791", "url": "https://pubmed.ncbi.nlm.nih.gov/28883791" }, { "database": "PubMed", "id": "28884137", "url": "https://pubmed.ncbi.nlm.nih.gov/28884137" }, { "database": "PubMed", "id": "28903349", "url": "https://pubmed.ncbi.nlm.nih.gov/28903349" }, { "database": "PubMed", "id": "28918059", "url": "https://pubmed.ncbi.nlm.nih.gov/28918059" }, { "database": "PubMed", "id": "29024195", "url": "https://pubmed.ncbi.nlm.nih.gov/29024195" }, { "database": "PubMed", "id": "29050232", "url": "https://pubmed.ncbi.nlm.nih.gov/29050232" }, { "database": "PubMed", "id": "29062282", "url": "https://pubmed.ncbi.nlm.nih.gov/29062282" }, { "database": "PubMed", "id": "29082496", "url": "https://pubmed.ncbi.nlm.nih.gov/29082496" }, { "database": "PubMed", "id": "29088733", "url": "https://pubmed.ncbi.nlm.nih.gov/29088733" }, { "database": "PubMed", "id": "29126425", "url": "https://pubmed.ncbi.nlm.nih.gov/29126425" }, { "database": "PubMed", "id": "29133922", "url": "https://pubmed.ncbi.nlm.nih.gov/29133922" }, { "database": "PubMed", "id": "29142074", "url": "https://pubmed.ncbi.nlm.nih.gov/29142074" }, { "database": "PubMed", "id": "29158850", "url": "https://pubmed.ncbi.nlm.nih.gov/29158850" }, { "database": "PubMed", "id": "29162862", "url": "https://pubmed.ncbi.nlm.nih.gov/29162862" }, { "database": "PubMed", "id": "29174507", "url": "https://pubmed.ncbi.nlm.nih.gov/29174507" }, { "database": "PubMed", "id": "29179471", "url": "https://pubmed.ncbi.nlm.nih.gov/29179471" }, { "database": "PubMed", "id": "29180818", "url": "https://pubmed.ncbi.nlm.nih.gov/29180818" }, { "database": "PubMed", "id": "29182685", "url": "https://pubmed.ncbi.nlm.nih.gov/29182685" }, { "database": "PubMed", "id": "29185442", "url": "https://pubmed.ncbi.nlm.nih.gov/29185442" }, { "database": "PubMed", "id": "29190960", "url": "https://pubmed.ncbi.nlm.nih.gov/29190960" }, { "database": "PubMed", "id": "29207075", "url": "https://pubmed.ncbi.nlm.nih.gov/29207075" }, { "database": "PubMed", "id": "29207614", "url": "https://pubmed.ncbi.nlm.nih.gov/29207614" }, { "database": "PubMed", "id": "29212252", "url": "https://pubmed.ncbi.nlm.nih.gov/29212252" }, { "database": "PubMed", "id": "29228628", "url": "https://pubmed.ncbi.nlm.nih.gov/29228628" }, { "database": "PubMed", "id": "29229958", "url": "https://pubmed.ncbi.nlm.nih.gov/29229958" }, { "database": "PubMed", "id": "29234062", "url": "https://pubmed.ncbi.nlm.nih.gov/29234062" }, { "database": "PubMed", "id": "29242509", "url": "https://pubmed.ncbi.nlm.nih.gov/29242509" }, { "database": "PubMed", "id": "29253028", "url": "https://pubmed.ncbi.nlm.nih.gov/29253028" }, { "database": "PubMed", "id": "29254221", "url": "https://pubmed.ncbi.nlm.nih.gov/29254221" }, { "database": "PubMed", "id": "29263930", "url": "https://pubmed.ncbi.nlm.nih.gov/29263930" }, { "database": "PubMed", "id": "29270528", "url": "https://pubmed.ncbi.nlm.nih.gov/29270528" }, { "database": "PubMed", "id": "29286132", "url": "https://pubmed.ncbi.nlm.nih.gov/29286132" }, { "database": "PubMed", "id": "29290793", "url": "https://pubmed.ncbi.nlm.nih.gov/29290793" }, { "database": "PubMed", "id": "29309895", "url": "https://pubmed.ncbi.nlm.nih.gov/29309895" }, { "database": "PubMed", "id": "29330478", "url": "https://pubmed.ncbi.nlm.nih.gov/29330478" }, { "database": "PubMed", "id": "29351406", "url": "https://pubmed.ncbi.nlm.nih.gov/29351406" }, { "database": "PubMed", "id": "29402895", "url": "https://pubmed.ncbi.nlm.nih.gov/29402895" }, { "database": "PubMed", "id": "29423098", "url": "https://pubmed.ncbi.nlm.nih.gov/29423098" }, { "database": "PubMed", "id": "29449694", "url": "https://pubmed.ncbi.nlm.nih.gov/29449694" }, { "database": "PubMed", "id": "29456111", "url": "https://pubmed.ncbi.nlm.nih.gov/29456111" }, { "database": "PubMed", "id": "29456240", "url": "https://pubmed.ncbi.nlm.nih.gov/29456240" }, { "database": "PubMed", "id": "29464030", "url": "https://pubmed.ncbi.nlm.nih.gov/29464030" }, { "database": "PubMed", "id": "29488000", "url": "https://pubmed.ncbi.nlm.nih.gov/29488000" }, { "database": "PubMed", "id": "29499951", "url": "https://pubmed.ncbi.nlm.nih.gov/29499951" }, { "database": "PubMed", "id": "29511087", "url": "https://pubmed.ncbi.nlm.nih.gov/29511087" }, { "database": "PubMed", "id": "29511600", "url": "https://pubmed.ncbi.nlm.nih.gov/29511600" }, { "database": "PubMed", "id": "29518696", "url": "https://pubmed.ncbi.nlm.nih.gov/29518696" }, { "database": "PubMed", "id": "29540666", "url": "https://pubmed.ncbi.nlm.nih.gov/29540666" }, { "database": "PubMed", "id": "29565987", "url": "https://pubmed.ncbi.nlm.nih.gov/29565987" }, { "database": "PubMed", "id": "29566069", "url": "https://pubmed.ncbi.nlm.nih.gov/29566069" }, { "database": "PubMed", "id": "29571296", "url": "https://pubmed.ncbi.nlm.nih.gov/29571296" }, { "database": "PubMed", "id": "29595328", "url": "https://pubmed.ncbi.nlm.nih.gov/29595328" }, { "database": "PubMed", "id": "29599917", "url": "https://pubmed.ncbi.nlm.nih.gov/29599917" }, { "database": "PubMed", "id": "29606890", "url": "https://pubmed.ncbi.nlm.nih.gov/29606890" }, { "database": "PubMed", "id": "29630659", "url": "https://pubmed.ncbi.nlm.nih.gov/29630659" }, { "database": "PubMed", "id": "29636527", "url": "https://pubmed.ncbi.nlm.nih.gov/29636527" }, { "database": "PubMed", "id": "29637003", "url": "https://pubmed.ncbi.nlm.nih.gov/29637003" }, { "database": "PubMed", "id": "29652915", "url": "https://pubmed.ncbi.nlm.nih.gov/29652915" }, { "database": "PubMed", "id": "29660364", "url": "https://pubmed.ncbi.nlm.nih.gov/29660364" }, { "database": "PubMed", "id": "29666362", "url": "https://pubmed.ncbi.nlm.nih.gov/29666362" }, { "database": "PubMed", "id": "29682112", "url": "https://pubmed.ncbi.nlm.nih.gov/29682112" }, { "database": "PubMed", "id": "29686295", "url": "https://pubmed.ncbi.nlm.nih.gov/29686295" }, { "database": "PubMed", "id": "29717134", "url": "https://pubmed.ncbi.nlm.nih.gov/29717134" }, { "database": "PubMed", "id": "29721383", "url": "https://pubmed.ncbi.nlm.nih.gov/29721383" }, { "database": "PubMed", "id": "29749438", "url": "https://pubmed.ncbi.nlm.nih.gov/29749438" }, { "database": "PubMed", "id": "29765448", "url": "https://pubmed.ncbi.nlm.nih.gov/29765448" }, { "database": "PubMed", "id": "29774125", "url": "https://pubmed.ncbi.nlm.nih.gov/29774125" }, { "database": "PubMed", "id": "29795016", "url": "https://pubmed.ncbi.nlm.nih.gov/29795016" }, { "database": "PubMed", "id": "29805309", "url": "https://pubmed.ncbi.nlm.nih.gov/29805309" }, { "database": "PubMed", "id": "29807795", "url": "https://pubmed.ncbi.nlm.nih.gov/29807795" }, { "database": "PubMed", "id": "29855616", "url": "https://pubmed.ncbi.nlm.nih.gov/29855616" }, { "database": "PubMed", "id": "29891854", "url": "https://pubmed.ncbi.nlm.nih.gov/29891854" }, { "database": "PubMed", "id": "29892198", "url": "https://pubmed.ncbi.nlm.nih.gov/29892198" }, { "database": "PubMed", "id": "29901083", "url": "https://pubmed.ncbi.nlm.nih.gov/29901083" }, { "database": "PubMed", "id": "29904948", "url": "https://pubmed.ncbi.nlm.nih.gov/29904948" }, { "database": "PubMed", "id": "29915371", "url": "https://pubmed.ncbi.nlm.nih.gov/29915371" }, { "database": "PubMed", "id": "29920512", "url": "https://pubmed.ncbi.nlm.nih.gov/29920512" }, { "database": "PubMed", "id": "29921768", "url": "https://pubmed.ncbi.nlm.nih.gov/29921768" }, { "database": "PubMed", "id": "29949238", "url": "https://pubmed.ncbi.nlm.nih.gov/29949238" }, { "database": "PubMed", "id": "29950561", "url": "https://pubmed.ncbi.nlm.nih.gov/29950561" }, { "database": "PubMed", "id": "29991802", "url": "https://pubmed.ncbi.nlm.nih.gov/29991802" }, { "database": "PubMed", "id": "29995595", "url": "https://pubmed.ncbi.nlm.nih.gov/29995595" }, { "database": "PubMed", "id": "30008594", "url": "https://pubmed.ncbi.nlm.nih.gov/30008594" }, { "database": "PubMed", "id": "30009856", "url": "https://pubmed.ncbi.nlm.nih.gov/30009856" }, { "database": "PubMed", "id": "30015159", "url": "https://pubmed.ncbi.nlm.nih.gov/30015159" }, { "database": "PubMed", "id": "30016456", "url": "https://pubmed.ncbi.nlm.nih.gov/30016456" }, { "database": "PubMed", "id": "30036966", "url": "https://pubmed.ncbi.nlm.nih.gov/30036966" }, { "database": "PubMed", "id": "30072687", "url": "https://pubmed.ncbi.nlm.nih.gov/30072687" }, { "database": "PubMed", "id": "30080291", "url": "https://pubmed.ncbi.nlm.nih.gov/30080291" }, { "database": "PubMed", "id": "30106087", "url": "https://pubmed.ncbi.nlm.nih.gov/30106087" }, { "database": "PubMed", "id": "30123428", "url": "https://pubmed.ncbi.nlm.nih.gov/30123428" }, { "database": "PubMed", "id": "30127373", "url": "https://pubmed.ncbi.nlm.nih.gov/30127373" }, { "database": "PubMed", "id": "30127519", "url": "https://pubmed.ncbi.nlm.nih.gov/30127519" }, { "database": "PubMed", "id": "30135074", "url": "https://pubmed.ncbi.nlm.nih.gov/30135074" }, { "database": "PubMed", "id": "30135654", "url": "https://pubmed.ncbi.nlm.nih.gov/30135654" }, { "database": "PubMed", "id": "30209389", "url": "https://pubmed.ncbi.nlm.nih.gov/30209389" }, { "database": "PubMed", "id": "30214513", "url": "https://pubmed.ncbi.nlm.nih.gov/30214513" }, { "database": "PubMed", "id": "30234199", "url": "https://pubmed.ncbi.nlm.nih.gov/30234199" }, { "database": "PubMed", "id": "30250641", "url": "https://pubmed.ncbi.nlm.nih.gov/30250641" }, { "database": "PubMed", "id": "30251272", "url": "https://pubmed.ncbi.nlm.nih.gov/30251272" }, { "database": "PubMed", "id": "30261753", "url": "https://pubmed.ncbi.nlm.nih.gov/30261753" }, { "database": "PubMed", "id": "30286779", "url": "https://pubmed.ncbi.nlm.nih.gov/30286779" }, { "database": "PubMed", "id": "30302278", "url": "https://pubmed.ncbi.nlm.nih.gov/30302278" }, { "database": "PubMed", "id": "30323565", "url": "https://pubmed.ncbi.nlm.nih.gov/30323565" }, { "database": "PubMed", "id": "30368518", "url": "https://pubmed.ncbi.nlm.nih.gov/30368518" }, { "database": "PubMed", "id": "30375708", "url": "https://pubmed.ncbi.nlm.nih.gov/30375708" }, { "database": "PubMed", "id": "30410767", "url": "https://pubmed.ncbi.nlm.nih.gov/30410767" }, { "database": "PubMed", "id": "30442941", "url": "https://pubmed.ncbi.nlm.nih.gov/30442941" }, { "database": "PubMed", "id": "30455690", "url": "https://pubmed.ncbi.nlm.nih.gov/30455690" }, { "database": "PubMed", "id": "30481203", "url": "https://pubmed.ncbi.nlm.nih.gov/30481203" }, { "database": "PubMed", "id": "30519314", "url": "https://pubmed.ncbi.nlm.nih.gov/30519314" }, { "database": "PubMed", "id": "30523261", "url": "https://pubmed.ncbi.nlm.nih.gov/30523261" }, { "database": "PubMed", "id": "30577812", "url": "https://pubmed.ncbi.nlm.nih.gov/30577812" }, { "database": "PubMed", "id": "30622543", "url": "https://pubmed.ncbi.nlm.nih.gov/30622543" }, { "database": "PubMed", "id": "30622697", "url": "https://pubmed.ncbi.nlm.nih.gov/30622697" }, { "database": "PubMed", "id": "30631031", "url": "https://pubmed.ncbi.nlm.nih.gov/30631031" }, { "database": "PubMed", "id": "30668440", "url": "https://pubmed.ncbi.nlm.nih.gov/30668440" }, { "database": "PubMed", "id": "30674340", "url": "https://pubmed.ncbi.nlm.nih.gov/30674340" }, { "database": "PubMed", "id": "30675525", "url": "https://pubmed.ncbi.nlm.nih.gov/30675525" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30720080", "url": "https://pubmed.ncbi.nlm.nih.gov/30720080" }, { "database": "PubMed", "id": "30720090", "url": "https://pubmed.ncbi.nlm.nih.gov/30720090" }, { "database": "PubMed", "id": "30735121", "url": "https://pubmed.ncbi.nlm.nih.gov/30735121" }, { "database": "PubMed", "id": "30745853", "url": "https://pubmed.ncbi.nlm.nih.gov/30745853" }, { "database": "PubMed", "id": "30756445", "url": "https://pubmed.ncbi.nlm.nih.gov/30756445" }, { "database": "PubMed", "id": "30760703", "url": "https://pubmed.ncbi.nlm.nih.gov/30760703" }, { "database": "PubMed", "id": "30770798", "url": "https://pubmed.ncbi.nlm.nih.gov/30770798" }, { "database": "PubMed", "id": "30783489", "url": "https://pubmed.ncbi.nlm.nih.gov/30783489" }, { "database": "PubMed", "id": "30787270", "url": "https://pubmed.ncbi.nlm.nih.gov/30787270" }, { "database": "PubMed", "id": "30810286", "url": "https://pubmed.ncbi.nlm.nih.gov/30810286" }, { "database": "PubMed", "id": "30833574", "url": "https://pubmed.ncbi.nlm.nih.gov/30833574" }, { "database": "PubMed", "id": "30854231", "url": "https://pubmed.ncbi.nlm.nih.gov/30854231" }, { "database": "PubMed", "id": "30857539", "url": "https://pubmed.ncbi.nlm.nih.gov/30857539" }, { "database": "PubMed", "id": "30899371", "url": "https://pubmed.ncbi.nlm.nih.gov/30899371" }, { "database": "PubMed", "id": "30947697", "url": "https://pubmed.ncbi.nlm.nih.gov/30947697" }, { "database": "PubMed", "id": "30948493", "url": "https://pubmed.ncbi.nlm.nih.gov/30948493" }, { "database": "PubMed", "id": "30949204", "url": "https://pubmed.ncbi.nlm.nih.gov/30949204" }, { "database": "PubMed", "id": "30950039", "url": "https://pubmed.ncbi.nlm.nih.gov/30950039" }, { "database": "PubMed", "id": "30958597", "url": "https://pubmed.ncbi.nlm.nih.gov/30958597" }, { "database": "PubMed", "id": "30980700", "url": "https://pubmed.ncbi.nlm.nih.gov/30980700" }, { "database": "PubMed", "id": "30981183", "url": "https://pubmed.ncbi.nlm.nih.gov/30981183" }, { "database": "PubMed", "id": "30986607", "url": "https://pubmed.ncbi.nlm.nih.gov/30986607" }, { "database": "PubMed", "id": "31002364", "url": "https://pubmed.ncbi.nlm.nih.gov/31002364" }, { "database": "PubMed", "id": "31013746", "url": "https://pubmed.ncbi.nlm.nih.gov/31013746" }, { "database": "PubMed", "id": "31018021", "url": "https://pubmed.ncbi.nlm.nih.gov/31018021" }, { "database": "PubMed", "id": "31048139", "url": "https://pubmed.ncbi.nlm.nih.gov/31048139" }, { "database": "PubMed", "id": "31058868", "url": "https://pubmed.ncbi.nlm.nih.gov/31058868" }, { "database": "PubMed", "id": "31068940", "url": "https://pubmed.ncbi.nlm.nih.gov/31068940" }, { "database": "PubMed", "id": "31105997", "url": "https://pubmed.ncbi.nlm.nih.gov/31105997" }, { "database": "PubMed", "id": "31118769", "url": "https://pubmed.ncbi.nlm.nih.gov/31118769" }, { "database": "PubMed", "id": "31129031", "url": "https://pubmed.ncbi.nlm.nih.gov/31129031" }, { "database": "PubMed", "id": "31182137", "url": "https://pubmed.ncbi.nlm.nih.gov/31182137" }, { "database": "PubMed", "id": "31198634", "url": "https://pubmed.ncbi.nlm.nih.gov/31198634" }, { "database": "PubMed", "id": "31201357", "url": "https://pubmed.ncbi.nlm.nih.gov/31201357" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31213027", "url": "https://pubmed.ncbi.nlm.nih.gov/31213027" }, { "database": "PubMed", "id": "31226168", "url": "https://pubmed.ncbi.nlm.nih.gov/31226168" }, { "database": "PubMed", "id": "31227842", "url": "https://pubmed.ncbi.nlm.nih.gov/31227842" }, { "database": "PubMed", "id": "31277507", "url": "https://pubmed.ncbi.nlm.nih.gov/31277507" }, { "database": "PubMed", "id": "31277685", "url": "https://pubmed.ncbi.nlm.nih.gov/31277685" }, { "database": "PubMed", "id": "31284599", "url": "https://pubmed.ncbi.nlm.nih.gov/31284599" }, { "database": "PubMed", "id": "31285546", "url": "https://pubmed.ncbi.nlm.nih.gov/31285546" }, { "database": "PubMed", "id": "31306849", "url": "https://pubmed.ncbi.nlm.nih.gov/31306849" }, { "database": "PubMed", "id": "31319869", "url": "https://pubmed.ncbi.nlm.nih.gov/31319869" }, { "database": "PubMed", "id": "31323961", "url": "https://pubmed.ncbi.nlm.nih.gov/31323961" }, { "database": "PubMed", "id": "31337063", "url": "https://pubmed.ncbi.nlm.nih.gov/31337063" }, { "database": "PubMed", "id": "31337349", "url": "https://pubmed.ncbi.nlm.nih.gov/31337349" }, { "database": "PubMed", "id": "31337843", "url": "https://pubmed.ncbi.nlm.nih.gov/31337843" }, { "database": "PubMed", "id": "31361391", "url": "https://pubmed.ncbi.nlm.nih.gov/31361391" }, { "database": "PubMed", "id": "31361777", "url": "https://pubmed.ncbi.nlm.nih.gov/31361777" }, { "database": "PubMed", "id": "31372043", "url": "https://pubmed.ncbi.nlm.nih.gov/31372043" }, { "database": "PubMed", "id": "31375423", "url": "https://pubmed.ncbi.nlm.nih.gov/31375423" }, { "database": "PubMed", "id": "31383893", "url": "https://pubmed.ncbi.nlm.nih.gov/31383893" }, { "database": "PubMed", "id": "31390744", "url": "https://pubmed.ncbi.nlm.nih.gov/31390744" }, { "database": "PubMed", "id": "31409371", "url": "https://pubmed.ncbi.nlm.nih.gov/31409371" }, { "database": "PubMed", "id": "31412593", "url": "https://pubmed.ncbi.nlm.nih.gov/31412593" }, { "database": "PubMed", "id": "31422383", "url": "https://pubmed.ncbi.nlm.nih.gov/31422383" }, { "database": "PubMed", "id": "31438472", "url": "https://pubmed.ncbi.nlm.nih.gov/31438472" }, { "database": "PubMed", "id": "31438567", "url": "https://pubmed.ncbi.nlm.nih.gov/31438567" }, { "database": "PubMed", "id": "31448054", "url": "https://pubmed.ncbi.nlm.nih.gov/31448054" }, { "database": "PubMed", "id": "31455240", "url": "https://pubmed.ncbi.nlm.nih.gov/31455240" }, { "database": "PubMed", "id": "31465777", "url": "https://pubmed.ncbi.nlm.nih.gov/31465777" }, { "database": "PubMed", "id": "31500219", "url": "https://pubmed.ncbi.nlm.nih.gov/31500219" }, { "database": "PubMed", "id": "31511071", "url": "https://pubmed.ncbi.nlm.nih.gov/31511071" }, { "database": "PubMed", "id": "31530281", "url": "https://pubmed.ncbi.nlm.nih.gov/31530281" }, { "database": "PubMed", "id": "31537377", "url": "https://pubmed.ncbi.nlm.nih.gov/31537377" }, { "database": "PubMed", "id": "31568643", "url": "https://pubmed.ncbi.nlm.nih.gov/31568643" }, { "database": "PubMed", "id": "31573734", "url": "https://pubmed.ncbi.nlm.nih.gov/31573734" }, { "database": "PubMed", "id": "31575007", "url": "https://pubmed.ncbi.nlm.nih.gov/31575007" }, { "database": "PubMed", "id": "31597912", "url": "https://pubmed.ncbi.nlm.nih.gov/31597912" }, { "database": "PubMed", "id": "31616177", "url": "https://pubmed.ncbi.nlm.nih.gov/31616177" }, { "database": "PubMed", "id": "31655629", "url": "https://pubmed.ncbi.nlm.nih.gov/31655629" }, { "database": "PubMed", "id": "31695791", "url": "https://pubmed.ncbi.nlm.nih.gov/31695791" }, { "database": "PubMed", "id": "31709178", "url": "https://pubmed.ncbi.nlm.nih.gov/31709178" }, { "database": "PubMed", "id": "31744223", "url": "https://pubmed.ncbi.nlm.nih.gov/31744223" }, { "database": "PubMed", "id": "31750256", "url": "https://pubmed.ncbi.nlm.nih.gov/31750256" }, { "database": "PubMed", "id": "31760402", "url": "https://pubmed.ncbi.nlm.nih.gov/31760402" }, { "database": "PubMed", "id": "31765941", "url": "https://pubmed.ncbi.nlm.nih.gov/31765941" }, { "database": "PubMed", "id": "31781039", "url": "https://pubmed.ncbi.nlm.nih.gov/31781039" }, { "database": "PubMed", "id": "31816634", "url": "https://pubmed.ncbi.nlm.nih.gov/31816634" }, { "database": "PubMed", "id": "31817171", "url": "https://pubmed.ncbi.nlm.nih.gov/31817171" }, { "database": "PubMed", "id": "31847229", "url": "https://pubmed.ncbi.nlm.nih.gov/31847229" }, { "database": "PubMed", "id": "31878046", "url": "https://pubmed.ncbi.nlm.nih.gov/31878046" }, { "database": "PubMed", "id": "31888532", "url": "https://pubmed.ncbi.nlm.nih.gov/31888532" }, { "database": "PubMed", "id": "31894334", "url": "https://pubmed.ncbi.nlm.nih.gov/31894334" }, { "database": "PubMed", "id": "31900385", "url": "https://pubmed.ncbi.nlm.nih.gov/31900385" }, { "database": "PubMed", "id": "31908417", "url": "https://pubmed.ncbi.nlm.nih.gov/31908417" }, { "database": "PubMed", "id": "31920333", "url": "https://pubmed.ncbi.nlm.nih.gov/31920333" }, { "database": "PubMed", "id": "31936807", "url": "https://pubmed.ncbi.nlm.nih.gov/31936807" }, { "database": "PubMed", "id": "31938049", "url": "https://pubmed.ncbi.nlm.nih.gov/31938049" }, { "database": "PubMed", "id": "31956373", "url": "https://pubmed.ncbi.nlm.nih.gov/31956373" }, { "database": "PubMed", "id": "31980595", "url": "https://pubmed.ncbi.nlm.nih.gov/31980595" }, { "database": "PubMed", "id": "31990532", "url": "https://pubmed.ncbi.nlm.nih.gov/31990532" }, { "database": "PubMed", "id": "32005797", "url": "https://pubmed.ncbi.nlm.nih.gov/32005797" }, { "database": "PubMed", "id": "32005799", "url": "https://pubmed.ncbi.nlm.nih.gov/32005799" }, { "database": "PubMed", "id": "32021288", "url": "https://pubmed.ncbi.nlm.nih.gov/32021288" }, { "database": "PubMed", "id": "32029900", "url": "https://pubmed.ncbi.nlm.nih.gov/32029900" }, { "database": "PubMed", "id": "32051479", "url": "https://pubmed.ncbi.nlm.nih.gov/32051479" }, { "database": "PubMed", "id": "32054489", "url": "https://pubmed.ncbi.nlm.nih.gov/32054489" }, { "database": "PubMed", "id": "32071920", "url": "https://pubmed.ncbi.nlm.nih.gov/32071920" }, { "database": "PubMed", "id": "32080166", "url": "https://pubmed.ncbi.nlm.nih.gov/32080166" }, { "database": "PubMed", "id": "32150979", "url": "https://pubmed.ncbi.nlm.nih.gov/32150979" }, { "database": "PubMed", "id": "32164483", "url": "https://pubmed.ncbi.nlm.nih.gov/32164483" }, { "database": "PubMed", "id": "32171124", "url": "https://pubmed.ncbi.nlm.nih.gov/32171124" }, { "database": "PubMed", "id": "32182833", "url": "https://pubmed.ncbi.nlm.nih.gov/32182833" }, { "database": "PubMed", "id": "32188095", "url": "https://pubmed.ncbi.nlm.nih.gov/32188095" }, { "database": "PubMed", "id": "32242230", "url": "https://pubmed.ncbi.nlm.nih.gov/32242230" }, { "database": "PubMed", "id": "32252311", "url": "https://pubmed.ncbi.nlm.nih.gov/32252311" }, { "database": "PubMed", "id": "32257917", "url": "https://pubmed.ncbi.nlm.nih.gov/32257917" }, { "database": "PubMed", "id": "32273843", "url": "https://pubmed.ncbi.nlm.nih.gov/32273843" }, { "database": "PubMed", "id": "32365859", "url": "https://pubmed.ncbi.nlm.nih.gov/32365859" }, { "database": "PubMed", "id": "32391256", "url": "https://pubmed.ncbi.nlm.nih.gov/32391256" }, { "database": "PubMed", "id": "32422984", "url": "https://pubmed.ncbi.nlm.nih.gov/32422984" }, { "database": "PubMed", "id": "32450513", "url": "https://pubmed.ncbi.nlm.nih.gov/32450513" }, { "database": "PubMed", "id": "32456348", "url": "https://pubmed.ncbi.nlm.nih.gov/32456348" }, { "database": "PubMed", "id": "32475380", "url": "https://pubmed.ncbi.nlm.nih.gov/32475380" }, { "database": "PubMed", "id": "32483468", "url": "https://pubmed.ncbi.nlm.nih.gov/32483468" }, { "database": "PubMed", "id": "32491253", "url": "https://pubmed.ncbi.nlm.nih.gov/32491253" }, { "database": "PubMed", "id": "32495998", "url": "https://pubmed.ncbi.nlm.nih.gov/32495998" }, { "database": "PubMed", "id": "32517717", "url": "https://pubmed.ncbi.nlm.nih.gov/32517717" }, { "database": "PubMed", "id": "32526010", "url": "https://pubmed.ncbi.nlm.nih.gov/32526010" }, { "database": "PubMed", "id": "32528731", "url": "https://pubmed.ncbi.nlm.nih.gov/32528731" }, { "database": "PubMed", "id": "32580970", "url": "https://pubmed.ncbi.nlm.nih.gov/32580970" }, { "database": "PubMed", "id": "32587662", "url": "https://pubmed.ncbi.nlm.nih.gov/32587662" }, { "database": "PubMed", "id": "32589311", "url": "https://pubmed.ncbi.nlm.nih.gov/32589311" }, { "database": "PubMed", "id": "32641029", "url": "https://pubmed.ncbi.nlm.nih.gov/32641029" }, { "database": "PubMed", "id": "32657763", "url": "https://pubmed.ncbi.nlm.nih.gov/32657763" }, { "database": "PubMed", "id": "32667731", "url": "https://pubmed.ncbi.nlm.nih.gov/32667731" }, { "database": "PubMed", "id": "32716315", "url": "https://pubmed.ncbi.nlm.nih.gov/32716315" }, { "database": "PubMed", "id": "32721246", "url": "https://pubmed.ncbi.nlm.nih.gov/32721246" }, { "database": "PubMed", "id": "32735617", "url": "https://pubmed.ncbi.nlm.nih.gov/32735617" }, { "database": "PubMed", "id": "32751884", "url": "https://pubmed.ncbi.nlm.nih.gov/32751884" }, { "database": "PubMed", "id": "32754441", "url": "https://pubmed.ncbi.nlm.nih.gov/32754441" }, { "database": "PubMed", "id": "32766155", "url": "https://pubmed.ncbi.nlm.nih.gov/32766155" }, { "database": "PubMed", "id": "32767999", "url": "https://pubmed.ncbi.nlm.nih.gov/32767999" }, { "database": "PubMed", "id": "32807795", "url": "https://pubmed.ncbi.nlm.nih.gov/32807795" }, { "database": "PubMed", "id": "32811873", "url": "https://pubmed.ncbi.nlm.nih.gov/32811873" }, { "database": "PubMed", "id": "32850477", "url": "https://pubmed.ncbi.nlm.nih.gov/32850477" }, { "database": "PubMed", "id": "32852592", "url": "https://pubmed.ncbi.nlm.nih.gov/32852592" }, { "database": "PubMed", "id": "32863764", "url": "https://pubmed.ncbi.nlm.nih.gov/32863764" }, { "database": "PubMed", "id": "32868906", "url": "https://pubmed.ncbi.nlm.nih.gov/32868906" }, { "database": "PubMed", "id": "32877289", "url": "https://pubmed.ncbi.nlm.nih.gov/32877289" }, { "database": "PubMed", "id": "32885530", "url": "https://pubmed.ncbi.nlm.nih.gov/32885530" }, { "database": "PubMed", "id": "32908147", "url": "https://pubmed.ncbi.nlm.nih.gov/32908147" }, { "database": "PubMed", "id": "32922036", "url": "https://pubmed.ncbi.nlm.nih.gov/32922036" }, { "database": "PubMed", "id": "32929201", "url": "https://pubmed.ncbi.nlm.nih.gov/32929201" }, { "database": "PubMed", "id": "32961646", "url": "https://pubmed.ncbi.nlm.nih.gov/32961646" }, { "database": "PubMed", "id": "32971907", "url": "https://pubmed.ncbi.nlm.nih.gov/32971907" }, { "database": "PubMed", "id": "32972460", "url": "https://pubmed.ncbi.nlm.nih.gov/32972460" }, { "database": "PubMed", "id": "32973302", "url": "https://pubmed.ncbi.nlm.nih.gov/32973302" }, { "database": "PubMed", "id": "33015502", "url": "https://pubmed.ncbi.nlm.nih.gov/33015502" }, { "database": "PubMed", "id": "33038372", "url": "https://pubmed.ncbi.nlm.nih.gov/33038372" }, { "database": "PubMed", "id": "33040485", "url": "https://pubmed.ncbi.nlm.nih.gov/33040485" }, { "database": "PubMed", "id": "33042115", "url": "https://pubmed.ncbi.nlm.nih.gov/33042115" }, { "database": "PubMed", "id": "33053804", "url": "https://pubmed.ncbi.nlm.nih.gov/33053804" }, { "database": "PubMed", "id": "33061855", "url": "https://pubmed.ncbi.nlm.nih.gov/33061855" }, { "database": "PubMed", "id": "33066004", "url": "https://pubmed.ncbi.nlm.nih.gov/33066004" }, { "database": "PubMed", "id": "33101052", "url": "https://pubmed.ncbi.nlm.nih.gov/33101052" }, { "database": "PubMed", "id": "33140053", "url": "https://pubmed.ncbi.nlm.nih.gov/33140053" }, { "database": "PubMed", "id": "33144502", "url": "https://pubmed.ncbi.nlm.nih.gov/33144502" }, { "database": "PubMed", "id": "33164240", "url": "https://pubmed.ncbi.nlm.nih.gov/33164240" }, { "database": "PubMed", "id": "33174044", "url": "https://pubmed.ncbi.nlm.nih.gov/33174044" }, { "database": "PubMed", "id": "33178223", "url": "https://pubmed.ncbi.nlm.nih.gov/33178223" }, { "database": "PubMed", "id": "33193827", "url": "https://pubmed.ncbi.nlm.nih.gov/33193827" }, { "database": "PubMed", "id": "33217668", "url": "https://pubmed.ncbi.nlm.nih.gov/33217668" }, { "database": "PubMed", "id": "33249747", "url": "https://pubmed.ncbi.nlm.nih.gov/33249747" }, { "database": "PubMed", "id": "33257655", "url": "https://pubmed.ncbi.nlm.nih.gov/33257655" }, { "database": "PubMed", "id": "33259114", "url": "https://pubmed.ncbi.nlm.nih.gov/33259114" }, { "database": "PubMed", "id": "33262462", "url": "https://pubmed.ncbi.nlm.nih.gov/33262462" }, { "database": "PubMed", "id": "33274592", "url": "https://pubmed.ncbi.nlm.nih.gov/33274592" }, { "database": "PubMed", "id": "33277798", "url": "https://pubmed.ncbi.nlm.nih.gov/33277798" }, { "database": "PubMed", "id": "33279931", "url": "https://pubmed.ncbi.nlm.nih.gov/33279931" }, { "database": "PubMed", "id": "33281966", "url": "https://pubmed.ncbi.nlm.nih.gov/33281966" }, { "database": "PubMed", "id": "33291686", "url": "https://pubmed.ncbi.nlm.nih.gov/33291686" }, { "database": "PubMed", "id": "33293765", "url": "https://pubmed.ncbi.nlm.nih.gov/33293765" }, { "database": "PubMed", "id": "33380422", "url": "https://pubmed.ncbi.nlm.nih.gov/33380422" }, { "database": "PubMed", "id": "33391507", "url": "https://pubmed.ncbi.nlm.nih.gov/33391507" }, { "database": "PubMed", "id": "33392396", "url": "https://pubmed.ncbi.nlm.nih.gov/33392396" }, { "database": "PubMed", "id": "33420372", "url": "https://pubmed.ncbi.nlm.nih.gov/33420372" }, { "database": "PubMed", "id": "33440995", "url": "https://pubmed.ncbi.nlm.nih.gov/33440995" }, { "database": "PubMed", "id": "33448097", "url": "https://pubmed.ncbi.nlm.nih.gov/33448097" }, { "database": "PubMed", "id": "33450849", "url": "https://pubmed.ncbi.nlm.nih.gov/33450849" }, { "database": "PubMed", "id": "33469308", "url": "https://pubmed.ncbi.nlm.nih.gov/33469308" }, { "database": "PubMed", "id": "33513694", "url": "https://pubmed.ncbi.nlm.nih.gov/33513694" }, { "database": "PubMed", "id": "33517393", "url": "https://pubmed.ncbi.nlm.nih.gov/33517393" }, { "database": "PubMed", "id": "33529218", "url": "https://pubmed.ncbi.nlm.nih.gov/33529218" }, { "database": "PubMed", "id": "33541421", "url": "https://pubmed.ncbi.nlm.nih.gov/33541421" }, { "database": "PubMed", "id": "33640759", "url": "https://pubmed.ncbi.nlm.nih.gov/33640759" }, { "database": "PubMed", "id": "33658640", "url": "https://pubmed.ncbi.nlm.nih.gov/33658640" }, { "database": "PubMed", "id": "33660414", "url": "https://pubmed.ncbi.nlm.nih.gov/33660414" }, { "database": "PubMed", "id": "33669259", "url": "https://pubmed.ncbi.nlm.nih.gov/33669259" }, { "database": "PubMed", "id": "33669634", "url": "https://pubmed.ncbi.nlm.nih.gov/33669634" }, { "database": "PubMed", "id": "33772065", "url": "https://pubmed.ncbi.nlm.nih.gov/33772065" }, { "database": "PubMed", "id": "33818016", "url": "https://pubmed.ncbi.nlm.nih.gov/33818016" }, { "database": "PubMed", "id": "33824475", "url": "https://pubmed.ncbi.nlm.nih.gov/33824475" }, { "database": "PubMed", "id": "33839684", "url": "https://pubmed.ncbi.nlm.nih.gov/33839684" }, { "database": "PubMed", "id": "33909625", "url": "https://pubmed.ncbi.nlm.nih.gov/33909625" }, { "database": "PubMed", "id": "33920736", "url": "https://pubmed.ncbi.nlm.nih.gov/33920736" }, { "database": "PubMed", "id": "33924087", "url": "https://pubmed.ncbi.nlm.nih.gov/33924087" }, { "database": "PubMed", "id": "33968084", "url": "https://pubmed.ncbi.nlm.nih.gov/33968084" }, { "database": "PubMed", "id": "33986510", "url": "https://pubmed.ncbi.nlm.nih.gov/33986510" }, { "database": "PubMed", "id": "34067421", "url": "https://pubmed.ncbi.nlm.nih.gov/34067421" }, { "database": "PubMed", "id": "34440160", "url": "https://pubmed.ncbi.nlm.nih.gov/34440160" }, { "database": "PubMed", "id": "34908808", "url": "https://pubmed.ncbi.nlm.nih.gov/34908808" }, { "database": "PubMed", "id": "35131454", "url": "https://pubmed.ncbi.nlm.nih.gov/35131454" }, { "database": "PubMed", "id": "35184394", "url": "https://pubmed.ncbi.nlm.nih.gov/35184394" }, { "database": "PubMed", "id": "35200033", "url": "https://pubmed.ncbi.nlm.nih.gov/35200033" }, { "database": "PubMed", "id": "35476936", "url": "https://pubmed.ncbi.nlm.nih.gov/35476936" }, { "database": "PubMed", "id": "35566660", "url": "https://pubmed.ncbi.nlm.nih.gov/35566660" }, { "database": "PubMed", "id": "35670018", "url": "https://pubmed.ncbi.nlm.nih.gov/35670018" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "35722967", "url": "https://pubmed.ncbi.nlm.nih.gov/35722967" }, { "database": "PubMed", "id": "35756080", "url": "https://pubmed.ncbi.nlm.nih.gov/35756080" }, { "database": "PubMed", "id": "35809767", "url": "https://pubmed.ncbi.nlm.nih.gov/35809767" }, { "database": "PubMed", "id": "35932642", "url": "https://pubmed.ncbi.nlm.nih.gov/35932642" }, { "database": "PubMed", "id": "36017196", "url": "https://pubmed.ncbi.nlm.nih.gov/36017196" }, { "database": "PubMed", "id": "36068200", "url": "https://pubmed.ncbi.nlm.nih.gov/36068200" }, { "database": "PubMed", "id": "36103247", "url": "https://pubmed.ncbi.nlm.nih.gov/36103247" }, { "database": "PubMed", "id": "36179418", "url": "https://pubmed.ncbi.nlm.nih.gov/36179418" }, { "database": "PubMed", "id": "36207761", "url": "https://pubmed.ncbi.nlm.nih.gov/36207761" }, { "database": "PubMed", "id": "36282975", "url": "https://pubmed.ncbi.nlm.nih.gov/36282975" }, { "database": "PubMed", "id": "36362294", "url": "https://pubmed.ncbi.nlm.nih.gov/36362294" }, { "database": "PubMed", "id": "9531474", "url": "https://pubmed.ncbi.nlm.nih.gov/9531474" }, { "database": "PubMed", "id": "12637586", "url": "https://pubmed.ncbi.nlm.nih.gov/12637586" }, { "database": "PubMed", "id": "15592455", "url": "https://pubmed.ncbi.nlm.nih.gov/15592455" }, { "database": "PubMed", "id": "16568091", "url": "https://pubmed.ncbi.nlm.nih.gov/16568091" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22306293", "url": "https://pubmed.ncbi.nlm.nih.gov/22306293" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "26293184", "url": "https://pubmed.ncbi.nlm.nih.gov/26293184" }, { "database": "PubMed", "id": "31899195", "url": "https://pubmed.ncbi.nlm.nih.gov/31899195" } ], "site_lbl": "Tyr705", "uniprot_canonical_ac": "P40763-1" } ], "record_id": "pubmed.25476455", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gene expression of INPP5F as an independent prognostic marker in fludarabine-based therapy of chronic lymphocytic leukemia.", "journal": "Blood cancer journal", "date": "2015", "authors": "Palermo G, Maisel D, Barrett M, Smith H, Duchateau-Nguyen G, Nguyen T, Yeh RF, Dufour A, Robak T, Dornan D, Weisser M", "reference": { "type": "PubMed", "id": "26430724", "url": "https://pubmed.ncbi.nlm.nih.gov/26430724" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y2H2", "url": "https://www.uniprot.org/uniprotkb/Q9Y2H2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26430724", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Imprinting aberrations of SNRPN, ZAC1 and INPP5F genes involved in the pathogenesis of congenital heart disease with extracardiac malformations.", "journal": "Journal of cellular and molecular medicine", "date": "2020", "authors": "Zhao X, Chang S, Liu X, Wang S, Zhang Y, Lu X, Zhang T, Zhang H, Wang L", "reference": { "type": "PubMed", "id": "32693431", "url": "https://pubmed.ncbi.nlm.nih.gov/32693431" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y2H2", "url": "https://www.uniprot.org/uniprotkb/Q9Y2H2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32693431", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Parkinson's Disease rs117896735 Variant Regulates INPP5F Expression in Brain Tissues and Increases Risk of Alzheimer's Disease.", "journal": "Journal of Alzheimer's disease : JAD", "date": "2022", "authors": "Xue F, Gao L, Chen T, Chen H, Zhang H, Wang T, Han Z, Gao S, Wang L, Hu Y, Tang J, Huang L, Liu G, Zhang Y", "reference": { "type": "PubMed", "id": "35848021", "url": "https://pubmed.ncbi.nlm.nih.gov/35848021" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y2H2", "url": "https://www.uniprot.org/uniprotkb/Q9Y2H2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35848021", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of human SLP-2, a novel homologue of stomatin (band 7.2b) present in erythrocytes and other tissues.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Wang Y, Morrow JS", "reference": { "type": "PubMed", "id": "10713127", "url": "https://pubmed.ncbi.nlm.nih.gov/10713127" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10713127", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel member of the stomatin/EPB72/mec-2 family, stomatin-like 2 (STOML2), is ubiquitously expressed and localizes to HSA chromosome 9p13.1.", "journal": "Cytogenet. Cell Genet.", "date": "2001", "authors": "Owczarek C M, Treutlein H R, Portbury K J, Gulluyan L M, Kola I, Hertzog P J", "reference": { "type": "PubMed", "id": "11435687", "url": "https://pubmed.ncbi.nlm.nih.gov/11435687" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11435687", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stomatin-like protein 2 is overexpressed in cancer and involved in regulating cell growth and cell adhesion in human esophageal squamous cell carcinoma.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2006", "authors": "Zhang L, Ding F, Cao W, Liu Z, Liu W, Yu Z, Wu Y, Li W, Li Y, Liu Z", "reference": { "type": "PubMed", "id": "16533792", "url": "https://pubmed.ncbi.nlm.nih.gov/16533792" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16533792", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mass spectrometrical verification of stomatin-like protein 2 (SLP-2) primary structure.", "journal": "Proteins", "date": "2006", "authors": "John Julius Paul Pradeep, Anrather Dorothea, Pollak Arnold, Lubec Gert", "reference": { "type": "PubMed", "id": "16671055", "url": "https://pubmed.ncbi.nlm.nih.gov/16671055" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16671055", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a novel mitochondrial complex containing mitofusin 2 and stomatin-like protein 2.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Hajek P, Chomyn A, Attardi G", "reference": { "type": "PubMed", "id": "17121834", "url": "https://pubmed.ncbi.nlm.nih.gov/17121834" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95140-1", "protein_name": "Mitofusin-2", "gene_name": "MFN2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17121834", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLP-2 interacts with prohibitins in the mitochondrial inner membrane and contributes to their stability.", "journal": "Biochim. Biophys. Acta", "date": "2008", "authors": "Da Cruz Sandrine, Parone Philippe A, Gonzalo Philippe, Bienvenut Willy V, Tondera Daniel, Jourdain Alexis, Quadroni Manfredo, Martinou Jean-Claude", "reference": { "type": "PubMed", "id": "18339324", "url": "https://pubmed.ncbi.nlm.nih.gov/18339324" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18339324", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Modulation of T cell activation by stomatin-like protein 2.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Kirchhof MG, Chau LA, Lemke CD, Vardhana S, Darlington PJ, Marquez ME, Taylor R, Rizkalla K, Blanca I, Dustin ML, Madrenas J", "reference": { "type": "PubMed", "id": "18641330", "url": "https://pubmed.ncbi.nlm.nih.gov/18641330" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18641330", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A frequent target of paraproteins in the sera of patients with multiple myeloma and MGUS.", "journal": "Int. J. Cancer", "date": "2009", "authors": "Preuss Klaus-Dieter, Pfreundschuh Michael, Ahlgrimm Manfred, Fadle Natalie, Regitz Evi, Murawski Niels, Grass Sandra", "reference": { "type": "PubMed", "id": "19405124", "url": "https://pubmed.ncbi.nlm.nih.gov/19405124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19405124", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Downregulation of a mitochondria associated protein SLP-2 inhibits tumor cell motility, proliferation and enhances cell sensitivity to chemotherapeutic reagents.", "journal": "Cancer biology & therapy", "date": "2009-09", "authors": "Wang Yueqi, Cao Wenfeng, Yu Zaicheng, Liu Zhihua", "reference": { "type": "PubMed", "id": "19597348", "url": "https://pubmed.ncbi.nlm.nih.gov/19597348" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19597348", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLP-2 negatively modulates mitochondrial sodium-calcium exchange.", "journal": "Cell calcium", "date": "2010-01", "authors": "Da Cruz Sandrine, De Marchi Umberto, Frieden Maud, Parone Philippe A, Martinou Jean-Claude, Demaurex Nicolas", "reference": { "type": "PubMed", "id": "19944461", "url": "https://pubmed.ncbi.nlm.nih.gov/19944461" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19944461", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stomatin-like protein 2 binds cardiolipin and regulates mitochondrial biogenesis and function.", "journal": "Molecular and cellular biology", "date": "2011-09", "authors": "Christie Darah A, Lemke Caitlin D, Elias Isaac M, Chau Luan A, Kirchhof Mark G, Li Bo, Ball Eric H, Dunn Stanley D, Hatch Grant M, Madrenas Joaqu\u00edn", "reference": { "type": "PubMed", "id": "21746876", "url": "https://pubmed.ncbi.nlm.nih.gov/21746876" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35232-1", "protein_name": "Prohibitin 1", "gene_name": "PHB1; PHB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99623-1", "protein_name": "Prohibitin-2", "gene_name": "PHB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21746876", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hyperphosphorylation of autoantigenic targets of paraproteins is due to inactivation of PP2A.", "journal": "Blood", "date": "2011", "authors": "Preuss KD, Pfreundschuh M, Fadle N, Regitz E, Raudies S, Murwaski N, Ahlgrimm M, Bittenbring J, Klotz M, Schafer KH, Held G, Neumann F, Grass S", "reference": { "type": "PubMed", "id": "21791414", "url": "https://pubmed.ncbi.nlm.nih.gov/21791414" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC/PRKCZ", "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" }, { "database": "iPTMnet", "id": "Q9UJZ1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UJZ1" }, { "database": "PubMed", "id": "21791414", "url": "https://pubmed.ncbi.nlm.nih.gov/21791414" }, { "database": "PubMed", "id": "25677163", "url": "https://pubmed.ncbi.nlm.nih.gov/25677163" } ], "site_lbl": "Ser17", "uniprot_canonical_ac": "Q9UJZ1-1" } ], "record_id": "pubmed.21791414", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CD4(+) T cells in chronic autoantigenic stimulation in MGUS, multiple myeloma and Waldenstrom's macroglobulinemia.", "journal": "International journal of cancer", "date": "2015", "authors": "Neumann F, Pfreundschuh M, Preuss KD, Schormann C, Zwick C, Murawski N, Kubuschok B", "reference": { "type": "PubMed", "id": "25677163", "url": "https://pubmed.ncbi.nlm.nih.gov/25677163" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC/PRKCZ", "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" }, { "database": "iPTMnet", "id": "Q9UJZ1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UJZ1" }, { "database": "PubMed", "id": "21791414", "url": "https://pubmed.ncbi.nlm.nih.gov/21791414" }, { "database": "PubMed", "id": "25677163", "url": "https://pubmed.ncbi.nlm.nih.gov/25677163" } ], "site_lbl": "Ser17", "uniprot_canonical_ac": "Q9UJZ1-1" } ], "record_id": "pubmed.25677163", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CHCHD10 and SLP2 control the stability of the PHB complex: a key factor for motor neuron viability.", "journal": "Brain : a journal of neurology", "date": "2022-10-21", "authors": "Genin Emmanuelle C, Bannwarth Sylvie, Ropert Baptiste, Lespinasse Fran\u00e7oise, Mauri-Crouzet Alessandra, Aug\u00e9 Gaelle, Fragaki Konstantina, Cochaud Charlotte, Donnarumma Erminia, Lacas-Gervais Sandra, Wai Timothy, Paquis-Flucklinger V\u00e9ronique", "reference": { "type": "PubMed", "id": "35656794", "url": "https://pubmed.ncbi.nlm.nih.gov/35656794" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35656794", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "STOML2 restricts mitophagy and increases chemosensitivity in pancreatic cancer through stabilizing PARL-induced PINK1 degradation.", "journal": "Cell death & disease", "date": "2023-03-11", "authors": "Qin Cheng, Wang Yuanyang, Zhao Bangbo, Li Zeru, Li Tianyu, Yang Xiaoying, Zhao Yutong, Wang Weibin", "reference": { "type": "PubMed", "id": "36906621", "url": "https://pubmed.ncbi.nlm.nih.gov/36906621" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36906621", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Diagnostic and prognostic utility of TROP-2, SLP-2, and CXCL12 expression in papillary thyroid carcinoma.", "journal": "Cancer biomarkers : section A of Disease markers", "date": "2024", "authors": "Attia Amany Selim, Hussein Samia, Sameh Hend, Khalil Amr, Waley Ahmad Barakat, Matar Ihab, Sameh Reham", "reference": { "type": "PubMed", "id": "38073379", "url": "https://pubmed.ncbi.nlm.nih.gov/38073379" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38073379", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Overexpressing lipid raft protein STOML2 modulates the tumor microenvironment via NF-\u03baB signaling in colorectal cancer.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2024-01-12", "authors": "Gong Hui, Chen Shaojing, Liu Shuguang, Hu Qianying, Li Yixuan, Li Yifan, Li Guiqiu, Huang Kaimeng, Li Riqing, Fang Lishan", "reference": { "type": "PubMed", "id": "38214751", "url": "https://pubmed.ncbi.nlm.nih.gov/38214751" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJZ1-1", "protein_name": "Stomatin-like protein 2, mitochondrial", "gene_name": "STOML2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJZ1", "url": "https://www.uniprot.org/uniprotkb/Q9UJZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38214751", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gene expression profile in interleukin-4-stimulated human vascular endothelial cells.", "journal": "Mol. Med.", "date": "2004", "authors": "Lee YW, Eum SY, Chen KC, Hennig B, Toborek M", "reference": { "type": "PubMed", "id": "15502879", "url": "https://pubmed.ncbi.nlm.nih.gov/15502879" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14159-1", "protein_name": "DNA repair-scaffolding protein", "gene_name": "SPIDR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14159", "url": "https://www.uniprot.org/uniprotkb/Q14159" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15502879", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparative host gene transcription by microarray analysis early after infection of the Huh7 cell line by severe acute respiratory syndrome coronavirus and human coronavirus 229E.", "journal": "J. Virol.", "date": "2005", "authors": "Tang Bone S F, Chan Kwok-Hung, Cheng Vincent C C, Woo Patrick C Y, Lau Susanna K P, Lam Clarence C K, Chan Tsun-Leung, Wu Alan K L, Hung Ivan F N, Leung Suet-Yi, Yuen Kwok-Yung", "reference": { "type": "PubMed", "id": "15858003", "url": "https://pubmed.ncbi.nlm.nih.gov/15858003" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14159-1", "protein_name": "DNA repair-scaffolding protein", "gene_name": "SPIDR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14159", "url": "https://www.uniprot.org/uniprotkb/Q14159" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15858003", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Biallelic Mutation in the Homologous Recombination Repair Gene SPIDR Is Associated With Human Gonadal Dysgenesis.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2017", "authors": "Smirin-Yosef P, Zuckerman-Levin N, Tzur S, Granot Y, Cohen L, Sachsenweger J, Borck G, Lagovsky I, Salmon-Divon M, Wiesmuller L, Basel-Vanagaite L", "reference": { "type": "PubMed", "id": "27967308", "url": "https://pubmed.ncbi.nlm.nih.gov/27967308" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14159-1", "protein_name": "DNA repair-scaffolding protein", "gene_name": "SPIDR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14159", "url": "https://www.uniprot.org/uniprotkb/Q14159" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27967308", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A SPIDR homozygous nonsense pathogenic variant in isolated primary ovarian insufficiency with chromosomal instability.", "journal": "Clinical genetics", "date": "2022", "authors": "Heddar A, Guichoux N, Auger N, Misrahi M", "reference": { "type": "PubMed", "id": "34697795", "url": "https://pubmed.ncbi.nlm.nih.gov/34697795" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14159-1", "protein_name": "DNA repair-scaffolding protein", "gene_name": "SPIDR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14159", "url": "https://www.uniprot.org/uniprotkb/Q14159" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34697795", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "High-throughput functional screening for autophagy-related genes and identification of TM9SF1 as an autophagosome-inducing gene.", "journal": "Autophagy", "date": "2009", "authors": "He P, Peng Z, Luo Y, Wang L, Yu P, Deng W, An Y, Shi T, Ma D", "reference": { "type": "PubMed", "id": "19029833", "url": "https://pubmed.ncbi.nlm.nih.gov/19029833" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15321-1", "protein_name": "Transmembrane 9 superfamily member 1", "gene_name": "TM9SF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H8M9-1", "protein_name": "Protein eva-1 homolog A", "gene_name": "EVA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96NL1-1", "protein_name": "Transmembrane protein 74", "gene_name": "TMEM74", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15321", "url": "https://www.uniprot.org/uniprotkb/O15321" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19029833", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of a human multispanning membrane protein cDNA: evidence for a new protein family.", "journal": "Gene", "date": "1997", "authors": "Chluba-de Tapia J, de Tapia M, Jaggin V, Eberle AN", "reference": { "type": "PubMed", "id": "9332367", "url": "https://pubmed.ncbi.nlm.nih.gov/9332367" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15321-1", "protein_name": "Transmembrane 9 superfamily member 1", "gene_name": "TM9SF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15321", "url": "https://www.uniprot.org/uniprotkb/O15321" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9332367", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The SET domain protein Metnase mediates foreign DNA integration and links integration to nonhomologous end-joining repair.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Lee SH, Oshige M, Durant ST, Rasila KK, Williamson EA, Ramsey H, Kwan L, Nickoloff JA, Hromas R", "reference": { "type": "PubMed", "id": "16332963", "url": "https://pubmed.ncbi.nlm.nih.gov/16332963" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 223, "end_pos": 223, "sequence_org": "N", "sequence_mut": "S", "comment": "Reduces activity in double-strand break repair.", "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" }, { "database": "PubMed", "id": "16332963", "url": "https://pubmed.ncbi.nlm.nih.gov/16332963" } ], "uniprot_canonical_ac": "Q53H47-1" }, { "start_pos": 261, "end_pos": 261, "sequence_org": "D", "sequence_mut": "S", "comment": "Reduces activity in double-strand break repair.", "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" }, { "database": "PubMed", "id": "16332963", "url": "https://pubmed.ncbi.nlm.nih.gov/16332963" } ], "uniprot_canonical_ac": "Q53H47-1" }, { "start_pos": 503, "end_pos": 503, "sequence_org": "D", "sequence_mut": "S", "comment": "Reduces activity in double-strand break repair.", "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" }, { "database": "PubMed", "id": "16332963", "url": "https://pubmed.ncbi.nlm.nih.gov/16332963" } ], "uniprot_canonical_ac": "Q53H47-1" } ], "record_id": "pubmed.16332963", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Birth of a chimeric primate gene by capture of the transposase gene from a mobile element.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006-05-23", "authors": "Cordaux Richard, Udit Swalpa, Batzer Mark A, Feschotte C\u00e9dric", "reference": { "type": "PubMed", "id": "16672366", "url": "https://pubmed.ncbi.nlm.nih.gov/16672366" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16672366", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hyperactive Himar1 transposase mediates transposition in cell culture and enhances gene expression in vivo.", "journal": "Human gene therapy", "date": "2006", "authors": "Keravala A, Liu D, Lechman ER, Wolfe D, Nash JA, Lampe DJ, Robbins PD", "reference": { "type": "PubMed", "id": "16989604", "url": "https://pubmed.ncbi.nlm.nih.gov/16989604" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16989604", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ancient mariner sails again: transposition of the human Hsmar1 element by a reconstructed transposase and activities of the SETMAR protein on transposon ends.", "journal": "Molecular and cellular biology", "date": "2007-06", "authors": "Miskey Csaba, Papp Bal\u00e1zs, M\u00e1t\u00e9s Lajos, Sinzelle Ludivine, Keller Heiko, Izsv\u00e1k Zsuzsanna, Ivics Zolt\u00e1n", "reference": { "type": "PubMed", "id": "17403897", "url": "https://pubmed.ncbi.nlm.nih.gov/17403897" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17403897", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biochemical characterization of a SET and transposase fusion protein, Metnase: its DNA binding and DNA cleavage activity.", "journal": "Biochemistry", "date": "2007", "authors": "Roman Y, Oshige M, Lee YJ, Goodwin K, Georgiadis MM, Hromas RA, Lee SH", "reference": { "type": "PubMed", "id": "17877369", "url": "https://pubmed.ncbi.nlm.nih.gov/17877369" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 445, "end_pos": 445, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolishes TIR-specific DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" }, { "database": "PubMed", "id": "17877369", "url": "https://pubmed.ncbi.nlm.nih.gov/17877369" } ], "uniprot_canonical_ac": "Q53H47-1" }, { "start_pos": 496, "end_pos": 496, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolishes DNA cleavage.", "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" }, { "database": "PubMed", "id": "17877369", "url": "https://pubmed.ncbi.nlm.nih.gov/17877369" } ], "uniprot_canonical_ac": "Q53H47-1" } ], "record_id": "pubmed.17877369", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of the human Hsmar1-derived transposase domain in the DNA repair enzyme Metnase.", "journal": "Biochemistry", "date": "2010", "authors": "Goodwin KD, He H, Imasaki T, Lee SH, Georgiadis MM", "reference": { "type": "PubMed", "id": "20521842", "url": "https://pubmed.ncbi.nlm.nih.gov/20521842" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 473, "end_pos": 473, "sequence_org": "F", "sequence_mut": "K", "comment": "Abolishes homodimerization and DNA-binding and reduces cleavage of single-stranded DNA.", "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" }, { "database": "PubMed", "id": "20521842", "url": "https://pubmed.ncbi.nlm.nih.gov/20521842" } ], "uniprot_canonical_ac": "Q53H47-1" } ], "record_id": "pubmed.20521842", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Methylation of histone H3 lysine 36 enhances DNA repair by nonhomologous end-joining.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011-01-11", "authors": "Fnu Sheema, Williamson Elizabeth A, De Haro Leyma P, Brenneman Mark, Wray Justin, Shaheen Montaser, Radhakrishnan Krishnan, Lee Suk-Hee, Nickoloff Jac A, Hromas Robert", "reference": { "type": "PubMed", "id": "21187428", "url": "https://pubmed.ncbi.nlm.nih.gov/21187428" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21187428", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chk1 phosphorylation of Metnase enhances DNA repair but inhibits replication fork restart.", "journal": "Oncogene", "date": "2012", "authors": "Hromas R, Williamson EA, Fnu S, Lee YJ, Park SJ, Beck BD, You JS, Leitao A, Nickoloff JA, Lee SH", "reference": { "type": "PubMed", "id": "22231448", "url": "https://pubmed.ncbi.nlm.nih.gov/22231448" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 508, "end_pos": 508, "sequence_org": "S", "sequence_mut": "A", "comment": "Prevents phosphorylation. Impairs recruitment to damaged DNA and double-strand break repair. Impairs interaction with histone H3 and its methylation. Allows replication fork restart.", "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" }, { "database": "PubMed", "id": "22231448", "url": "https://pubmed.ncbi.nlm.nih.gov/22231448" } ], "uniprot_canonical_ac": "Q53H47-1" } ], "phosphorylation": [ { "start_pos": 508, "end_pos": 508, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CHEK1", "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" }, { "database": "iPTMnet", "id": "Q53H47", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q53H47" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "22231448", "url": "https://pubmed.ncbi.nlm.nih.gov/22231448" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Ser508", "uniprot_canonical_ac": "Q53H47-1" } ], "record_id": "pubmed.22231448", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The DDN catalytic motif is required for Metnase functions in non-homologous end joining (NHEJ) repair and replication restart.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Kim HS, Chen Q, Kim SK, Nickoloff JA, Hromas R, Georgiadis MM, Lee SH", "reference": { "type": "PubMed", "id": "24573677", "url": "https://pubmed.ncbi.nlm.nih.gov/24573677" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 623, "end_pos": 623, "sequence_org": "N", "sequence_mut": "D", "comment": "Loss of function in DNA repair. Altered DNA-binding properties.", "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" }, { "database": "PubMed", "id": "24573677", "url": "https://pubmed.ncbi.nlm.nih.gov/24573677" } ], "uniprot_canonical_ac": "Q53H47-1" }, { "start_pos": 623, "end_pos": 623, "sequence_org": "N", "sequence_mut": "E", "comment": "Loss of function in DNA repair. Altered DNA-binding properties.", "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" }, { "database": "PubMed", "id": "24573677", "url": "https://pubmed.ncbi.nlm.nih.gov/24573677" } ], "uniprot_canonical_ac": "Q53H47-1" } ], "record_id": "pubmed.24573677", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The DNA repair component Metnase regulates Chk1 stability.", "journal": "Cell division", "date": "2014", "authors": "Williamson Elizabeth A, Wu Yuehan, Singh Sudha, Byrne Michael, Wray Justin, Lee Suk-Hee, Nickoloff Jac A, Hromas Robert", "reference": { "type": "PubMed", "id": "25024738", "url": "https://pubmed.ncbi.nlm.nih.gov/25024738" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 508, "end_pos": 508, "kinase_uniprot_canonical_ac": "O14757-1", "kinase_gene_name": "CHEK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q53H47", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q53H47" }, { "database": "PubMed", "id": "25024738", "url": "https://pubmed.ncbi.nlm.nih.gov/25024738" } ], "site_lbl": "Ser508", "uniprot_canonical_ac": "Q53H47-1" } ], "record_id": "pubmed.25024738", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and genome-wide analyses suggest that transposon-derived protein SETMAR alters transcription and splicing.", "journal": "The Journal of biological chemistry", "date": "2022", "authors": "Chen Q, Bates AM, Hanquier JN, Simpson E, Rusch DB, Podicheti R, Liu Y, Wek RC, Cornett EM, Georgiadis MM", "reference": { "type": "PubMed", "id": "35378129", "url": "https://pubmed.ncbi.nlm.nih.gov/35378129" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35378129", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Investigating the Expression Pattern of the SETMAR Gene Transcript Variants in Childhood Acute Leukemia: Revisiting an Old Gene.", "journal": "Journal of pediatric hematology/oncology", "date": "2023-07-01", "authors": "Boroumand-Noughabi Samaneh, Pashaee Ali, Montazer Mehdi, Rahmati Atefe, Ayatollahi Hossein, Sadeghian Mohammad Hadi, Keramati Mohammad Reza", "reference": { "type": "PubMed", "id": "36706314", "url": "https://pubmed.ncbi.nlm.nih.gov/36706314" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36706314", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular evolution of an ancient mariner transposon, Hsmar1, in the human genome.", "journal": "Gene", "date": "1997", "authors": "Robertson HM, Zumpano KL", "reference": { "type": "PubMed", "id": "9461395", "url": "https://pubmed.ncbi.nlm.nih.gov/9461395" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53H47-1", "protein_name": "Histone-lysine N-methyltransferase SETMAR", "gene_name": "SETMAR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53H47", "url": "https://www.uniprot.org/uniprotkb/Q53H47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9461395", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.", "journal": "Diabetologia", "date": "2009", "authors": "Song XY, Lee SY, Ma RC, So WY, Cai JH, Tam C, Lam V, Ying W, Ng MC, Chan JC", "reference": { "type": "PubMed", "id": "19479237", "url": "https://pubmed.ncbi.nlm.nih.gov/19479237" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99470-1", "protein_name": "Stromal cell-derived factor 2", "gene_name": "SDF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99470", "url": "https://www.uniprot.org/uniprotkb/Q99470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19479237", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcript analyses of stromal cell derived factors (SDFs): SDF-2, SDF-4 and SDF-5 reveal a different pattern of expression and prognostic association in human breast cancer.", "journal": "International journal of oncology", "date": "2009", "authors": "Kang H, Escudero-Esparza A, Douglas-Jones A, Mansel RE, Jiang WG", "reference": { "type": "PubMed", "id": "19513569", "url": "https://pubmed.ncbi.nlm.nih.gov/19513569" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99470-1", "protein_name": "Stromal cell-derived factor 2", "gene_name": "SDF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99470", "url": "https://www.uniprot.org/uniprotkb/Q99470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19513569", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stromal cell-derived factor 2 is critical for Hsp90-dependent eNOS activation.", "journal": "Science signaling", "date": "2015", "authors": "Siragusa M, Frohlich F, Park EJ, Schleicher M, Walther TC, Sessa WC", "reference": { "type": "PubMed", "id": "26286023", "url": "https://pubmed.ncbi.nlm.nih.gov/26286023" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99470-1", "protein_name": "Stromal cell-derived factor 2", "gene_name": "SDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29474-1", "protein_name": "Nitric oxide synthase 3", "gene_name": "NOS3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99470", "url": "https://www.uniprot.org/uniprotkb/Q99470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1177, "end_pos": 1177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AMPK", "evidence": [ { "database": "UniProtKB", "id": "P29474", "url": "https://www.uniprot.org/uniprotkb/P29474" }, { "database": "iPTMnet", "id": "P29474", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29474" }, { "database": "PubMed", "id": "19131647", "url": "https://pubmed.ncbi.nlm.nih.gov/19131647" }, { "database": "PubMed", "id": "10908731", "url": "https://pubmed.ncbi.nlm.nih.gov/10908731" }, { "database": "PubMed", "id": "11029403", "url": "https://pubmed.ncbi.nlm.nih.gov/11029403" }, { "database": "PubMed", "id": "11319202", "url": "https://pubmed.ncbi.nlm.nih.gov/11319202" }, { "database": "PubMed", "id": "11397791", "url": "https://pubmed.ncbi.nlm.nih.gov/11397791" }, { "database": "PubMed", "id": "11696579", "url": "https://pubmed.ncbi.nlm.nih.gov/11696579" }, { "database": "PubMed", "id": "11701613", "url": "https://pubmed.ncbi.nlm.nih.gov/11701613" }, { "database": "PubMed", "id": "11826414", "url": "https://pubmed.ncbi.nlm.nih.gov/11826414" }, { "database": "PubMed", "id": "11934843", "url": "https://pubmed.ncbi.nlm.nih.gov/11934843" }, { "database": "PubMed", "id": "12446767", "url": "https://pubmed.ncbi.nlm.nih.gov/12446767" }, { "database": "PubMed", "id": "12482742", "url": "https://pubmed.ncbi.nlm.nih.gov/12482742" }, { "database": "PubMed", "id": "12644458", "url": "https://pubmed.ncbi.nlm.nih.gov/12644458" }, { "database": "PubMed", "id": "12791703", "url": "https://pubmed.ncbi.nlm.nih.gov/12791703" }, { "database": "PubMed", "id": "14661033", "url": "https://pubmed.ncbi.nlm.nih.gov/14661033" }, { "database": "PubMed", "id": "14985356", "url": "https://pubmed.ncbi.nlm.nih.gov/14985356" }, { "database": "PubMed", "id": "15319431", "url": "https://pubmed.ncbi.nlm.nih.gov/15319431" }, { "database": "PubMed", "id": "15381390", "url": "https://pubmed.ncbi.nlm.nih.gov/15381390" }, { "database": "PubMed", "id": "15710249", "url": "https://pubmed.ncbi.nlm.nih.gov/15710249" }, { "database": "PubMed", "id": "15733940", "url": "https://pubmed.ncbi.nlm.nih.gov/15733940" }, { "database": "PubMed", "id": "15737995", "url": "https://pubmed.ncbi.nlm.nih.gov/15737995" }, { "database": "PubMed", "id": "15933265", "url": "https://pubmed.ncbi.nlm.nih.gov/15933265" }, { "database": "PubMed", "id": "16036314", "url": "https://pubmed.ncbi.nlm.nih.gov/16036314" }, { "database": "PubMed", "id": "16126727", "url": "https://pubmed.ncbi.nlm.nih.gov/16126727" }, { "database": "PubMed", "id": "16270749", "url": "https://pubmed.ncbi.nlm.nih.gov/16270749" }, { "database": "PubMed", "id": "16344378", "url": "https://pubmed.ncbi.nlm.nih.gov/16344378" }, { "database": "PubMed", "id": "16410224", "url": "https://pubmed.ncbi.nlm.nih.gov/16410224" }, { "database": "PubMed", "id": "16497987", "url": "https://pubmed.ncbi.nlm.nih.gov/16497987" }, { "database": "PubMed", "id": "16545819", "url": "https://pubmed.ncbi.nlm.nih.gov/16545819" }, { "database": "PubMed", "id": "16643490", "url": "https://pubmed.ncbi.nlm.nih.gov/16643490" }, { "database": "PubMed", "id": "16840783", "url": "https://pubmed.ncbi.nlm.nih.gov/16840783" }, { "database": "PubMed", "id": "16873402", "url": "https://pubmed.ncbi.nlm.nih.gov/16873402" }, { "database": "PubMed", "id": "16946136", "url": "https://pubmed.ncbi.nlm.nih.gov/16946136" }, { "database": "PubMed", "id": "17016497", "url": "https://pubmed.ncbi.nlm.nih.gov/17016497" }, { "database": "PubMed", "id": "17229561", "url": "https://pubmed.ncbi.nlm.nih.gov/17229561" }, { "database": "PubMed", "id": "17242275", "url": "https://pubmed.ncbi.nlm.nih.gov/17242275" }, { "database": "PubMed", "id": "17572401", "url": "https://pubmed.ncbi.nlm.nih.gov/17572401" }, { "database": "PubMed", "id": "17784906", "url": "https://pubmed.ncbi.nlm.nih.gov/17784906" }, { "database": "PubMed", "id": "18062898", "url": "https://pubmed.ncbi.nlm.nih.gov/18062898" }, { "database": "PubMed", "id": "18242595", "url": "https://pubmed.ncbi.nlm.nih.gov/18242595" }, { "database": "PubMed", "id": "18326799", "url": "https://pubmed.ncbi.nlm.nih.gov/18326799" }, { "database": "PubMed", "id": "18414637", "url": "https://pubmed.ncbi.nlm.nih.gov/18414637" }, { "database": "PubMed", "id": "18564176", "url": "https://pubmed.ncbi.nlm.nih.gov/18564176" }, { "database": "PubMed", "id": "18931031", "url": "https://pubmed.ncbi.nlm.nih.gov/18931031" }, { "database": "PubMed", "id": "19073885", "url": "https://pubmed.ncbi.nlm.nih.gov/19073885" }, { "database": "PubMed", "id": "19136580", "url": "https://pubmed.ncbi.nlm.nih.gov/19136580" }, { "database": "PubMed", "id": "19188511", "url": "https://pubmed.ncbi.nlm.nih.gov/19188511" }, { "database": "PubMed", "id": "19262472", "url": "https://pubmed.ncbi.nlm.nih.gov/19262472" }, { "database": "PubMed", "id": "19320971", "url": "https://pubmed.ncbi.nlm.nih.gov/19320971" }, { "database": "PubMed", "id": "19342481", "url": "https://pubmed.ncbi.nlm.nih.gov/19342481" }, { "database": "PubMed", "id": "19351806", "url": "https://pubmed.ncbi.nlm.nih.gov/19351806" }, { "database": "PubMed", "id": "19465546", "url": "https://pubmed.ncbi.nlm.nih.gov/19465546" }, { "database": "PubMed", "id": "19501907", "url": "https://pubmed.ncbi.nlm.nih.gov/19501907" }, { "database": "PubMed", "id": "19632222", "url": "https://pubmed.ncbi.nlm.nih.gov/19632222" }, { "database": "PubMed", "id": "19881293", "url": "https://pubmed.ncbi.nlm.nih.gov/19881293" }, { "database": "PubMed", "id": "20108211", "url": "https://pubmed.ncbi.nlm.nih.gov/20108211" }, { "database": "PubMed", "id": "20299462", "url": "https://pubmed.ncbi.nlm.nih.gov/20299462" }, { "database": "PubMed", "id": "20375905", "url": "https://pubmed.ncbi.nlm.nih.gov/20375905" }, { "database": "PubMed", "id": "20416296", "url": "https://pubmed.ncbi.nlm.nih.gov/20416296" }, { "database": "PubMed", "id": "20881236", "url": "https://pubmed.ncbi.nlm.nih.gov/20881236" }, { "database": "PubMed", "id": "21063103", "url": "https://pubmed.ncbi.nlm.nih.gov/21063103" }, { "database": "PubMed", "id": "21139021", "url": "https://pubmed.ncbi.nlm.nih.gov/21139021" }, { "database": "PubMed", "id": "21147698", "url": "https://pubmed.ncbi.nlm.nih.gov/21147698" }, { "database": "PubMed", "id": "21234858", "url": "https://pubmed.ncbi.nlm.nih.gov/21234858" }, { "database": "PubMed", "id": "21741389", "url": "https://pubmed.ncbi.nlm.nih.gov/21741389" }, { "database": "PubMed", "id": "21757745", "url": "https://pubmed.ncbi.nlm.nih.gov/21757745" }, { "database": "PubMed", "id": "22037549", "url": "https://pubmed.ncbi.nlm.nih.gov/22037549" }, { "database": "PubMed", "id": "22120969", "url": "https://pubmed.ncbi.nlm.nih.gov/22120969" }, { "database": "PubMed", "id": "22219320", "url": "https://pubmed.ncbi.nlm.nih.gov/22219320" }, { "database": "PubMed", "id": "22294688", "url": "https://pubmed.ncbi.nlm.nih.gov/22294688" }, { "database": "PubMed", "id": "22323292", "url": "https://pubmed.ncbi.nlm.nih.gov/22323292" }, { "database": "PubMed", "id": "22469105", "url": "https://pubmed.ncbi.nlm.nih.gov/22469105" }, { "database": "PubMed", "id": "22542797", "url": "https://pubmed.ncbi.nlm.nih.gov/22542797" }, { "database": "PubMed", "id": "22728282", "url": "https://pubmed.ncbi.nlm.nih.gov/22728282" }, { "database": "PubMed", "id": "23204109", "url": "https://pubmed.ncbi.nlm.nih.gov/23204109" }, { "database": "PubMed", "id": "23264539", "url": "https://pubmed.ncbi.nlm.nih.gov/23264539" }, { "database": "PubMed", "id": "23284736", "url": "https://pubmed.ncbi.nlm.nih.gov/23284736" }, { "database": "PubMed", "id": "23328297", "url": "https://pubmed.ncbi.nlm.nih.gov/23328297" }, { "database": "PubMed", "id": "23604495", "url": "https://pubmed.ncbi.nlm.nih.gov/23604495" }, { "database": "PubMed", "id": "23624269", "url": "https://pubmed.ncbi.nlm.nih.gov/23624269" }, { "database": "PubMed", "id": "23804534", "url": "https://pubmed.ncbi.nlm.nih.gov/23804534" }, { "database": "PubMed", "id": "23836447", "url": "https://pubmed.ncbi.nlm.nih.gov/23836447" }, { "database": "PubMed", "id": "23959544", "url": "https://pubmed.ncbi.nlm.nih.gov/23959544" }, { "database": "PubMed", "id": "24319055", "url": "https://pubmed.ncbi.nlm.nih.gov/24319055" }, { "database": "PubMed", "id": "24376548", "url": "https://pubmed.ncbi.nlm.nih.gov/24376548" }, { "database": "PubMed", "id": "24520379", "url": "https://pubmed.ncbi.nlm.nih.gov/24520379" }, { "database": "PubMed", "id": "24587005", "url": "https://pubmed.ncbi.nlm.nih.gov/24587005" }, { "database": "PubMed", "id": "24757494", "url": "https://pubmed.ncbi.nlm.nih.gov/24757494" }, { "database": "PubMed", "id": "24804268", "url": "https://pubmed.ncbi.nlm.nih.gov/24804268" }, { "database": "PubMed", "id": "24827148", "url": "https://pubmed.ncbi.nlm.nih.gov/24827148" }, { "database": "PubMed", "id": "24887036", "url": "https://pubmed.ncbi.nlm.nih.gov/24887036" }, { "database": "PubMed", "id": "24914683", "url": "https://pubmed.ncbi.nlm.nih.gov/24914683" }, { "database": "PubMed", "id": "24971375", "url": "https://pubmed.ncbi.nlm.nih.gov/24971375" }, { "database": "PubMed", "id": "25133540", "url": "https://pubmed.ncbi.nlm.nih.gov/25133540" }, { "database": "PubMed", "id": "25170746", "url": "https://pubmed.ncbi.nlm.nih.gov/25170746" }, { "database": "PubMed", "id": "25407137", "url": "https://pubmed.ncbi.nlm.nih.gov/25407137" }, { "database": "PubMed", "id": "25419657", "url": "https://pubmed.ncbi.nlm.nih.gov/25419657" }, { "database": "PubMed", "id": "25869503", "url": "https://pubmed.ncbi.nlm.nih.gov/25869503" }, { "database": "PubMed", "id": "26286023", "url": "https://pubmed.ncbi.nlm.nih.gov/26286023" }, { "database": "PubMed", "id": "26297582", "url": "https://pubmed.ncbi.nlm.nih.gov/26297582" }, { "database": "PubMed", "id": "26662566", "url": "https://pubmed.ncbi.nlm.nih.gov/26662566" }, { "database": "PubMed", "id": "27002278", "url": "https://pubmed.ncbi.nlm.nih.gov/27002278" }, { "database": "PubMed", "id": "27170438", "url": "https://pubmed.ncbi.nlm.nih.gov/27170438" }, { "database": "PubMed", "id": "27235860", "url": "https://pubmed.ncbi.nlm.nih.gov/27235860" }, { "database": "PubMed", "id": "27279530", "url": "https://pubmed.ncbi.nlm.nih.gov/27279530" }, { "database": "PubMed", "id": "27463705", "url": "https://pubmed.ncbi.nlm.nih.gov/27463705" }, { "database": "PubMed", "id": "27563480", "url": "https://pubmed.ncbi.nlm.nih.gov/27563480" }, { "database": "PubMed", "id": "27593859", "url": "https://pubmed.ncbi.nlm.nih.gov/27593859" }, { "database": "PubMed", "id": "27773804", "url": "https://pubmed.ncbi.nlm.nih.gov/27773804" }, { "database": "PubMed", "id": "27923677", "url": "https://pubmed.ncbi.nlm.nih.gov/27923677" }, { "database": "PubMed", "id": "28000882", "url": "https://pubmed.ncbi.nlm.nih.gov/28000882" }, { "database": "PubMed", "id": "28067284", "url": "https://pubmed.ncbi.nlm.nih.gov/28067284" }, { "database": "PubMed", "id": "28214453", "url": "https://pubmed.ncbi.nlm.nih.gov/28214453" }, { "database": "PubMed", "id": "28409476", "url": "https://pubmed.ncbi.nlm.nih.gov/28409476" }, { "database": "PubMed", "id": "28559108", "url": "https://pubmed.ncbi.nlm.nih.gov/28559108" }, { "database": "PubMed", "id": "28581447", "url": "https://pubmed.ncbi.nlm.nih.gov/28581447" }, { "database": "PubMed", "id": "28627664", "url": "https://pubmed.ncbi.nlm.nih.gov/28627664" }, { "database": "PubMed", "id": "28725180", "url": "https://pubmed.ncbi.nlm.nih.gov/28725180" }, { "database": "PubMed", "id": "28801524", "url": "https://pubmed.ncbi.nlm.nih.gov/28801524" }, { "database": "PubMed", "id": "28870504", "url": "https://pubmed.ncbi.nlm.nih.gov/28870504" }, { "database": "PubMed", "id": "28912066", "url": "https://pubmed.ncbi.nlm.nih.gov/28912066" }, { "database": "PubMed", "id": "29104511", "url": "https://pubmed.ncbi.nlm.nih.gov/29104511" }, { "database": "PubMed", "id": "29374229", "url": "https://pubmed.ncbi.nlm.nih.gov/29374229" }, { "database": "PubMed", "id": "29410170", "url": "https://pubmed.ncbi.nlm.nih.gov/29410170" }, { "database": "PubMed", "id": "29466710", "url": "https://pubmed.ncbi.nlm.nih.gov/29466710" }, { "database": "PubMed", "id": "29563255", "url": "https://pubmed.ncbi.nlm.nih.gov/29563255" }, { "database": "PubMed", "id": "29566307", "url": "https://pubmed.ncbi.nlm.nih.gov/29566307" }, { "database": "PubMed", "id": "29632805", "url": "https://pubmed.ncbi.nlm.nih.gov/29632805" }, { "database": "PubMed", "id": "29888556", "url": "https://pubmed.ncbi.nlm.nih.gov/29888556" }, { "database": "PubMed", "id": "29899706", "url": "https://pubmed.ncbi.nlm.nih.gov/29899706" }, { "database": "PubMed", "id": "30048241", "url": "https://pubmed.ncbi.nlm.nih.gov/30048241" }, { "database": "PubMed", "id": "30471424", "url": "https://pubmed.ncbi.nlm.nih.gov/30471424" }, { "database": "PubMed", "id": "30513637", "url": "https://pubmed.ncbi.nlm.nih.gov/30513637" }, { "database": "PubMed", "id": "31584065", "url": "https://pubmed.ncbi.nlm.nih.gov/31584065" }, { "database": "PubMed", "id": "31744135", "url": "https://pubmed.ncbi.nlm.nih.gov/31744135" }, { "database": "PubMed", "id": "31747921", "url": "https://pubmed.ncbi.nlm.nih.gov/31747921" }, { "database": "PubMed", "id": "31754254", "url": "https://pubmed.ncbi.nlm.nih.gov/31754254" }, { "database": "PubMed", "id": "31871538", "url": "https://pubmed.ncbi.nlm.nih.gov/31871538" }, { "database": "PubMed", "id": "31973180", "url": "https://pubmed.ncbi.nlm.nih.gov/31973180" }, { "database": "PubMed", "id": "32106617", "url": "https://pubmed.ncbi.nlm.nih.gov/32106617" }, { "database": "PubMed", "id": "32161546", "url": "https://pubmed.ncbi.nlm.nih.gov/32161546" }, { "database": "PubMed", "id": "32251485", "url": "https://pubmed.ncbi.nlm.nih.gov/32251485" }, { "database": "PubMed", "id": "32544536", "url": "https://pubmed.ncbi.nlm.nih.gov/32544536" }, { "database": "PubMed", "id": "32566092", "url": "https://pubmed.ncbi.nlm.nih.gov/32566092" }, { "database": "PubMed", "id": "32590330", "url": "https://pubmed.ncbi.nlm.nih.gov/32590330" }, { "database": "PubMed", "id": "32606304", "url": "https://pubmed.ncbi.nlm.nih.gov/32606304" }, { "database": "PubMed", "id": "32653904", "url": "https://pubmed.ncbi.nlm.nih.gov/32653904" }, { "database": "PubMed", "id": "32676485", "url": "https://pubmed.ncbi.nlm.nih.gov/32676485" }, { "database": "PubMed", "id": "32696742", "url": "https://pubmed.ncbi.nlm.nih.gov/32696742" }, { "database": "PubMed", "id": "32781622", "url": "https://pubmed.ncbi.nlm.nih.gov/32781622" }, { "database": "PubMed", "id": "32863226", "url": "https://pubmed.ncbi.nlm.nih.gov/32863226" }, { "database": "PubMed", "id": "32872351", "url": "https://pubmed.ncbi.nlm.nih.gov/32872351" }, { "database": "PubMed", "id": "32927592", "url": "https://pubmed.ncbi.nlm.nih.gov/32927592" }, { "database": "PubMed", "id": "32977740", "url": "https://pubmed.ncbi.nlm.nih.gov/32977740" }, { "database": "PubMed", "id": "33129903", "url": "https://pubmed.ncbi.nlm.nih.gov/33129903" }, { "database": "PubMed", "id": "33168911", "url": "https://pubmed.ncbi.nlm.nih.gov/33168911" }, { "database": "PubMed", "id": "33320446", "url": "https://pubmed.ncbi.nlm.nih.gov/33320446" }, { "database": "PubMed", "id": "33506378", "url": "https://pubmed.ncbi.nlm.nih.gov/33506378" }, { "database": "PubMed", "id": "33899122", "url": "https://pubmed.ncbi.nlm.nih.gov/33899122" }, { "database": "PubMed", "id": "34026871", "url": "https://pubmed.ncbi.nlm.nih.gov/34026871" }, { "database": "PubMed", "id": "34954278", "url": "https://pubmed.ncbi.nlm.nih.gov/34954278" }, { "database": "PubMed", "id": "35157107", "url": "https://pubmed.ncbi.nlm.nih.gov/35157107" }, { "database": "PubMed", "id": "35195045", "url": "https://pubmed.ncbi.nlm.nih.gov/35195045" }, { "database": "PubMed", "id": "35217004", "url": "https://pubmed.ncbi.nlm.nih.gov/35217004" }, { "database": "PubMed", "id": "35300809", "url": "https://pubmed.ncbi.nlm.nih.gov/35300809" }, { "database": "PubMed", "id": "35874500", "url": "https://pubmed.ncbi.nlm.nih.gov/35874500" }, { "database": "PubMed", "id": "35884891", "url": "https://pubmed.ncbi.nlm.nih.gov/35884891" }, { "database": "PubMed", "id": "36305972", "url": "https://pubmed.ncbi.nlm.nih.gov/36305972" }, { "database": "PubMed", "id": "36312762", "url": "https://pubmed.ncbi.nlm.nih.gov/36312762" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser1177", "uniprot_canonical_ac": "P29474-1" } ], "record_id": "pubmed.26286023", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protection of stromal cell-derived factor 2 by heat shock protein 72 prevents oxaliplatin-induced cell death in oxaliplatin-resistant human gastric cancer cells.", "journal": "Cancer letters", "date": "2016", "authors": "Takahashi K, Tanaka M, Yashiro M, Matsumoto M, Ohtsuka A, Nakayama KI, Izumi Y, Nagayama K, Miura K, Iwao H, Shiota M", "reference": { "type": "PubMed", "id": "27157913", "url": "https://pubmed.ncbi.nlm.nih.gov/27157913" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99470-1", "protein_name": "Stromal cell-derived factor 2", "gene_name": "SDF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99470", "url": "https://www.uniprot.org/uniprotkb/Q99470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27157913", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stromal Cell-Derived Factor 2: A Novel Protein that Interferes in Endoplasmic Reticulum Stress Pathway in Human Placental Cells.", "journal": "Biology of reproduction", "date": "2016", "authors": "Lorenzon-Ojea AR, Guzzo CR, Kapidzic M, Fisher SJ, Bevilacqua E", "reference": { "type": "PubMed", "id": "27335075", "url": "https://pubmed.ncbi.nlm.nih.gov/27335075" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99470-1", "protein_name": "Stromal cell-derived factor 2", "gene_name": "SDF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99470", "url": "https://www.uniprot.org/uniprotkb/Q99470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27335075", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Endoplasmic reticulum proteins SDF2 and SDF2L1 act as components of the BiP chaperone cycle to prevent protein aggregation.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2017", "authors": "Fujimori T, Suno R, Iemura SI, Natsume T, Wada I, Hosokawa N", "reference": { "type": "PubMed", "id": "28597544", "url": "https://pubmed.ncbi.nlm.nih.gov/28597544" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99470-1", "protein_name": "Stromal cell-derived factor 2", "gene_name": "SDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN8-1", "protein_name": "Stromal cell-derived factor 2-like protein 1", "gene_name": "SDF2L1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99470", "url": "https://www.uniprot.org/uniprotkb/Q99470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28597544", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stromal Cell-Derived Factor (SDF) 2 and the Endoplasmic Reticulum Stress Response of Trophoblast Cells in Gestational Diabetes Mellitus and In vitro Hyperglycaemic Condition.", "journal": "Current vascular pharmacology", "date": "2021", "authors": "Lorenzon AR, Moreli JB, de Macedo Melo R, Namba FY, Staff AC, Yung HW, Burton GJ, Bevilacqua E", "reference": { "type": "PubMed", "id": "32504504", "url": "https://pubmed.ncbi.nlm.nih.gov/32504504" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99470-1", "protein_name": "Stromal cell-derived factor 2", "gene_name": "SDF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99470", "url": "https://www.uniprot.org/uniprotkb/Q99470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32504504", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of a novel secretory protein, stromal cell-derived factor-2 (SDF-2) using the signal sequence trap method.", "journal": "Gene", "date": "1996", "authors": "Hamada T, Tashiro K, Tada H, Inazawa J, Shirozu M, Shibahara K, Nakamura T, Martina N, Nakano T, Honjo T", "reference": { "type": "PubMed", "id": "8918255", "url": "https://pubmed.ncbi.nlm.nih.gov/8918255" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99470-1", "protein_name": "Stromal cell-derived factor 2", "gene_name": "SDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9DCT5-1", "protein_name": "Stromal cell-derived factor 2", "gene_name": "Sdf2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99470", "url": "https://www.uniprot.org/uniprotkb/Q99470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8918255", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The SPANX gene family of cancer/testis-specific antigens: rapid evolution and amplification in African great apes and hominids.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Kouprina N, Mullokandov M, Rogozin IB, Collins NK, Solomon G, Otstot J, Risinger JI, Koonin EV, Barrett JC, Larionov V", "reference": { "type": "PubMed", "id": "14973187", "url": "https://pubmed.ncbi.nlm.nih.gov/14973187" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5MJ08-1", "protein_name": "Sperm protein associated with the nucleus on the X chromosome N4", "gene_name": "SPANXN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VSR9-1", "protein_name": "Sperm protein associated with the nucleus on the X chromosome N1", "gene_name": "SPANXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5MJ09-1", "protein_name": "Sperm protein associated with the nucleus on the X chromosome N3", "gene_name": "SPANXN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5MJ07-1", "protein_name": "Sperm protein associated with the nucleus on the X chromosome N5", "gene_name": "SPANXN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5MJ10-1", "protein_name": "Sperm protein associated with the nucleus on the X chromosome N2", "gene_name": "SPANXN2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5MJ08", "url": "https://www.uniprot.org/uniprotkb/Q5MJ08" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14973187", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]