[ { "title": "Molecular mechanisms of EAST/SeSAME syndrome mutations in Kir4.1 (KCNJ10).", "journal": "The Journal of biological chemistry", "date": "2010-11-12", "authors": "Sala-Rabanal Monica, Kucheryavykh Lilia Y, Skatchkov Serguei N, Eaton Misty J, Nichols Colin G", "reference": { "type": "PubMed", "id": "20807765", "url": "https://pubmed.ncbi.nlm.nih.gov/20807765" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49655-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 10", "gene_name": "Kcnj10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P52191-1", "protein_name": "Inward rectifier potassium channel 16", "gene_name": "Kcnj16", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P78508-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 10", "gene_name": "KCNJ10", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 140, "end_pos": 140, "sequence_org": "C", "sequence_mut": "R", "comment": "Loss of potassium ion transport.", "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" }, { "database": "PubMed", "id": "20807765", "url": "https://pubmed.ncbi.nlm.nih.gov/20807765" } ], "uniprot_canonical_ac": "P49655-1" }, { "start_pos": 164, "end_pos": 164, "sequence_org": "T", "sequence_mut": "I", "comment": "Decreased potassium ion transport. Results in a shift to a more alkaline pH for channel activation.", "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" }, { "database": "PubMed", "id": "20807765", "url": "https://pubmed.ncbi.nlm.nih.gov/20807765" } ], "uniprot_canonical_ac": "P49655-1" }, { "start_pos": 167, "end_pos": 167, "sequence_org": "A", "sequence_mut": "V", "comment": "Decreased potassium ion transport.", "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" }, { "database": "PubMed", "id": "20807765", "url": "https://pubmed.ncbi.nlm.nih.gov/20807765" } ], "uniprot_canonical_ac": "P49655-1" }, { "start_pos": 199, "end_pos": 379, "sequence_org": "RVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV", "sequence_mut": "", "comment": "Loss of potassium ion transport.", "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" }, { "database": "PubMed", "id": "20807765", "url": "https://pubmed.ncbi.nlm.nih.gov/20807765" } ], "uniprot_canonical_ac": "P49655-1" }, { "start_pos": 297, "end_pos": 297, "sequence_org": "R", "sequence_mut": "C", "comment": "Loss of potassium ion transport. Results in a shift to a more alkaline pH for channel activation.", "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" }, { "database": "PubMed", "id": "20807765", "url": "https://pubmed.ncbi.nlm.nih.gov/20807765" } ], "uniprot_canonical_ac": "P49655-1" }, { "start_pos": 65, "end_pos": 65, "sequence_org": "R", "sequence_mut": "P", "comment": "Decreased potassium ion transport. Results in a shift to a more alkaline pH for channel activation.", "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" }, { "database": "PubMed", "id": "20807765", "url": "https://pubmed.ncbi.nlm.nih.gov/20807765" } ], "uniprot_canonical_ac": "P49655-1" }, { "start_pos": 77, "end_pos": 77, "sequence_org": "G", "sequence_mut": "R", "comment": "Loss of potassium ion transport.", "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" }, { "database": "PubMed", "id": "20807765", "url": "https://pubmed.ncbi.nlm.nih.gov/20807765" } ], "uniprot_canonical_ac": "P49655-1" } ], "record_id": "pubmed.20807765", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Advanced glycation end (AGE) product modification of laminin downregulates Kir4.1 in retinal Muller cells.", "journal": "PloS one", "date": "2018", "authors": "Thompson K, Chen J, Luo Q, Xiao Y, Cummins TR, Bhatwadekar AD", "reference": { "type": "PubMed", "id": "29474462", "url": "https://pubmed.ncbi.nlm.nih.gov/29474462" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49655-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 10", "gene_name": "Kcnj10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.29474462", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Down-Regulation of Astrocytic Kir4.1 Channels during the Audiogenic Epileptogenesis in Leucine-Rich Glioma-Inactivated 1 (Lgi1) Mutant Rats.", "journal": "International journal of molecular sciences", "date": "2019", "authors": "Kinboshi M, Shimizu S, Mashimo T, Serikawa T, Ito H, Ikeda A, Takahashi R, Ohno Y", "reference": { "type": "PubMed", "id": "30813600", "url": "https://pubmed.ncbi.nlm.nih.gov/30813600" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49655-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 10", "gene_name": "Kcnj10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q8K4Y5-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "Lgi1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.30813600", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Correlation between Kir4.1 expression and barium-sensitive currents in rat and human glioma cell lines.", "journal": "Neuroscience letters", "date": "2021", "authors": "Madadi A, Wolfart J, Lange F, Brehme H, Linnebacher M, Brauer AU, Buttner A, Freiman T, Henker C, Einsle A, Rackow S, Kohling R, Kirschstein T, Muller S", "reference": { "type": "PubMed", "id": "33161102", "url": "https://pubmed.ncbi.nlm.nih.gov/33161102" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49655-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 10", "gene_name": "Kcnj10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33161102", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dysfunction of oligodendrocyte inwardly rectifying potassium channel in a rat model of amyotrophic lateral sclerosis.", "journal": "The European journal of neuroscience", "date": "2021", "authors": "Peric M, Nikolic L, Andjus PR, Bataveljic D", "reference": { "type": "PubMed", "id": "34510584", "url": "https://pubmed.ncbi.nlm.nih.gov/34510584" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49655-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 10", "gene_name": "Kcnj10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.34510584", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[IL-6 promotes the activation of rat astrocytes and down-regulation of the expression of Kir4.1 channel].", "journal": "Xi bao yu fen zi mian yi xue za zhi = Chinese journal of cellular and molecular immunology", "date": "2022", "authors": "Lu S, Wang J, Sun T, Yan H, Zou W, Li H, Qi Q, Sun M", "reference": { "type": "PubMed", "id": "35583060", "url": "https://pubmed.ncbi.nlm.nih.gov/35583060" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49655-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 10", "gene_name": "Kcnj10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.35583060", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pharmacological inhibition of Kir4.1 evokes rapid-onset antidepressant responses.", "journal": "Nat. Chem. Biol.", "date": "2024", "authors": "Zhou Xiaoyu, Zhao Cheng, Xu Haiyan, Xu Yixiang, Zhan Li, Wang Pei, He Jingyi, Lu Taotao, Gu Yueling, Yang Yan, Xu Chanjuan, Chen Yiyang, Liu Yuxuan, Zeng Yue, Tian Fuyun, Chen Qian, Xie Xin, Liu Jianfeng, Hu Hailan, Li Jian, Zheng Yueming, Guo Jiangtao, Gao Zhaobing", "reference": { "type": "PubMed", "id": "38355723", "url": "https://pubmed.ncbi.nlm.nih.gov/38355723" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49655-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 10", "gene_name": "Kcnj10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.38355723", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel ATP-dependent inward rectifier potassium channel expressed predominantly in glial cells.", "journal": "The Journal of biological chemistry", "date": "1995-07-07", "authors": "Takumi T, Ishii T, Horio Y, Morishige K, Takahashi N, Yamada M, Yamashita T, Kiyama H, Sohmiya K, Nakanishi S", "reference": { "type": "PubMed", "id": "7608203", "url": "https://pubmed.ncbi.nlm.nih.gov/7608203" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49655-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 10", "gene_name": "Kcnj10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P49655", "url": "https://www.uniprot.org/uniprotkb/P49655" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7608203", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation and inactivation of HMG-CoA reductase at the AMP-activated protein kinase site in response to fructose treatment of isolated rat hepatocytes.", "journal": "FEBS Lett.", "date": "1992", "authors": "Gillespie JG, Hardie DG", "reference": { "type": "PubMed", "id": "1628744", "url": "https://pubmed.ncbi.nlm.nih.gov/1628744" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51639-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "Hmgcr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51639", "url": "https://www.uniprot.org/uniprotkb/P51639" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 871, "end_pos": 871, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AMPK", "evidence": [ { "database": "UniProtKB", "id": "P51639", "url": "https://www.uniprot.org/uniprotkb/P51639" }, { "database": "iPTMnet", "id": "P51639", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51639" }, { "database": "PubMed", "id": "1628744", "url": "https://pubmed.ncbi.nlm.nih.gov/1628744" }, { "database": "PubMed", "id": "2369897", "url": "https://pubmed.ncbi.nlm.nih.gov/2369897" } ], "site_lbl": "Ser871", "uniprot_canonical_ac": "P51639-1" } ], "record_id": "pubmed.1628744", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of HMG-CoA reductase: identification of the site phosphorylated by the AMP-activated protein kinase in vitro and in intact rat liver.", "journal": "The EMBO journal", "date": "1990", "authors": "Clarke PR, Hardie DG", "reference": { "type": "PubMed", "id": "2369897", "url": "https://pubmed.ncbi.nlm.nih.gov/2369897" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51639-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "Hmgcr", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q09137-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-2", "gene_name": "Prkaa2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P54645-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-1", "gene_name": "Prkaa1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51639", "url": "https://www.uniprot.org/uniprotkb/P51639" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 871, "end_pos": 871, "kinase_uniprot_canonical_ac": "P27791-1", "kinase_gene_name": "Prkaca", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51639", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51639" }, { "database": "PubMed", "id": "2369897", "url": "https://pubmed.ncbi.nlm.nih.gov/2369897" } ], "site_lbl": "Ser871", "uniprot_canonical_ac": "P51639-1" }, { "start_pos": 871, "end_pos": 871, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AMPK", "evidence": [ { "database": "UniProtKB", "id": "P51639", "url": "https://www.uniprot.org/uniprotkb/P51639" }, { "database": "iPTMnet", "id": "P51639", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51639" }, { "database": "PubMed", "id": "1628744", "url": "https://pubmed.ncbi.nlm.nih.gov/1628744" }, { "database": "PubMed", "id": "2369897", "url": "https://pubmed.ncbi.nlm.nih.gov/2369897" } ], "site_lbl": "Ser871", "uniprot_canonical_ac": "P51639-1" }, { "start_pos": 872, "end_pos": 872, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04035", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04035" }, { "database": "PubMed", "id": "2369897", "url": "https://pubmed.ncbi.nlm.nih.gov/2369897" } ], "site_lbl": "Ser872", "uniprot_canonical_ac": "P04035-1" }, { "start_pos": 872, "end_pos": 872, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04035", "url": "https://www.uniprot.org/uniprotkb/P04035" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "iPTMnet", "id": "P04035", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04035" }, { "database": "PubMed", "id": "2369897", "url": "https://pubmed.ncbi.nlm.nih.gov/2369897" }, { "database": "PubMed", "id": "32526887", "url": "https://pubmed.ncbi.nlm.nih.gov/32526887" } ], "site_lbl": "Ser872", "uniprot_canonical_ac": "P04035-1" } ], "record_id": "pubmed.2369897", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of hepatic hydroxy methyl glutarate - CoA reductase for controlling hypercholesterolemia in rats.", "journal": "Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie", "date": "2017", "authors": "Khamis AA, Salama AF, Kenawy ME, Mohamed TM", "reference": { "type": "PubMed", "id": "28938515", "url": "https://pubmed.ncbi.nlm.nih.gov/28938515" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51639-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "Hmgcr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51639", "url": "https://www.uniprot.org/uniprotkb/P51639" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.28938515", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A-family anti-inflammatory cyclopentenone prostaglandins: A novel class of non-statin inhibitors of HMG-CoA reductase.", "journal": "Biochimie", "date": "2021", "authors": "Gutierrez LLP, Marques CV, Scomazzon SP, Schroeder HT, Fernandes JR, da Silva Rossato J, Homem de Bittencourt PI Jr", "reference": { "type": "PubMed", "id": "33412161", "url": "https://pubmed.ncbi.nlm.nih.gov/33412161" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51639-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "Hmgcr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51639", "url": "https://www.uniprot.org/uniprotkb/P51639" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33412161", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An evolutionarily-conserved promoter allele governs HMG-CoA reductase expression in spontaneously hypertensive rat.", "journal": "Journal of molecular and cellular cardiology", "date": "2021", "authors": "Khan AA, Sundar P, Natarajan B, Gupta V, Arige V, Reddy SS, Barthwal MK, Mahapatra NR", "reference": { "type": "PubMed", "id": "34081950", "url": "https://pubmed.ncbi.nlm.nih.gov/34081950" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51639-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "Hmgcr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51639", "url": "https://www.uniprot.org/uniprotkb/P51639" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.34081950", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional size of rat hepatic 3-hydroxy-3-methylglutaryl coenzyme A reductase as determined by radiation inactivation.", "journal": "The Journal of biological chemistry", "date": "1985-08-25", "authors": "Edwards P A, Kempner E S, Lan S F, Erickson S K", "reference": { "type": "PubMed", "id": "4019513", "url": "https://pubmed.ncbi.nlm.nih.gov/4019513" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51639-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "Hmgcr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51639", "url": "https://www.uniprot.org/uniprotkb/P51639" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.4019513", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Temporally and spatially regulated expression of a candidate G-protein-coupled receptor during cerebral cortical development.", "journal": "J. Neurobiol.", "date": "2001", "authors": "Chenn A, Levin ME, McConnell SK", "reference": { "type": "PubMed", "id": "11169503", "url": "https://pubmed.ncbi.nlm.nih.gov/11169503" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51651-1", "protein_name": "G protein-coupled receptor 6", "gene_name": "Gpr6", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51651", "url": "https://www.uniprot.org/uniprotkb/P51651" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11169503", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Constitutively active GPR6 is located in the intracellular compartments.", "journal": "FEBS letters", "date": "2009", "authors": "Padmanabhan S, Myers AG, Prasad BM", "reference": { "type": "PubMed", "id": "19059244", "url": "https://pubmed.ncbi.nlm.nih.gov/19059244" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51651-1", "protein_name": "G protein-coupled receptor 6", "gene_name": "Gpr6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P46095-1", "protein_name": "G protein-coupled receptor 6", "gene_name": "GPR6", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51651", "url": "https://www.uniprot.org/uniprotkb/P51651" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.19059244", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Investigation of non-CB1, non-CB2 WIN55212-2-sensitive G-protein-coupled receptors in the brains of mammals, birds, and amphibians.", "journal": "Journal of receptor and signal transduction research", "date": "2018", "authors": "Breivogel CS, McPartland JM, Parekh B", "reference": { "type": "PubMed", "id": "30376752", "url": "https://pubmed.ncbi.nlm.nih.gov/30376752" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51651-1", "protein_name": "G protein-coupled receptor 6", "gene_name": "Gpr6", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51651", "url": "https://www.uniprot.org/uniprotkb/P51651" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.30376752", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of a novel candidate G protein-coupled receptor from rat brain.", "journal": "FEBS Lett.", "date": "1994", "authors": "Song ZH, Young WS 3rd, Brownstein MJ, Bonner TI", "reference": { "type": "PubMed", "id": "8082799", "url": "https://pubmed.ncbi.nlm.nih.gov/8082799" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51651-1", "protein_name": "G protein-coupled receptor 6", "gene_name": "Gpr6", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51651", "url": "https://www.uniprot.org/uniprotkb/P51651" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8082799", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cerebroglycan: an integral membrane heparan sulfate proteoglycan that is unique to the developing nervous system and expressed specifically during neuronal differentiation.", "journal": "J. Cell Biol.", "date": "1994", "authors": "Stipp C S, Litwack E D, Lander A D", "reference": { "type": "PubMed", "id": "8294498", "url": "https://pubmed.ncbi.nlm.nih.gov/8294498" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51653-1", "protein_name": "Glypican-2", "gene_name": "Gpc2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51653", "url": "https://www.uniprot.org/uniprotkb/P51653" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8294498", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning, functional expression and localization of a novel inward rectifier potassium channel in the rat brain.", "journal": "FEBS letters", "date": "1994-03-21", "authors": "Koyama H, Morishige K, Takahashi N, Zanelli J S, Fass D N, Kurachi Y", "reference": { "type": "PubMed", "id": "8137958", "url": "https://pubmed.ncbi.nlm.nih.gov/8137958" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52188-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 12", "gene_name": "Kcnj12", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P52188", "url": "https://www.uniprot.org/uniprotkb/P52188" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8137958", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "pH dependence of the inwardly rectifying potassium channel, Kir5.1, and localization in renal tubular epithelia.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Tucker S J, Imbrici P, Salvatore L, D'Adamo M C, Pessia M", "reference": { "type": "PubMed", "id": "10764726", "url": "https://pubmed.ncbi.nlm.nih.gov/10764726" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52191-1", "protein_name": "Inward rectifier potassium channel 16", "gene_name": "Kcnj16", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P52191", "url": "https://www.uniprot.org/uniprotkb/P52191" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10764726", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Elevation of the post-translational modification of proteins by O-linked N-acetylglucosamine leads to deterioration of the glucose-stimulated insulin secretion in the pancreas of diabetic Goto-Kakizaki rats.", "journal": "Glycobiology", "date": "2007", "authors": "Akimoto Y, Hart GW, Wells L, Vosseller K, Yamamoto K, Munetomo E, Ohara-Imaizumi M, Nishiwaki C, Nagamatsu S, Hirano H, Kawakami H", "reference": { "type": "PubMed", "id": "17095531", "url": "https://pubmed.ncbi.nlm.nih.gov/17095531" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P52947-1", "protein_name": "Pancreas/duodenum homeobox protein 1", "gene_name": "Pdx1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P52947", "url": "https://www.uniprot.org/uniprotkb/P52947" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "17095531", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17095531" }, { "id": "P52947", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P52947" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P52947-1" } ], "record_id": "pubmed.17095531", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of somatostatin transactivating factor-1, a novel homeobox factor that stimulates somatostatin expression in pancreatic islet cells.", "journal": "Mol. Endocrinol.", "date": "1993", "authors": "Leonard J, Peers B, Johnson T, Ferreri K, Lee S, Montminy MR", "reference": { "type": "PubMed", "id": "7505393", "url": "https://pubmed.ncbi.nlm.nih.gov/7505393" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52947-1", "protein_name": "Pancreas/duodenum homeobox protein 1", "gene_name": "Pdx1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P52947", "url": "https://www.uniprot.org/uniprotkb/P52947" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7505393", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IDX-1: a new homeodomain transcription factor expressed in rat pancreatic islets and duodenum that transactivates the somatostatin gene.", "journal": "EMBO J.", "date": "1994", "authors": "Miller CP, McGehee RE Jr, Habener JF", "reference": { "type": "PubMed", "id": "7907546", "url": "https://pubmed.ncbi.nlm.nih.gov/7907546" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52947-1", "protein_name": "Pancreas/duodenum homeobox protein 1", "gene_name": "Pdx1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P52947", "url": "https://www.uniprot.org/uniprotkb/P52947" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7907546", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Paraoxonase 1 Was Negatively Associated With Intervertebral Disc Degeneration.", "journal": "Spine", "date": "2019", "authors": "Chen F, Liu H, Li Z, Pei Y, Wang H, Zhang J, Wang J, Zheng Z", "reference": { "type": "PubMed", "id": "30946296", "url": "https://pubmed.ncbi.nlm.nih.gov/30946296" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55159-1", "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "Pon1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P55159", "url": "https://www.uniprot.org/uniprotkb/P55159" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.30946296", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pon1 Deficiency Promotes Trem2 Pathway-Mediated Microglial Phagocytosis and Inhibits Pro-inflammatory Cytokines Release In Vitro and In Vivo.", "journal": "Molecular neurobiology", "date": "2022", "authors": "Zhang L, Dong W, Ma Y, Bai L, Zhang X, Sun C, Li J, Zhang L", "reference": { "type": "PubMed", "id": "35589918", "url": "https://pubmed.ncbi.nlm.nih.gov/35589918" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55159-1", "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "Pon1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P55159", "url": "https://www.uniprot.org/uniprotkb/P55159" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.35589918", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BRAP silencing protects against neuronal inflammation, oxidative stress and apoptosis in cerebral ischemia-reperfusion injury by promoting PON1 expression.", "journal": "Environmental toxicology", "date": "2023-08-30", "authors": "Kang Tao, Qin Xiao, Lei Qi, Yang Qian", "reference": { "type": "PubMed", "id": "37647369", "url": "https://pubmed.ncbi.nlm.nih.gov/37647369" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55159-1", "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "Pon1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "A0A8I5Y120-1", "protein_name": "BRCA1-associated protein", "gene_name": "Brap", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P55159", "url": "https://www.uniprot.org/uniprotkb/P55159" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37647369", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification and characterization of paraoxon hydrolase from rat liver.", "journal": "Biochem. J.", "date": "1997", "authors": "Rodrigo L, Gil F, Hernandez A F, Marina A, Vazquez J, Pla A", "reference": { "type": "PubMed", "id": "9032442", "url": "https://pubmed.ncbi.nlm.nih.gov/9032442" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55159-1", "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "Pon1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P55159", "url": "https://www.uniprot.org/uniprotkb/P55159" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9032442", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparative expressed-sequence-tag analysis of differential gene expression profiles in PC-12 cells before and after nerve growth factor treatment.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "Lee N H, Weinstock K G, Kirkness E F, Earle-Hughes J A, Fuldner R A, Marmaros S, Glodek A, Gocayne J D, Adams M D, Kerlavage A R", "reference": { "type": "PubMed", "id": "7667285", "url": "https://pubmed.ncbi.nlm.nih.gov/7667285" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55770-1", "protein_name": "NHP2-like protein 1", "gene_name": "Snu13-ps5; Snu13", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P55770", "url": "https://www.uniprot.org/uniprotkb/P55770" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7667285", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Brn-5 is a divergent POU domain factor highly expressed in layer IV of the neocortex.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Andersen B, Schonemann M D, Pearse R V, Jenne K, Sugarman J, Rosenfeld M G", "reference": { "type": "PubMed", "id": "7901208", "url": "https://pubmed.ncbi.nlm.nih.gov/7901208" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P56223-1", "protein_name": "POU domain, class 6, transcription factor 1", "gene_name": "Pou6f1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56223", "url": "https://www.uniprot.org/uniprotkb/P56223" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7901208", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structure of nephritogenoside. A nephritogenic glycopeptide with alpha-N-glycosidic linkage.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Shibata S, Takeda T, Natori Y", "reference": { "type": "PubMed", "id": "3410849", "url": "https://pubmed.ncbi.nlm.nih.gov/3410849" }, "referenced_glycans": [ { "glytoucan_ac": "G99375FM" }, { "glytoucan_ac": "G10488WF" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P58522-1", "protein_name": "Nephritogenoside", "gene_name": "", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P58522", "url": "https://www.uniprot.org/uniprotkb/P58522" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (Glc...) asparagine", "icn3d_view": {}, "start_pos": 1, "start_aa": "Asn", "end_pos": 1, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1", "evidence": [ { "id": "P58522", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P58522#ptm_processing" }, { "id": "3410849", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3410849" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P58522-1" } ], "glycan_expression": [ { "glytoucan_ac": "G99375FM", "abundance": "", "tissue": { "name": "glomerular basement membrane", "namespace": "UBERON", "id": "0005777", "url": "http://purl.obolibrary.org/obo/UBERON_0005777" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {} } ], "record_id": "pubmed.3410849", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pannexin1 and pannexin3 delivery, cell surface dynamics, and cytoskeletal interactions.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Bhalla-Gehi R, Penuela S, Churko JM, Shao Q, Laird DW", "reference": { "type": "PubMed", "id": "20086016", "url": "https://pubmed.ncbi.nlm.nih.gov/20086016" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60572-1", "protein_name": "Pannexin-3", "gene_name": "Panx3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q96QZ0-1", "protein_name": "Pannexin-3", "gene_name": "PANX3", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P60572", "url": "https://www.uniprot.org/uniprotkb/P60572" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.20086016", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Implications of pannexin 1 and pannexin 3 for keratinocyte differentiation.", "journal": "Journal of cell science", "date": "2010", "authors": "Celetti SJ, Cowan KN, Penuela S, Shao Q, Churko J, Laird DW", "reference": { "type": "PubMed", "id": "20332104", "url": "https://pubmed.ncbi.nlm.nih.gov/20332104" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60572-1", "protein_name": "Pannexin-3", "gene_name": "Panx3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P60572", "url": "https://www.uniprot.org/uniprotkb/P60572" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.20332104", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of pannexin1 and pannexin3 and their regulation by androgens in the male reproductive tract of the adult rat.", "journal": "Molecular reproduction and development", "date": "2011", "authors": "Turmel P, Dufresne J, Hermo L, Smith CE, Penuela S, Laird DW, Cyr DG", "reference": { "type": "PubMed", "id": "21337450", "url": "https://pubmed.ncbi.nlm.nih.gov/21337450" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60572-1", "protein_name": "Pannexin-3", "gene_name": "Panx3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P60572", "url": "https://www.uniprot.org/uniprotkb/P60572" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.21337450", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pannexin 3 activates P2X7 receptor to mediate inflammation and cartilage matrix degradation in temporomandibular joint osteoarthritis.", "journal": "Cell biology international", "date": "2023-04-06", "authors": "Xiao Jialing, Li Yali, Zhang Jie, Xu Guochao, Zhang Jianxing", "reference": { "type": "PubMed", "id": "37021698", "url": "https://pubmed.ncbi.nlm.nih.gov/37021698" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60572-1", "protein_name": "Pannexin-3", "gene_name": "Panx3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q64663-1", "protein_name": "P2X purinoceptor 7", "gene_name": "P2rx7", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P60572", "url": "https://www.uniprot.org/uniprotkb/P60572" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37021698", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An evolutionarily conserved G-protein coupled receptor family, SREB, expressed in the central nervous system.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2000", "authors": "Matsumoto M, Saito T, Takasaki J, Kamohara M, Sugimoto T, Kobayashi M, Tadokoro M, Matsumoto S, Ohishi T, Furuichi K", "reference": { "type": "PubMed", "id": "10833454", "url": "https://pubmed.ncbi.nlm.nih.gov/10833454" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60895-1", "protein_name": "Probable G protein-coupled receptor 85", "gene_name": "Gpr85", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9JJH2-1", "protein_name": "Probable G protein-coupled receptor 173", "gene_name": "Gpr173", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9JJH3-1", "protein_name": "Probable G protein-coupled receptor 27", "gene_name": "Gpr27", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9I918-1", "protein_name": "Probable G protein-coupled receptor 173", "gene_name": "gpr173", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q9NS66-1", "protein_name": "Probable G protein-coupled receptor 173", "gene_name": "GPR173", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60893-1", "protein_name": "Probable G protein-coupled receptor 85", "gene_name": "GPR85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9I919-1", "protein_name": "Probable G protein-coupled receptor 85", "gene_name": "gpr85", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q9NS67-1", "protein_name": "Probable G protein-coupled receptor 27", "gene_name": "GPR27", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P60895", "url": "https://www.uniprot.org/uniprotkb/P60895" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10833454", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A conserved mRNA expression profile of SREB2 (GPR85) in adult human, monkey, and rat forebrain.", "journal": "Brain research. Molecular brain research", "date": "2005", "authors": "Matsumoto M, Beltaifa S, Weickert CS, Herman MM, Hyde TM, Saunders RC, Lipska BK, Weinberger DR, Kleinman JE", "reference": { "type": "PubMed", "id": "15893849", "url": "https://pubmed.ncbi.nlm.nih.gov/15893849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60895-1", "protein_name": "Probable G protein-coupled receptor 85", "gene_name": "Gpr85", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P60893-1", "protein_name": "Probable G protein-coupled receptor 85", "gene_name": "GPR85", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P60895", "url": "https://www.uniprot.org/uniprotkb/P60895" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.15893849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The RNA-Binding Protein hnRNP K Mediates the Effect of BDNF on Dendritic mRNA Metabolism and Regulates Synaptic NMDA Receptors in Hippocampal Neurons.", "journal": "eNeuro", "date": "2017", "authors": "Leal G, Comprido D, de Luca P, Morais E, Rodrigues L, Mele M, Santos AR, Costa RO, Pinto MJ, Patil S, Berentsen B, Afonso P, Carreto L, Li KW, Pinheiro P, Almeida RD, Santos MAS, Bramham CR, Duarte CB", "reference": { "type": "PubMed", "id": "29255796", "url": "https://pubmed.ncbi.nlm.nih.gov/29255796" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61980-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein K", "gene_name": "Hnrnpk; LOC100359916", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P61980", "url": "https://www.uniprot.org/uniprotkb/P61980" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.29255796", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression analysis of multifunctional RNA-binding protein hnRNP K during development of mammalian testis.", "journal": "Polish journal of veterinary sciences", "date": "2018", "authors": "Xu H, Zhang P, Li R, Wu W, Wang S, Xu Y", "reference": { "type": "PubMed", "id": "30450874", "url": "https://pubmed.ncbi.nlm.nih.gov/30450874" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61980-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein K", "gene_name": "Hnrnpk; LOC100359916", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P61980", "url": "https://www.uniprot.org/uniprotkb/P61980" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.30450874", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial uncoupling protein 2 is regulated through heterogeneous nuclear ribonucleoprotein K in lead exposure models.", "journal": "Journal of environmental science and health. Part C, Toxicology and carcinogenesis", "date": "2021", "authors": "Zhu G, Zhu Q, Zhang W, Hui C, Li Y, Yang M, Pang S, Li Y, Xue G, Chen H", "reference": { "type": "PubMed", "id": "33576715", "url": "https://pubmed.ncbi.nlm.nih.gov/33576715" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61980-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein K", "gene_name": "Hnrnpk; LOC100359916", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P61980", "url": "https://www.uniprot.org/uniprotkb/P61980" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33576715", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of a single-stranded DNA binding protein that specifically recognizes deoxycytidine stretch.", "journal": "Nucleic Acids Res.", "date": "1994", "authors": "Ito K, Sato K, Endo H", "reference": { "type": "PubMed", "id": "8127654", "url": "https://pubmed.ncbi.nlm.nih.gov/8127654" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61980-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein K", "gene_name": "Hnrnpk; LOC100359916", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P61980", "url": "https://www.uniprot.org/uniprotkb/P61980" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8127654", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence for different functional properties of the neuronal calcium sensor proteins VILIP-1 and VILIP-3: from subcellular localization to cellular function.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Spilker C, Gundelfinger ED, Braunewell KH", "reference": { "type": "PubMed", "id": "12445467", "url": "https://pubmed.ncbi.nlm.nih.gov/12445467" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62749-1", "protein_name": "Hippocalcin-like protein 1", "gene_name": "Hpcal1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62749", "url": "https://www.uniprot.org/uniprotkb/P62749" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12445467", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Calcium-myristoyl switch, subcellular localization, and calcium-dependent translocation of the neuronal calcium sensor protein VILIP-3, and comparison with VILIP-1 in hippocampal neurons.", "journal": "Molecular and cellular neurosciences", "date": "2003", "authors": "Spilker C, Braunewell KH", "reference": { "type": "PubMed", "id": "14664824", "url": "https://pubmed.ncbi.nlm.nih.gov/14664824" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62749-1", "protein_name": "Hippocalcin-like protein 1", "gene_name": "Hpcal1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62749", "url": "https://www.uniprot.org/uniprotkb/P62749" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.14664824", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Postnatal brain development and neural cell differentiation modulate mitochondrial Bax and BH3 peptide-induced cytochrome c release.", "journal": "Cell death and differentiation", "date": "2003", "authors": "Polster BM, Robertson CL, Bucci CJ, Suzuki M, Fiskum G", "reference": { "type": "PubMed", "id": "12700636", "url": "https://pubmed.ncbi.nlm.nih.gov/12700636" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62817-1", "protein_name": "Activator of apoptosis harakiri", "gene_name": "Hrk", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62817", "url": "https://www.uniprot.org/uniprotkb/P62817" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12700636", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Signaling by IL-1beta+IFN-gamma and ER stress converge on DP5/Hrk activation: a novel mechanism for pancreatic beta-cell apoptosis.", "journal": "Cell death and differentiation", "date": "2009", "authors": "Gurzov EN, Ortis F, Cunha DA, Gosset G, Li M, Cardozo AK, Eizirik DL", "reference": { "type": "PubMed", "id": "19629134", "url": "https://pubmed.ncbi.nlm.nih.gov/19629134" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62817-1", "protein_name": "Activator of apoptosis harakiri", "gene_name": "Hrk", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62817", "url": "https://www.uniprot.org/uniprotkb/P62817" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.19629134", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Long Noncoding RNA SOX2-OT Aggravates Doxorubicin-Induced Apoptosis of Cardiomyocyte by Targeting miR-942-5p/DP5.", "journal": "Drug design, development and therapy", "date": "2021", "authors": "Wang H, Lin X, Li J, Zeng G, Xu T", "reference": { "type": "PubMed", "id": "33603338", "url": "https://pubmed.ncbi.nlm.nih.gov/33603338" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62817-1", "protein_name": "Activator of apoptosis harakiri", "gene_name": "Hrk", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62817", "url": "https://www.uniprot.org/uniprotkb/P62817" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33603338", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of mitochondrial pyruvate carrier 1 by lapatinib ditosylate mitigates Alzheimer's-like disease in D-galactose/ovariectomized rats.", "journal": "Neurochemistry international", "date": "2021", "authors": "Mansour HM, Fawzy HM, El-Khatib AS, Khattab MM", "reference": { "type": "PubMed", "id": "34481907", "url": "https://pubmed.ncbi.nlm.nih.gov/34481907" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63031-1", "protein_name": "Mitochondrial pyruvate carrier 1", "gene_name": "Mpc1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63031", "url": "https://www.uniprot.org/uniprotkb/P63031" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.34481907", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial pyruvate carrier 1 alleviates hypoxic-ischemic brain injury in rats.", "journal": "Life sciences", "date": "2023-04-06", "authors": "Liu Yue, Yuan Yuan, Yan Yi, Wang Ruyue, Wang Zhaohui, Liu Xiao, Zhang Ying, Hua Jianyu, Wang Yue, Zhao Li", "reference": { "type": "PubMed", "id": "37030616", "url": "https://pubmed.ncbi.nlm.nih.gov/37030616" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63031-1", "protein_name": "Mitochondrial pyruvate carrier 1", "gene_name": "Mpc1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63031", "url": "https://www.uniprot.org/uniprotkb/P63031" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37030616", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNA-binding activity of the rat calmodulin-binding PEP-19 protein and of the long PEP-19 isoform.", "journal": "International journal of molecular medicine", "date": "2012", "authors": "Saladino P, Di Liegro CM, Proia P, Sala A, Schiera G, Lo Cicero A, Di Liegro I", "reference": { "type": "PubMed", "id": "22020791", "url": "https://pubmed.ncbi.nlm.nih.gov/22020791" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63055-1", "protein_name": "Calmodulin regulator protein PCP4", "gene_name": "Pcp4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63055", "url": "https://www.uniprot.org/uniprotkb/P63055" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.22020791", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peptide 19-containing neurons in the medullary dorsal horn, subnuclei interpolaris and oralis, and nucleus principalis of the rat.", "journal": "Annals of anatomy = Anatomischer Anzeiger : official organ of the Anatomische Gesellschaft", "date": "2012", "authors": "Suzuki T, Sato T, Sasaki R, Ichikawa H", "reference": { "type": "PubMed", "id": "22197496", "url": "https://pubmed.ncbi.nlm.nih.gov/22197496" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63055-1", "protein_name": "Calmodulin regulator protein PCP4", "gene_name": "Pcp4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63055", "url": "https://www.uniprot.org/uniprotkb/P63055" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.22197496", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Overexpression of PEP-19 suppresses angiotensin II-induced cardiomyocyte hypertrophy.", "journal": "Journal of pharmacological sciences", "date": "2014", "authors": "Xie YY, Sun MM, Lou XF, Zhang C, Han F, Zhang BY, Wang P, Lu YM", "reference": { "type": "PubMed", "id": "25048017", "url": "https://pubmed.ncbi.nlm.nih.gov/25048017" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63055-1", "protein_name": "Calmodulin regulator protein PCP4", "gene_name": "Pcp4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63055", "url": "https://www.uniprot.org/uniprotkb/P63055" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.25048017", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of a neuron-specific transcript and its regulation during normal and aberrant cerebellar development.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Sangameswaran L, Hempstead J, Morgan JI", "reference": { "type": "PubMed", "id": "2748608", "url": "https://pubmed.ncbi.nlm.nih.gov/2748608" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63055-1", "protein_name": "Calmodulin regulator protein PCP4", "gene_name": "Pcp4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63055", "url": "https://www.uniprot.org/uniprotkb/P63055" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.2748608", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation, sequence, and developmental profile of a brain-specific polypeptide, PEP-19.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Ziai R, Pan YC, Hulmes JD, Sangameswaran L, Morgan JI", "reference": { "type": "PubMed", "id": "3464961", "url": "https://pubmed.ncbi.nlm.nih.gov/3464961" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63055-1", "protein_name": "Calmodulin regulator protein PCP4", "gene_name": "Pcp4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63055", "url": "https://www.uniprot.org/uniprotkb/P63055" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.3464961", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "G protein-gated inwardly rectifying potassium channel subunits 1 and 2 are down-regulated in rat dorsal root ganglion neurons and spinal cord after peripheral axotomy.", "journal": "Molecular pain", "date": "2015", "authors": "Lyu C, Mulder J, Barde S, Sahlholm K, Zeberg H, Nilsson J, Arhem P, Hokfelt T, Fried K, Shi TJ", "reference": { "type": "PubMed", "id": "26199148", "url": "https://pubmed.ncbi.nlm.nih.gov/26199148" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63251-1", "protein_name": "G protein-activated inward rectifier potassium channel 1", "gene_name": "Kcnj3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63251", "url": "https://www.uniprot.org/uniprotkb/P63251" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.26199148", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Calcium Release from Stores Inhibits GIRK.", "journal": "Cell reports", "date": "2016", "authors": "Kramer PF, Williams JT", "reference": { "type": "PubMed", "id": "28009293", "url": "https://pubmed.ncbi.nlm.nih.gov/28009293" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63251-1", "protein_name": "G protein-activated inward rectifier potassium channel 1", "gene_name": "Kcnj3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63251", "url": "https://www.uniprot.org/uniprotkb/P63251" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.28009293", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Knockdown of cardiac Kir3.1 gene with siRNA can improve bradycardia in an experimental sinus bradycardia rat model.", "journal": "Molecular and cellular biochemistry", "date": "2017", "authors": "Li Y, Fu X, Zhang Z, Yu B", "reference": { "type": "PubMed", "id": "28205094", "url": "https://pubmed.ncbi.nlm.nih.gov/28205094" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63251-1", "protein_name": "G protein-activated inward rectifier potassium channel 1", "gene_name": "Kcnj3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63251", "url": "https://www.uniprot.org/uniprotkb/P63251" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.28205094", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "G protein-activated inwardly rectifying potassium channel (GIRK1/KGA) mRNA in adult rat heart and brain by in situ hybridization histochemistry.", "journal": "Mol. Cell. Neurosci.", "date": "1994", "authors": "DePaoli A M, Bell G I, Stoffel M", "reference": { "type": "PubMed", "id": "7704424", "url": "https://pubmed.ncbi.nlm.nih.gov/7704424" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63251-1", "protein_name": "G protein-activated inward rectifier potassium channel 1", "gene_name": "Kcnj3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63251", "url": "https://www.uniprot.org/uniprotkb/P63251" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7704424", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Atrial G protein-activated K+ channel: expression cloning and molecular properties.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Dascal N, Schreibmayer W, Lim NF, Wang W, Chavkin C, DiMagno L, Labarca C, Kieffer BL, Gaveriaux-Ruff C, Trollinger D, et al.", "reference": { "type": "PubMed", "id": "8234283", "url": "https://pubmed.ncbi.nlm.nih.gov/8234283" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63251-1", "protein_name": "G protein-activated inward rectifier potassium channel 1", "gene_name": "Kcnj3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63251", "url": "https://www.uniprot.org/uniprotkb/P63251" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8234283", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Primary structure and functional expression of a rat G-protein-coupled muscarinic potassium channel.", "journal": "Nature", "date": "1993", "authors": "Kubo Y, Reuveny E, Slesinger PA, Jan YN, Jan LY", "reference": { "type": "PubMed", "id": "8355805", "url": "https://pubmed.ncbi.nlm.nih.gov/8355805" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63251-1", "protein_name": "G protein-activated inward rectifier potassium channel 1", "gene_name": "Kcnj3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63251", "url": "https://www.uniprot.org/uniprotkb/P63251" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8355805", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IRK(1-3) and GIRK(1-4) inwardly rectifying K+ channel mRNAs are differentially expressed in the adult rat brain.", "journal": "J. Neurosci.", "date": "1996", "authors": "Karschin C, Dissmann E, St\u00fchmer W, Karschin A", "reference": { "type": "PubMed", "id": "8642402", "url": "https://pubmed.ncbi.nlm.nih.gov/8642402" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63251-1", "protein_name": "G protein-activated inward rectifier potassium channel 1", "gene_name": "Kcnj3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63251", "url": "https://www.uniprot.org/uniprotkb/P63251" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8642402", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional expression and cellular mRNA localization of a G protein-activated K+ inward rectifier isolated from rat brain.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Dissmann E, Wischmeyer E, Spauschus A, Pfeil DV, Karschin C, Karschin A", "reference": { "type": "PubMed", "id": "8670306", "url": "https://pubmed.ncbi.nlm.nih.gov/8670306" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63251-1", "protein_name": "G protein-activated inward rectifier potassium channel 1", "gene_name": "Kcnj3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63511-1", "protein_name": "G protein-activated inward rectifier potassium channel 3", "gene_name": "Kcnj9", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P63251", "url": "https://www.uniprot.org/uniprotkb/P63251" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8670306", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adropin acts in brain to inhibit water drinking: potential interaction with the orphan G protein-coupled receptor, GPR19.", "journal": "American journal of physiology. Regulatory, integrative and comparative physiology", "date": "2016-03-15", "authors": "Stein Lauren M, Yosten Gina L C, Samson Willis K", "reference": { "type": "PubMed", "id": "26739651", "url": "https://pubmed.ncbi.nlm.nih.gov/26739651" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70585-1", "protein_name": "Probable G protein-coupled receptor 19", "gene_name": "Gpr19", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70585", "url": "https://www.uniprot.org/uniprotkb/P70585" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.26739651", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adropin regulates pyruvate dehydrogenase in cardiac cells via a novel GPCR-MAPK-PDK4 signaling pathway.", "journal": "Redox biology", "date": "2018", "authors": "Thapa D, Stoner MW, Zhang M, Xie B, Manning JR, Guimaraes D, Shiva S, Jurczak MJ, Scott I", "reference": { "type": "PubMed", "id": "29909017", "url": "https://pubmed.ncbi.nlm.nih.gov/29909017" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70585-1", "protein_name": "Probable G protein-coupled receptor 19", "gene_name": "Gpr19", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70585", "url": "https://www.uniprot.org/uniprotkb/P70585" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.29909017", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparison of the generic neuronal differentiation and neuron subtype specification functions of mammalian achaete-scute and atonal homologs in cultured neural progenitor cells.", "journal": "Development (Cambridge, England)", "date": "2002", "authors": "Lo L, Dormand E, Greenwood A, Anderson DJ", "reference": { "type": "PubMed", "id": "11923194", "url": "https://pubmed.ncbi.nlm.nih.gov/11923194" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70595-1", "protein_name": "Neurogenin-1", "gene_name": "Neurog1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70595", "url": "https://www.uniprot.org/uniprotkb/P70595" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11923194", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Impact of siRNA targeting of beta-catenin on differentiation of rat neural stem cells and gene expression of Ngn1 and BMP4 following in vitro hypoxic-ischemic brain damage.", "journal": "Molecular medicine reports", "date": "2016", "authors": "Zhang X, Zhu C, Luo Q, Dong J, Liu L, Li M, Zhu H, Ma X, Wang J", "reference": { "type": "PubMed", "id": "27573468", "url": "https://pubmed.ncbi.nlm.nih.gov/27573468" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70595-1", "protein_name": "Neurogenin-1", "gene_name": "Neurog1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70595", "url": "https://www.uniprot.org/uniprotkb/P70595" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.27573468", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of microsomal acyl-CoA thioesterase. A member of the rat liver microsomal carboxylesterase multi-gene family.", "journal": "Eur. J. Biochem.", "date": "1993", "authors": "Alexson S E, Mentlein R, Wernstedt C, Hellman U", "reference": { "type": "PubMed", "id": "8100522", "url": "https://pubmed.ncbi.nlm.nih.gov/8100522" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P80250-1", "protein_name": "Palmitoyl-CoA hydrolase", "gene_name": "", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P80250", "url": "https://www.uniprot.org/uniprotkb/P80250" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8100522", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Germ cell-specific heat shock protein 105 binds to p53 in a temperature-sensitive manner in rat testis.", "journal": "Eur. J. Biochem.", "date": "2000", "authors": "Kumagai J, Fukuda J, Kodama H, Murata M, Kawamura K, Itoh H, Tanaka T", "reference": { "type": "PubMed", "id": "10806408", "url": "https://pubmed.ncbi.nlm.nih.gov/10806408" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P83581-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "Hspa4l", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P83581", "url": "https://www.uniprot.org/uniprotkb/P83581" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10806408", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the 105-kDa molecular chaperone. Identification, biochemical properties, and localization.", "journal": "European journal of biochemistry", "date": "2002-11", "authors": "Matsumori Mika, Itoh Hideaki, Toyoshima Itaru, Komatsuda Atsushi, Sawada Ken-Ichi, Fukuda Jun, Tanaka Toshinobu, Okubo Atsuya, Kinouchi Hiroyuki, Mizoi Kazuo, Hama Tokiko, Suzuki Akira, Hamada Fumio, Otaka Michiro, Shoji Yutaka, Takada Goro", "reference": { "type": "PubMed", "id": "12423363", "url": "https://pubmed.ncbi.nlm.nih.gov/12423363" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P83581-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "Hspa4l", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P83581", "url": "https://www.uniprot.org/uniprotkb/P83581" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12423363", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Different expression time of the 105-kDa protein and 90-kDa heat-shock protein in rat testis.", "journal": "FEBS Lett.", "date": "1991", "authors": "Itoh H, Tashima Y", "reference": { "type": "PubMed", "id": "1893998", "url": "https://pubmed.ncbi.nlm.nih.gov/1893998" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P83581-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "Hspa4l", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P83581", "url": "https://www.uniprot.org/uniprotkb/P83581" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.1893998", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel testis-specific 105-kDa protein related to the 90-kDa heat-shock protein.", "journal": "Eur. J. Biochem.", "date": "1990", "authors": "Itoh H, Tashima Y", "reference": { "type": "PubMed", "id": "2226463", "url": "https://pubmed.ncbi.nlm.nih.gov/2226463" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P83581-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "Hspa4l", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P83581", "url": "https://www.uniprot.org/uniprotkb/P83581" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.2226463", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and characterization of rat karyopherin alpha1 gene: structure and expression.", "journal": "Gene", "date": "2004", "authors": "Wang B, Li Z, Xu L, Goggi J, Yu Y, Zhou J", "reference": { "type": "PubMed", "id": "15094201", "url": "https://pubmed.ncbi.nlm.nih.gov/15094201" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P83953-1", "protein_name": "Importin subunit alpha-5", "gene_name": "Kpna1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P83953", "url": "https://www.uniprot.org/uniprotkb/P83953" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.15094201", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Striatum is more vulnerable to oxidative damage induced by the metabolites accumulating in 3-hydroxy-3-methylglutaryl-CoA lyase deficiency as compared to liver.", "journal": "International journal of developmental neuroscience : the official journal of the International Society for Developmental Neuroscience", "date": "2009", "authors": "Leipnitz G, Seminotti B, Fernandes CG, Amaral AU, Beskow AP, da Silva Lde B, Zanatta A, Ribeiro CA, Vargas CR, Wajner M", "reference": { "type": "PubMed", "id": "19460629", "url": "https://pubmed.ncbi.nlm.nih.gov/19460629" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97519-1", "protein_name": "Hydroxymethylglutaryl-CoA lyase, mitochondrial", "gene_name": "Hmgcl", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97519", "url": "https://www.uniprot.org/uniprotkb/P97519" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.19460629", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of rat mitochondrial 3-hydroxy-3-methylglutaryl-CoA lyase and detection of the corresponding mRNA and of those encoding the remaining enzymes comprising the ketogenic 3-hydroxy-3-methylglutaryl-CoA cycle in central nervous system of suckling rat.", "journal": "Biochem. J.", "date": "1998", "authors": "Cullingford T E, Dolphin C T, Bhakoo K K, Peuchen S, Canevari L, Clark J B", "reference": { "type": "PubMed", "id": "9425122", "url": "https://pubmed.ncbi.nlm.nih.gov/9425122" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97519-1", "protein_name": "Hydroxymethylglutaryl-CoA lyase, mitochondrial", "gene_name": "Hmgcl", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97519", "url": "https://www.uniprot.org/uniprotkb/P97519" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9425122", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and functional characterization of a K+ channel alpha-subunit with regulatory properties specific to brain.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1997", "authors": "Castellano A, Chiara MD, Mellstrom B, Molina A, Monje F, Naranjo JR, Lopez-Barneo J", "reference": { "type": "PubMed", "id": "9169526", "url": "https://pubmed.ncbi.nlm.nih.gov/9169526" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97557-1", "protein_name": "Potassium voltage-gated channel subfamily V member 1", "gene_name": "Kcnv1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97557", "url": "https://www.uniprot.org/uniprotkb/P97557" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9169526", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effects of short-term physical training on the interleukin-15 signalling pathway and glucose tolerance in aged rats.", "journal": "Cytokine", "date": "2021", "authors": "Minuzzi LG, da Conceicao LR, Munoz VR, Vieira RFL, Gaspar RC, da Silva ASR, Cintra DE, Pereira de Moura L, Ropelle ER, Teixeira AM, Pauli JR", "reference": { "type": "PubMed", "id": "33010727", "url": "https://pubmed.ncbi.nlm.nih.gov/33010727" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97604-1", "protein_name": "Interleukin-15", "gene_name": "Il15", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97604", "url": "https://www.uniprot.org/uniprotkb/P97604" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33010727", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Intestinal epithelial cells both express and respond to interleukin 15.", "journal": "Gastroenterology", "date": "1996", "authors": "Reinecker HC, MacDermott RP, Mirau S, Dignass A, Podolsky DK", "reference": { "type": "PubMed", "id": "8942753", "url": "https://pubmed.ncbi.nlm.nih.gov/8942753" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97604-1", "protein_name": "Interleukin-15", "gene_name": "Il15", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97604", "url": "https://www.uniprot.org/uniprotkb/P97604" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8942753", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Developmental regulation of the A-type potassium-channel current in hippocampal neurons: role of the Kvbeta 1.1 subunit.", "journal": "Neuroscience", "date": "2003", "authors": "Falk T, Kilani RK, Strazdas LA, Borders RS, Steidl JV, Yool AJ, Sherman SJ", "reference": { "type": "PubMed", "id": "12890510", "url": "https://pubmed.ncbi.nlm.nih.gov/12890510" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97678-1", "protein_name": "Calcium-activated potassium channel subunit beta-1", "gene_name": "Kcnmb1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97678", "url": "https://www.uniprot.org/uniprotkb/P97678" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12890510", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Downregulation of the BK channel beta1 subunit in genetic hypertension.", "journal": "Circulation research", "date": "2003", "authors": "Amberg GC, Santana LF", "reference": { "type": "PubMed", "id": "14551242", "url": "https://pubmed.ncbi.nlm.nih.gov/14551242" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97678-1", "protein_name": "Calcium-activated potassium channel subunit beta-1", "gene_name": "Kcnmb1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97678", "url": "https://www.uniprot.org/uniprotkb/P97678" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.14551242", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Impaired Trafficking of beta1 Subunits Inhibits BK Channels in Cerebral Arteries of Hypertensive Rats.", "journal": "Hypertension (Dallas, Tex. : 1979)", "date": "2018", "authors": "Leo MD, Zhai X, Yin W, Jaggar JH", "reference": { "type": "PubMed", "id": "30012867", "url": "https://pubmed.ncbi.nlm.nih.gov/30012867" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97678-1", "protein_name": "Calcium-activated potassium channel subunit beta-1", "gene_name": "Kcnmb1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97678", "url": "https://www.uniprot.org/uniprotkb/P97678" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.30012867", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Aging influences cerebrovascular myogenic reactivity and BK channel function in a sex-specific manner.", "journal": "Cardiovascular research", "date": "2020", "authors": "Reed JT, Pareek T, Sriramula S, Pabbidi MR", "reference": { "type": "PubMed", "id": "31738403", "url": "https://pubmed.ncbi.nlm.nih.gov/31738403" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97678-1", "protein_name": "Calcium-activated potassium channel subunit beta-1", "gene_name": "Kcnmb1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97678", "url": "https://www.uniprot.org/uniprotkb/P97678" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.31738403", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Antenatal Dexamethasone Exposure Impairs the High-Conductance Ca(2+)-Activated K(+) Channels via Epigenetic Alteration at Gene Promoter in Male Offspring.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2020", "authors": "Xu T, Zhao M, Li H, Zhou X, Liu B, Sun M, Xu Z, Gao Q", "reference": { "type": "PubMed", "id": "32967457", "url": "https://pubmed.ncbi.nlm.nih.gov/32967457" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97678-1", "protein_name": "Calcium-activated potassium channel subunit beta-1", "gene_name": "Kcnmb1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97678", "url": "https://www.uniprot.org/uniprotkb/P97678" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.32967457", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cholesterol activates BK channels by increasing KCNMB1 protein levels in the plasmalemma.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Bukiya AN, Leo MD, Jaggar JH, Dopico AM", "reference": { "type": "PubMed", "id": "33556372", "url": "https://pubmed.ncbi.nlm.nih.gov/33556372" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97678-1", "protein_name": "Calcium-activated potassium channel subunit beta-1", "gene_name": "Kcnmb1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97678", "url": "https://www.uniprot.org/uniprotkb/P97678" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33556372", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential expression of the alpha and beta subunits of the large-conductance calcium-activated potassium channel: implication for channel diversity.", "journal": "Brain Res. Mol. Brain Res.", "date": "1997", "authors": "Chang CP, Dworetzky SI, Wang J, Goldstein ME", "reference": { "type": "PubMed", "id": "9105668", "url": "https://pubmed.ncbi.nlm.nih.gov/9105668" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97678-1", "protein_name": "Calcium-activated potassium channel subunit beta-1", "gene_name": "Kcnmb1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97678", "url": "https://www.uniprot.org/uniprotkb/P97678" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9105668", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence and expression of rat ICAM-1.", "journal": "Biochim. Biophys. Acta", "date": "1992", "authors": "Kita Y, Takashi T, Iigo Y, Tamatani T, Miyasaka M, Horiuchi T", "reference": { "type": "PubMed", "id": "1349828", "url": "https://pubmed.ncbi.nlm.nih.gov/1349828" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00238-1", "protein_name": "Intercellular adhesion molecule 1", "gene_name": "Icam1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q00238", "url": "https://www.uniprot.org/uniprotkb/Q00238" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.1349828", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Actin-binding protein, IQGAP1, regulates LPS-induced RPMVECs hyperpermeability and ICAM-1 upregulation via Rap1/Src signalling pathway.", "journal": "Cellular signalling", "date": "2021", "authors": "Zhang N, Wang G, Sun G", "reference": { "type": "PubMed", "id": "34147590", "url": "https://pubmed.ncbi.nlm.nih.gov/34147590" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00238-1", "protein_name": "Intercellular adhesion molecule 1", "gene_name": "Icam1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q00238", "url": "https://www.uniprot.org/uniprotkb/Q00238" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.34147590", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Acupoint catgut embedment may reduce airway inflammation reaction by down-regulating ICAM-1 and EOS by suppressing p38MAPK signaling in lung tissue of asthmatic rats].", "journal": "Zhen ci yan jiu = Acupuncture research", "date": "2022", "authors": "Tang XY, Chen PB, Du DJ, Qin ZY, Long RJ", "reference": { "type": "PubMed", "id": "35218622", "url": "https://pubmed.ncbi.nlm.nih.gov/35218622" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00238-1", "protein_name": "Intercellular adhesion molecule 1", "gene_name": "Icam1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q00238", "url": "https://www.uniprot.org/uniprotkb/Q00238" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.35218622", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ICAM-1 Abundance Is Increased in Pancreatic Islets of Hyperglycemic Female NOD Mice and Is Rapidly Upregulated by NF-\u03baB in Pancreatic \u03b2-Cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2022-07-18", "authors": "Martin Thomas M, Burke Susan J, Batdorf Heidi M, Burk David H, Ghosh Sujoy, Dupuy Samuel D, Karlstad Michael D, Collier J Jason", "reference": { "type": "PubMed", "id": "35851539", "url": "https://pubmed.ncbi.nlm.nih.gov/35851539" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00238-1", "protein_name": "Intercellular adhesion molecule 1", "gene_name": "Icam1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q00238", "url": "https://www.uniprot.org/uniprotkb/Q00238" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.35851539", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hypoxia-sensitive cells trigger NK cell activation via the KLF4-ASH1L-ICAM-1 axis, contributing to impairment in the rat epididymis.", "journal": "Cell reports", "date": "2023-11-28", "authors": "Zeng Jitao, Gao Weiwu, Tang Ying, Wang Ying, Liu Xiaona, Yin Jun, Su Xingxing, Zhang Mengjie, Kang Enchuan, Tian Yi, Ni Bing, He Wei", "reference": { "type": "PubMed", "id": "37952156", "url": "https://pubmed.ncbi.nlm.nih.gov/37952156" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00238-1", "protein_name": "Intercellular adhesion molecule 1", "gene_name": "Icam1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q00238", "url": "https://www.uniprot.org/uniprotkb/Q00238" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37952156", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphodiesterase type 1 inhibition alters medial prefrontal cortical activity during goal-driven behaviour and partially reverses neurophysiological deficits in the rat phencyclidine model of schizophrenia.", "journal": "Neuropharmacology", "date": "2021", "authors": "Hayes J, Laursen B, Eneberg E, Kehler J, Rasmussen LK, Langgard M, Bastlund JF, Gerdjikov TV", "reference": { "type": "PubMed", "id": "33444639", "url": "https://pubmed.ncbi.nlm.nih.gov/33444639" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01066-1", "protein_name": "Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B", "gene_name": "Pde1b", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01066", "url": "https://www.uniprot.org/uniprotkb/Q01066" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33444639", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The trans-spliced variants of Sp1 mRNA in rat.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2002", "authors": "Takahara Terunao, Kasahara Daisuke, Mori Daisuke, Yanagisawa Shuichi, Akanuma Hiroshi", "reference": { "type": "PubMed", "id": "12379234", "url": "https://pubmed.ncbi.nlm.nih.gov/12379234" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01714-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01714", "url": "https://www.uniprot.org/uniprotkb/Q01714" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12379234", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Diabetes and the accompanying hyperglycemia impairs cardiomyocyte calcium cycling through increased nuclear O-GlcNAcylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Clark RJ, McDonough PM, Swanson E, Trost SU, Suzuki M, Fukuda M, Dillmann WH", "reference": { "type": "PubMed", "id": "12941958", "url": "https://pubmed.ncbi.nlm.nih.gov/12941958" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01714-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01714", "url": "https://www.uniprot.org/uniprotkb/Q01714" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "20851344", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20851344" }, { "id": "Q01714", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q01714" }, { "id": "16052526", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16052526" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "12397027", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12397027" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "14675536", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14675536" }, { "id": "16365142", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16365142" }, { "id": "12941958", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12941958" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01714-1" } ], "record_id": "pubmed.12941958", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "O-GlcNAc modification is an endogenous inhibitor of the proteasome.", "journal": "Cell", "date": "2003", "authors": "Zhang F, Su K, Yang X, Bowe DB, Paterson AJ, Kudlow JE", "reference": { "type": "PubMed", "id": "14675536", "url": "https://pubmed.ncbi.nlm.nih.gov/14675536" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01714-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01714", "url": "https://www.uniprot.org/uniprotkb/Q01714" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "20851344", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20851344" }, { "id": "Q01714", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q01714" }, { "id": "16052526", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16052526" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "12397027", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12397027" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "14675536", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14675536" }, { "id": "16365142", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16365142" }, { "id": "12941958", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12941958" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01714-1" } ], "record_id": "pubmed.14675536", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of O-linked beta-N-acetylglucosamine modification in the subcellular distribution of alpha4 phosphoprotein and Sp1 in rat lymphoma cells.", "journal": "Journal of cellular biochemistry", "date": "2005", "authors": "Dauphinee SM, Ma M, Too CK", "reference": { "type": "PubMed", "id": "16052526", "url": "https://pubmed.ncbi.nlm.nih.gov/16052526" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01714-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O08836-1", "protein_name": "Immunoglobulin-binding protein 1", "gene_name": "Igbp1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01714", "url": "https://www.uniprot.org/uniprotkb/Q01714" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "20851344", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20851344" }, { "id": "Q01714", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q01714" }, { "id": "16052526", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16052526" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "12397027", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12397027" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "14675536", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14675536" }, { "id": "16365142", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16365142" }, { "id": "12941958", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12941958" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01714-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "16052526", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16052526" }, { "id": "O08836", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O08836" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O08836-1" } ], "record_id": "pubmed.16052526", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 2 }, { "field": "fuzzy_o_linked_sites", "count": 2 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 2 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 2 }, { "field": "fuzzy_o_linked_sites", "count": 2 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 2 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insulin dynamically regulates calmodulin gene expression by sequential o-glycosylation and phosphorylation of sp1 and its subcellular compartmentalization in liver cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Majumdar G, Harrington A, Hungerford J, Martinez-Hernandez A, Gerling IC, Raghow R, Solomon S", "reference": { "type": "PubMed", "id": "16332679", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01714-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P08047-1", "protein_name": "Transcription factor Sp1", "gene_name": "SP1", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01714", "url": "https://www.uniprot.org/uniprotkb/Q01714" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 613, "start_aa": "Ser", "end_pos": 613, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser613", "evidence": [ { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "Q01714", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01714" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "Q01714-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 641, "start_aa": "Thr", "end_pos": 641, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr641", "evidence": [ { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "Q01714", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01714" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "Q01714-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 642, "start_aa": "Ser", "end_pos": 642, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser642", "evidence": [ { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "Q01714", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01714" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "Q01714-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 699, "start_aa": "Ser", "end_pos": 699, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser699", "evidence": [ { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "Q01714", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01714" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "Q01714-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 703, "start_aa": "Ser", "end_pos": 703, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser703", "evidence": [ { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "Q01714", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01714" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "Q01714-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "20851344", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20851344" }, { "id": "Q01714", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q01714" }, { "id": "16052526", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16052526" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "12397027", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12397027" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "14675536", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14675536" }, { "id": "16365142", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16365142" }, { "id": "12941958", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12941958" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01714-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 120, "start_aa": "Ser", "end_pos": 120, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser120", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 126, "start_aa": "Ser", "end_pos": 126, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser126", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 128, "start_aa": "Thr", "end_pos": 128, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr128", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 131, "start_aa": "Ser", "end_pos": 131, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser131", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 134, "start_aa": "Ser", "end_pos": 134, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser134", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 254, "start_aa": "Thr", "end_pos": 254, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr254", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 265, "start_aa": "Thr", "end_pos": 265, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr265", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 271, "start_aa": "Ser", "end_pos": 271, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser271", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 273, "start_aa": "Ser", "end_pos": 273, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser273", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 276, "start_aa": "Thr", "end_pos": 276, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr276", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 312, "start_aa": "Ser", "end_pos": 312, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser312", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 316, "start_aa": "Ser", "end_pos": 316, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser316", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 36, "start_aa": "Ser", "end_pos": 36, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser36", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 394, "start_aa": "Thr", "end_pos": 394, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr394", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 421, "start_aa": "Ser", "end_pos": 421, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser421", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 424, "start_aa": "Thr", "end_pos": 424, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr424", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 446, "start_aa": "Ser", "end_pos": 446, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser446", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 453, "start_aa": "Thr", "end_pos": 453, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr453", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01110", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 455, "start_aa": "Thr", "end_pos": 455, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr455", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 491, "start_aa": "Ser", "end_pos": 491, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser491", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "25484640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25484640" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "id": "35499042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35499042" }, { "id": "38226157", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38226157" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 507, "start_aa": "Ser", "end_pos": 507, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser507", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 510, "start_aa": "Ser", "end_pos": 510, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser510", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 517, "start_aa": "Thr", "end_pos": 517, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr517", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 56, "start_aa": "Ser", "end_pos": 56, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser56", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01111", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 612, "start_aa": "Ser", "end_pos": 612, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser612", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "25484640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25484640" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "id": "35499042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35499042" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01111", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 612, "start_aa": "Ser", "end_pos": 612, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser612", "evidence": [ { "id": "P08047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08047#ptm_processing" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" } ], "filter_code": "000000000000000100000.00000001000000.00.01111", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 640, "start_aa": "Thr", "end_pos": 640, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr640", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "25484640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25484640" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "id": "35499042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35499042" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01110", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 640, "start_aa": "Thr", "end_pos": 640, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr640", "evidence": [ { "id": "P08047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08047#ptm_processing" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" } ], "filter_code": "000000000000000010000.00000001000000.00.01110", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 641, "start_aa": "Ser", "end_pos": 641, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser641", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "25484640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25484640" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "id": "35499042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35499042" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01111", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 641, "start_aa": "Ser", "end_pos": 641, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser641", "evidence": [ { "id": "P08047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08047#ptm_processing" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" } ], "filter_code": "000000000000000100000.00000001000000.00.01111", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 698, "start_aa": "Ser", "end_pos": 698, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser698", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "25484640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25484640" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "id": "35499042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35499042" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01110", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 698, "start_aa": "Ser", "end_pos": 698, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser698", "evidence": [ { "id": "P08047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08047#ptm_processing" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" } ], "filter_code": "000000000000000100000.00000001000000.00.01110", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 702, "start_aa": "Ser", "end_pos": 702, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser702", "evidence": [ { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21105874" }, { "id": "25352121", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25352121" }, { "id": "20657584", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20657584" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "31866443", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31866443" }, { "id": "11371615", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371615" }, { "id": "16027160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16027160" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34638625", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34638625" }, { "id": "33686291", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33686291" }, { "id": "28054006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28054006" }, { "id": "9079710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9079710" }, { "id": "26499076", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26499076" }, { "id": "24802710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24802710" }, { "id": "19193796", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19193796" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "20699577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20699577" }, { "id": "17049555", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17049555" }, { "id": "24995865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995865" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "24129563", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24129563" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "31847126", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31847126" }, { "id": "9343410", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9343410" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "19302979", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19302979" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "17614351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17614351" }, { "id": "21795679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21795679" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "9452489", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9452489" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "23013401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23013401" }, { "id": "24553187", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24553187" }, { "id": "25484640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25484640" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "id": "35499042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35499042" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01110", "uniprot_canonical_ac": "P08047-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 702, "start_aa": "Ser", "end_pos": 702, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser702", "evidence": [ { "id": "P08047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08047#ptm_processing" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" } ], "filter_code": "000000000000000100000.00000001000000.00.01110", "uniprot_canonical_ac": "P08047-1" } ], "phosphorylation": [ { "start_pos": 612, "end_pos": 612, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprotkb/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16332679", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" } ], "site_lbl": "Ser612", "uniprot_canonical_ac": "P08047-1" }, { "start_pos": 640, "end_pos": 640, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; alternate", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprotkb/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16332679", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" } ], "site_lbl": "Thr640", "uniprot_canonical_ac": "P08047-1" }, { "start_pos": 641, "end_pos": 641, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC/PRKCZ; alternate", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprotkb/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16332679", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "database": "PubMed", "id": "16943418", "url": "https://pubmed.ncbi.nlm.nih.gov/16943418" } ], "site_lbl": "Ser641", "uniprot_canonical_ac": "P08047-1" }, { "start_pos": 698, "end_pos": 698, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprotkb/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16332679", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" } ], "site_lbl": "Ser698", "uniprot_canonical_ac": "P08047-1" }, { "start_pos": 702, "end_pos": 702, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprotkb/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16332679", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "database": "PubMed", "id": "20953893", "url": "https://pubmed.ncbi.nlm.nih.gov/20953893" } ], "site_lbl": "Ser702", "uniprot_canonical_ac": "P08047-1" } ], "record_id": "pubmed.16332679", "abstract": "", "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 40 }, { "field": "total_sites", "count": 35 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 35 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 35 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 34 }, { "field": "exact_o_linked_sites", "count": 34 }, { "field": "exact_o_linked_glycan_sites", "count": 34 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 5 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_o_linked_sites", "count": 5 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 35 }, { "field": "total_sites", "count": 35 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 35 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 35 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 34 }, { "field": "exact_o_linked_sites", "count": 34 }, { "field": "exact_o_linked_glycan_sites", "count": 34 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Posttranslational, reversible O-glycosylation is stimulated by high glucose and mediates plasminogen activator inhibitor-1 gene expression and Sp1 transcriptional activity in glomerular mesangial cells.", "journal": "Endocrinology", "date": "2006", "authors": "Goldberg HJ, Whiteside CI, Hart GW, Fantus IG", "reference": { "type": "PubMed", "id": "16365142", "url": "https://pubmed.ncbi.nlm.nih.gov/16365142" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01714-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01714", "url": "https://www.uniprot.org/uniprotkb/Q01714" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "20851344", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20851344" }, { "id": "Q01714", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q01714" }, { "id": "16052526", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16052526" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "12397027", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12397027" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "14675536", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14675536" }, { "id": "16365142", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16365142" }, { "id": "12941958", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12941958" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01714-1" } ], "record_id": "pubmed.16365142", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Elevation of Global O-GlcNAc in rodents using a selective O-GlcNAcase inhibitor does not cause insulin resistance or perturb glucohomeostasis.", "journal": "Chemistry & biology", "date": "2010", "authors": "Macauley MS, Shan X, Yuzwa SA, Gloster TM, Vocadlo DJ", "reference": { "type": "PubMed", "id": "20851344", "url": "https://pubmed.ncbi.nlm.nih.gov/20851344" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01714-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01714", "url": "https://www.uniprot.org/uniprotkb/Q01714" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "20851344", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20851344" }, { "id": "Q01714", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q01714" }, { "id": "16052526", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16052526" }, { "id": "16332679", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16332679" }, { "id": "12397027", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12397027" }, { "id": "9111324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9111324" }, { "id": "14675536", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14675536" }, { "id": "16365142", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16365142" }, { "id": "12941958", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12941958" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01714-1" } ], "record_id": "pubmed.20851344", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sp1 mediated the inhibitory effect of glutamate on pulmonary surfactant synthesis.", "journal": "PloS one", "date": "2023", "authors": "Li Xiao-Hong, Fu Jie-Jun, Shi Xiao-Juan, Zhang Yun-Na, Shao Min, Yue Shao-Jie, Li Chen, Luo Zi-Qiang", "reference": { "type": "PubMed", "id": "37556489", "url": "https://pubmed.ncbi.nlm.nih.gov/37556489" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01714-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01714", "url": "https://www.uniprot.org/uniprotkb/Q01714" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37556489", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SP1-stimulated miR-208a-5p aggravates sepsis-induced myocardial injury via targeting XIAP.", "journal": "Experimental cell research", "date": "2023-12-30", "authors": "Xu Ling-Jun, Yang Yixian, Yuan Ling-Feng, Liu Hong, Xu Nan-Ping, Yang Yu, Huang Liang", "reference": { "type": "PubMed", "id": "38163563", "url": "https://pubmed.ncbi.nlm.nih.gov/38163563" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01714-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9R0I6-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "Xiap", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01714", "url": "https://www.uniprot.org/uniprotkb/Q01714" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.38163563", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of Sp1 and Setd8 promotes vascular smooth muscle cells apoptosis by activating Mark4 in vascular calcification.", "journal": "Aging", "date": "2024-02-01", "authors": "Li Yun, Cheng Meijuan, Jin Jingjing, Zhang Dongxue, Zhang Shenglei, Bai Yaling, Xu Jinsheng", "reference": { "type": "PubMed", "id": "38301049", "url": "https://pubmed.ncbi.nlm.nih.gov/38301049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01714-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "D4A6T9-1", "protein_name": "MAP/microtubule affinity-regulating kinase 4", "gene_name": "Mark4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9NQR1-1", "protein_name": "N-lysine methyltransferase KMT5A", "gene_name": "KMT5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L34-1", "protein_name": "MAP/microtubule affinity-regulating kinase 4", "gene_name": "MARK4", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01714", "url": "https://www.uniprot.org/uniprotkb/Q01714" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.38301049", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MicroRNA-124-3p targets Sp1 transcription factor to regulate glioma progression in rats.", "journal": "Gene", "date": "2024-12-20", "authors": "Vaghf Atena, Sadegh Mehdi, Khansarinejad Behzad, Mondanizadeh Mahdieh", "reference": { "type": "PubMed", "id": "39153708", "url": "https://pubmed.ncbi.nlm.nih.gov/39153708" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01714-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01714", "url": "https://www.uniprot.org/uniprotkb/Q01714" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.39153708", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]