[ { "title": "Solute carrier family 35 member F2 is indispensable for papillary thyroid carcinoma progression through activation of transforming growth factor-beta type I receptor/apoptosis signal-regulating kinase 1/mitogen-activated protein kinase signaling axis.", "journal": "Cancer science", "date": "2018", "authors": "He J, Jin Y, Zhou M, Li X, Chen W, Wang Y, Gu S, Cao Y, Chu C, Liu X, Zou Q", "reference": { "type": "PubMed", "id": "29274137", "url": "https://pubmed.ncbi.nlm.nih.gov/29274137" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXU6-1", "protein_name": "Queuine/queuosine transporter SLC35F2", "gene_name": "SLC35F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXU6", "url": "https://www.uniprot.org/uniprotkb/Q8IXU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29274137", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLC35F2, a Transporter Sporadically Mutated in the Untranslated Region, Promotes Growth, Migration, and Invasion of Bladder Cancer Cells.", "journal": "Cells", "date": "2021", "authors": "Kotolloshi R, Holzer M, Gajda M, Grimm MO, Steinbach D", "reference": { "type": "PubMed", "id": "33418944", "url": "https://pubmed.ncbi.nlm.nih.gov/33418944" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXU6-1", "protein_name": "Queuine/queuosine transporter SLC35F2", "gene_name": "SLC35F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXU6", "url": "https://www.uniprot.org/uniprotkb/Q8IXU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33418944", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "USP32 confers cancer cell resistance to YM155 via promoting ER-associated degradation of solute carrier protein SLC35F2.", "journal": "Theranostics", "date": "2021", "authors": "Chandrasekaran AP, Kaushal K, Park CH, Kim KS, Ramakrishna S", "reference": { "type": "PubMed", "id": "34815782", "url": "https://pubmed.ncbi.nlm.nih.gov/34815782" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXU6-1", "protein_name": "Queuine/queuosine transporter SLC35F2", "gene_name": "SLC35F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXU6", "url": "https://www.uniprot.org/uniprotkb/Q8IXU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34815782", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLC35F2-SYVN1-TRIM59 axis critically regulates ferroptosis of pancreatic cancer cells by inhibiting endogenous p53.", "journal": "Oncogene", "date": "2023-10", "authors": "Che Ben, Du Yunyan, Yuan Rongfa, Xiao Han, Zhang Wenming, Shao Jun, Lu Hongcheng, Yu Yi, Xiang Mingfeng, Hao Liang, Zhang Shouhua, Du Xiaohong, Liu Xiuxia, Zhou Wei, Wang Kai, Chen Leifeng", "reference": { "type": "PubMed", "id": "37740007", "url": "https://pubmed.ncbi.nlm.nih.gov/37740007" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXU6-1", "protein_name": "Queuine/queuosine transporter SLC35F2", "gene_name": "SLC35F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWR1-1", "protein_name": "Tripartite motif-containing protein 59", "gene_name": "TRIM59", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXU6", "url": "https://www.uniprot.org/uniprotkb/Q8IXU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37740007", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "\u03b2TrCP1 promotes SLC35F2 protein ubiquitination and inhibits cancer progression in HeLa cells.", "journal": "Biochemical and biophysical research communications", "date": "2023-11-19", "authors": "Colaco Jencia Carminha, Chandrasekaran Arun Pandian, Karapurkar Janardhan Keshav, Birappa Girish, Rajkumar Sripriya, Gowda D A Ayush, Suresh Bharathi, Lee Junwon, Singh Vijai, Hong Seok-Ho, Kim Kye-Seong, Ramakrishna Suresh", "reference": { "type": "PubMed", "id": "37801987", "url": "https://pubmed.ncbi.nlm.nih.gov/37801987" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXU6-1", "protein_name": "Queuine/queuosine transporter SLC35F2", "gene_name": "SLC35F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXU6", "url": "https://www.uniprot.org/uniprotkb/Q8IXU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37801987", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The oncogene SLC35F2 is a high-specificity transporter for the micronutrients queuine and queuosine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2025-06-24", "authors": "Burtnyak Lyubomyr, Yuan Yifeng, Stojek Erwina, Pan Xiaobei, Gunaratne Lankani, Silveira d'Almeida Gabriel, Fergus Claire, Martinelli Maria, J Reed Colbie, Fernandez Jessie, Patel Bhargesh Indravadan, Marquez Isaac, Ehrenhofer-Murray Ann E, Swairjo Manal A, Alfonzo Juan D, Green Brian D, Kelly Vincent P, de Cr\u00e9cy-Lagard Val\u00e9rie", "reference": { "type": "PubMed", "id": "40526720", "url": "https://pubmed.ncbi.nlm.nih.gov/40526720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXU6-1", "protein_name": "Queuine/queuosine transporter SLC35F2", "gene_name": "SLC35F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXU6", "url": "https://www.uniprot.org/uniprotkb/Q8IXU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.40526720", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Diversity of human choline transporters: substrate specificity, kinetic properties, and inhibitor sensitivity.", "journal": "Biochemical pharmacology", "date": "2025-12", "authors": "Redeker Kyra-Elisa Maria, Brockm\u00f6ller J\u00fcrgen", "reference": { "type": "PubMed", "id": "40972734", "url": "https://pubmed.ncbi.nlm.nih.gov/40972734" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXU6-1", "protein_name": "Queuine/queuosine transporter SLC35F2", "gene_name": "SLC35F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV3-1", "protein_name": "High affinity choline transporter 1", "gene_name": "SLC5A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A4IF30-1", "protein_name": "Solute carrier family 35 member F4", "gene_name": "SLC35F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C7Q5-1", "protein_name": "Solute carrier family 35 member G4", "gene_name": "SLC35G4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV83-1", "protein_name": "Solute carrier family 35 member F5", "gene_name": "SLC35F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15244-1", "protein_name": "Solute carrier family 22 member 2", "gene_name": "SLC22A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCS7-1", "protein_name": "Choline transporter-like protein 5", "gene_name": "SLC44A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75751-1", "protein_name": "Solute carrier family 22 member 3", "gene_name": "SLC22A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Y0-1", "protein_name": "Choline/ethanolamine transporter FLVCR1", "gene_name": "FLVCR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPI3-1", "protein_name": "Choline/ethanolamine transporter FLVCR2", "gene_name": "FLVCR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY50-1", "protein_name": "Solute carrier family 35 member F3", "gene_name": "SLC35F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15245-1", "protein_name": "Solute carrier family 22 member 1", "gene_name": "SLC22A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXU6", "url": "https://www.uniprot.org/uniprotkb/Q8IXU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.40972734", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Construction of a transcription map around the gene for ataxia telangiectasia; identification of at least four novel genes.", "journal": "Genomics", "date": "1997", "authors": "Stankovic T, Byrd P J, Cooper P R, McConville C M, Munroe D J, Riley J H, Watts G D, Ambrose H, McGuire G, Smith A D, Sutcliffe A, Mills T, Taylor A M", "reference": { "type": "PubMed", "id": "9119394", "url": "https://pubmed.ncbi.nlm.nih.gov/9119394" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXU6-1", "protein_name": "Queuine/queuosine transporter SLC35F2", "gene_name": "SLC35F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14964-1", "protein_name": "Ras-related protein Rab-39A", "gene_name": "RAB39A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXU6", "url": "https://www.uniprot.org/uniprotkb/Q8IXU6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9119394", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SNAP(c): a core promoter factor with a built-in DNA-binding damper that is deactivated by the Oct-1 POU domain.", "journal": "Genes & development", "date": "1999", "authors": "Mittal V, Ma B, Hernandez N", "reference": { "type": "PubMed", "id": "10421633", "url": "https://pubmed.ncbi.nlm.nih.gov/10421633" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14859-1", "protein_name": "POU domain, class 2, transcription factor 1", "gene_name": "POU2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52747-1", "protein_name": "Zinc finger protein 143", "gene_name": "ZNF143", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SXM2-1", "protein_name": "snRNA-activating protein complex subunit 4", "gene_name": "SNAPC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16533-1", "protein_name": "snRNA-activating protein complex subunit 1", "gene_name": "SNAPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13487-1", "protein_name": "snRNA-activating protein complex subunit 2", "gene_name": "SNAPC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75971-1", "protein_name": "snRNA-activating protein complex subunit 5", "gene_name": "SNAPC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAW0-1", "protein_name": "Transcription factor IIIB 50 kDa subunit", "gene_name": "BRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92966-1", "protein_name": "snRNA-activating protein complex subunit 3", "gene_name": "SNAPC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10421633", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Solution structure of the hRPABC14.4 subunit of human RNA polymerases.", "journal": "Nat. Struct. Biol.", "date": "1999", "authors": "del R\u00edo-Portilla F , Gaskell A, Gilbert D, Ladias J A, Wagner G", "reference": { "type": "PubMed", "id": "10542096", "url": "https://pubmed.ncbi.nlm.nih.gov/10542096" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10542096", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A map of protein-protein contacts within the small nuclear RNA-activating protein complex SNAPc.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Ma B, Hernandez N", "reference": { "type": "PubMed", "id": "11056176", "url": "https://pubmed.ncbi.nlm.nih.gov/11056176" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14859-1", "protein_name": "POU domain, class 2, transcription factor 1", "gene_name": "POU2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52747-1", "protein_name": "Zinc finger protein 143", "gene_name": "ZNF143", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SXM2-1", "protein_name": "snRNA-activating protein complex subunit 4", "gene_name": "SNAPC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16533-1", "protein_name": "snRNA-activating protein complex subunit 1", "gene_name": "SNAPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13487-1", "protein_name": "snRNA-activating protein complex subunit 2", "gene_name": "SNAPC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75971-1", "protein_name": "snRNA-activating protein complex subunit 5", "gene_name": "SNAPC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAW0-1", "protein_name": "Transcription factor IIIB 50 kDa subunit", "gene_name": "BRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92966-1", "protein_name": "snRNA-activating protein complex subunit 3", "gene_name": "SNAPC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 115, "end_pos": 115, "sequence_org": "Q", "sequence_mut": "L", "comment": "Abolishes SNAPC5 binding in the absence of SNAPC1. Minimal effect on SNAPC5 binding in the presence of SNAPC1.", "evidence": [ { "database": "UniProtKB", "id": "Q5SXM2", "url": "https://www.uniprot.org/uniprotkb/Q5SXM2" }, { "database": "PubMed", "id": "11056176", "url": "https://pubmed.ncbi.nlm.nih.gov/11056176" } ], "uniprot_canonical_ac": "Q5SXM2-1" }, { "start_pos": 1314, "end_pos": 1314, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes SNAPC2-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q5SXM2", "url": "https://www.uniprot.org/uniprotkb/Q5SXM2" }, { "database": "PubMed", "id": "11056176", "url": "https://pubmed.ncbi.nlm.nih.gov/11056176" } ], "uniprot_canonical_ac": "Q5SXM2-1" }, { "start_pos": 1355, "end_pos": 1355, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes SNAPC2-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q5SXM2", "url": "https://www.uniprot.org/uniprotkb/Q5SXM2" }, { "database": "PubMed", "id": "11056176", "url": "https://pubmed.ncbi.nlm.nih.gov/11056176" } ], "uniprot_canonical_ac": "Q5SXM2-1" }, { "start_pos": 1362, "end_pos": 1362, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes SNAPC2-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q5SXM2", "url": "https://www.uniprot.org/uniprotkb/Q5SXM2" }, { "database": "PubMed", "id": "11056176", "url": "https://pubmed.ncbi.nlm.nih.gov/11056176" } ], "uniprot_canonical_ac": "Q5SXM2-1" }, { "start_pos": 1364, "end_pos": 1364, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes SNAPC2-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q5SXM2", "url": "https://www.uniprot.org/uniprotkb/Q5SXM2" }, { "database": "PubMed", "id": "11056176", "url": "https://pubmed.ncbi.nlm.nih.gov/11056176" } ], "uniprot_canonical_ac": "Q5SXM2-1" }, { "start_pos": 1369, "end_pos": 1369, "sequence_org": "L", "sequence_mut": "A", "comment": "Decreased binding to SNAPC2.", "evidence": [ { "database": "UniProtKB", "id": "Q5SXM2", "url": "https://www.uniprot.org/uniprotkb/Q5SXM2" }, { "database": "PubMed", "id": "11056176", "url": "https://pubmed.ncbi.nlm.nih.gov/11056176" } ], "uniprot_canonical_ac": "Q5SXM2-1" }, { "start_pos": 94, "end_pos": 94, "sequence_org": "Q", "sequence_mut": "A", "comment": "Abolishes SNAPC5 binding in the absence of SNAPC1. Minimal effect on SNAPC5 binding in the presence of SNAPC1.", "evidence": [ { "database": "UniProtKB", "id": "Q5SXM2", "url": "https://www.uniprot.org/uniprotkb/Q5SXM2" }, { "database": "PubMed", "id": "11056176", "url": "https://pubmed.ncbi.nlm.nih.gov/11056176" } ], "uniprot_canonical_ac": "Q5SXM2-1" }, { "start_pos": 94, "end_pos": 94, "sequence_org": "Q", "sequence_mut": "L", "comment": "Abolishes SNAPC5 binding in the absence of SNAPC1. Minimal effect on SNAPC5 binding in the presence of SNAPC1.", "evidence": [ { "database": "UniProtKB", "id": "Q5SXM2", "url": "https://www.uniprot.org/uniprotkb/Q5SXM2" }, { "database": "PubMed", "id": "11056176", "url": "https://pubmed.ncbi.nlm.nih.gov/11056176" } ], "uniprot_canonical_ac": "Q5SXM2-1" }, { "start_pos": 18, "end_pos": 18, "sequence_org": "L", "sequence_mut": "A", "comment": "Minimal effect on SNAPC4 binding in the absence of SNAPC1. Reduced SNAPC4 binding in the presence of SNAPC1.", "evidence": [ { "database": "UniProtKB", "id": "O75971", "url": "https://www.uniprot.org/uniprotkb/O75971" }, { "database": "PubMed", "id": "11056176", "url": "https://pubmed.ncbi.nlm.nih.gov/11056176" } ], "uniprot_canonical_ac": "O75971-1" }, { "start_pos": 8, "end_pos": 8, "sequence_org": "L", "sequence_mut": "A", "comment": "Reduced SNAPC4 binding in both the presence or absence of SNAPC1.", "evidence": [ { "database": "UniProtKB", "id": "O75971", "url": "https://www.uniprot.org/uniprotkb/O75971" }, { "database": "PubMed", "id": "11056176", "url": "https://pubmed.ncbi.nlm.nih.gov/11056176" } ], "uniprot_canonical_ac": "O75971-1" } ], "record_id": "pubmed.11056176", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear factor 1 (NF1) affects accurate termination and multiple-round transcription by human RNA polymerase III.", "journal": "The EMBO journal", "date": "2000", "authors": "Wang Z, Bai L, Hsieh YJ, Roeder RG", "reference": { "type": "PubMed", "id": "11118217", "url": "https://pubmed.ncbi.nlm.nih.gov/11118217" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00712-1", "protein_name": "Nuclear factor 1 B-type", "gene_name": "NFIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08651-1", "protein_name": "Nuclear factor 1 C-type", "gene_name": "NFIC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05455-1", "protein_name": "Lupus La protein", "gene_name": "SSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14938-1", "protein_name": "Nuclear factor 1 X-type", "gene_name": "NFIX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12857-1", "protein_name": "Nuclear factor 1 A-type", "gene_name": "NFIA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11118217", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The RNA polymerase III transcription apparatus.", "journal": "Journal of molecular biology", "date": "2001", "authors": "Geiduschek EP, Kassavetis GA", "reference": { "type": "PubMed", "id": "11419933", "url": "https://pubmed.ncbi.nlm.nih.gov/11419933" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKN8-1", "protein_name": "General transcription factor 3C polypeptide 4", "gene_name": "GTF3C4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12789-2", "protein_name": "General transcription factor 3C polypeptide 1", "gene_name": "GTF3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q8-1", "protein_name": "General transcription factor 3C polypeptide 5", "gene_name": "GTF3C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUA4-1", "protein_name": "General transcription factor 3C polypeptide 2", "gene_name": "GTF3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q9-1", "protein_name": "General transcription factor 3C polypeptide 3", "gene_name": "GTF3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F1-1", "protein_name": "General transcription factor 3C polypeptide 6", "gene_name": "GTF3C6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11419933", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 27 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A positioned nucleosome on the human U6 promoter allows recruitment of SNAPc by the Oct-1 POU domain.", "journal": "Molecular cell", "date": "2001", "authors": "Zhao X, Pendergrast PS, Hernandez N", "reference": { "type": "PubMed", "id": "11463379", "url": "https://pubmed.ncbi.nlm.nih.gov/11463379" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14859-1", "protein_name": "POU domain, class 2, transcription factor 1", "gene_name": "POU2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52747-1", "protein_name": "Zinc finger protein 143", "gene_name": "ZNF143", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SXM2-1", "protein_name": "snRNA-activating protein complex subunit 4", "gene_name": "SNAPC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16533-1", "protein_name": "snRNA-activating protein complex subunit 1", "gene_name": "SNAPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13487-1", "protein_name": "snRNA-activating protein complex subunit 2", "gene_name": "SNAPC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75971-1", "protein_name": "snRNA-activating protein complex subunit 5", "gene_name": "SNAPC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAW0-1", "protein_name": "Transcription factor IIIB 50 kDa subunit", "gene_name": "BRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92966-1", "protein_name": "snRNA-activating protein complex subunit 3", "gene_name": "SNAPC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11463379", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recruitment of RNA polymerase III to its target promoters.", "journal": "Genes & development", "date": "2002", "authors": "Schramm L, Hernandez N", "reference": { "type": "PubMed", "id": "12381659", "url": "https://pubmed.ncbi.nlm.nih.gov/12381659" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKN8-1", "protein_name": "General transcription factor 3C polypeptide 4", "gene_name": "GTF3C4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12789-2", "protein_name": "General transcription factor 3C polypeptide 1", "gene_name": "GTF3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q8-1", "protein_name": "General transcription factor 3C polypeptide 5", "gene_name": "GTF3C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUA4-1", "protein_name": "General transcription factor 3C polypeptide 2", "gene_name": "GTF3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q9-1", "protein_name": "General transcription factor 3C polypeptide 3", "gene_name": "GTF3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F1-1", "protein_name": "General transcription factor 3C polypeptide 6", "gene_name": "GTF3C6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12381659", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 27 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AIM2 recognizes cytosolic dsDNA and forms a caspase-1-activating inflammasome with ASC.", "journal": "Nature", "date": "2009", "authors": "Hornung V, Ablasser A, Charrel-Dennis M, Bauernfeind F, Horvath G, Caffrey DR, Latz E, Fitzgerald KA", "reference": { "type": "PubMed", "id": "19158675", "url": "https://pubmed.ncbi.nlm.nih.gov/19158675" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14862-1", "protein_name": "Interferon-inducible protein AIM2", "gene_name": "AIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULZ3-1", "protein_name": "Apoptosis-associated speck-like protein containing a CARD", "gene_name": "PYCARD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12956-1", "protein_name": "DNA repair protein Ku70", "gene_name": "XRCC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13010-1", "protein_name": "DNA repair protein Ku80", "gene_name": "XRCC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78527-1", "protein_name": "DNA-dependent protein kinase catalytic subunit", "gene_name": "PRKDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q91VJ1-1", "protein_name": "Interferon-inducible protein AIM2", "gene_name": "Aim2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19158675", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AIM2 activates the inflammasome and cell death in response to cytoplasmic DNA.", "journal": "Nature", "date": "2009", "authors": "Fernandes-Alnemri T, Yu JW, Datta P, Wu J, Alnemri ES", "reference": { "type": "PubMed", "id": "19158676", "url": "https://pubmed.ncbi.nlm.nih.gov/19158676" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14862-1", "protein_name": "Interferon-inducible protein AIM2", "gene_name": "AIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULZ3-1", "protein_name": "Apoptosis-associated speck-like protein containing a CARD", "gene_name": "PYCARD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12956-1", "protein_name": "DNA repair protein Ku70", "gene_name": "XRCC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13010-1", "protein_name": "DNA repair protein Ku80", "gene_name": "XRCC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78527-1", "protein_name": "DNA-dependent protein kinase catalytic subunit", "gene_name": "PRKDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q91VJ1-1", "protein_name": "Interferon-inducible protein AIM2", "gene_name": "Aim2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19158676", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An orthogonal proteomic-genomic screen identifies AIM2 as a cytoplasmic DNA sensor for the inflammasome.", "journal": "Nature immunology", "date": "2009", "authors": "Burckstummer T, Baumann C, Bluml S, Dixit E, Durnberger G, Jahn H, Planyavsky M, Bilban M, Colinge J, Bennett KL, Superti-Furga G", "reference": { "type": "PubMed", "id": "19158679", "url": "https://pubmed.ncbi.nlm.nih.gov/19158679" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14862-1", "protein_name": "Interferon-inducible protein AIM2", "gene_name": "AIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12956-1", "protein_name": "DNA repair protein Ku70", "gene_name": "XRCC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13010-1", "protein_name": "DNA repair protein Ku80", "gene_name": "XRCC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78527-1", "protein_name": "DNA-dependent protein kinase catalytic subunit", "gene_name": "PRKDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q91VJ1-1", "protein_name": "Interferon-inducible protein AIM2", "gene_name": "Aim2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 14, "end_pos": 14, "sequence_org": "L", "sequence_mut": "A", "comment": "Fails to activate interleukin-1 beta production.", "evidence": [ { "database": "UniProtKB", "id": "O14862", "url": "https://www.uniprot.org/uniprotkb/O14862" }, { "database": "PubMed", "id": "19158679", "url": "https://pubmed.ncbi.nlm.nih.gov/19158679" } ], "uniprot_canonical_ac": "O14862-1" }, { "start_pos": 165, "end_pos": 165, "sequence_org": "F", "sequence_mut": "A", "comment": "Impairs DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "O14862", "url": "https://www.uniprot.org/uniprotkb/O14862" }, { "database": "PubMed", "id": "19158679", "url": "https://pubmed.ncbi.nlm.nih.gov/19158679" } ], "uniprot_canonical_ac": "O14862-1" } ], "record_id": "pubmed.19158679", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The small subunit of transcription factor IIF recruits RNA polymerase II into the preinitiation complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Flores O, Lu H, Killeen M, Greenblatt J, Burton ZF, Reinberg D", "reference": { "type": "PubMed", "id": "1946469", "url": "https://pubmed.ncbi.nlm.nih.gov/1946469" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKN8-1", "protein_name": "General transcription factor 3C polypeptide 4", "gene_name": "GTF3C4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12789-2", "protein_name": "General transcription factor 3C polypeptide 1", "gene_name": "GTF3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q8-1", "protein_name": "General transcription factor 3C polypeptide 5", "gene_name": "GTF3C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUA4-1", "protein_name": "General transcription factor 3C polypeptide 2", "gene_name": "GTF3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q9-1", "protein_name": "General transcription factor 3C polypeptide 3", "gene_name": "GTF3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F1-1", "protein_name": "General transcription factor 3C polypeptide 6", "gene_name": "GTF3C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92664-1", "protein_name": "Transcription factor IIIA", "gene_name": "GTF3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1946469", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RIG-I-dependent sensing of poly(dA:dT) through the induction of an RNA polymerase III-transcribed RNA intermediate.", "journal": "Nature immunology", "date": "2009", "authors": "Ablasser A, Bauernfeind F, Hartmann G, Latz E, Fitzgerald KA, Hornung V", "reference": { "type": "PubMed", "id": "19609254", "url": "https://pubmed.ncbi.nlm.nih.gov/19609254" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14862-1", "protein_name": "Interferon-inducible protein AIM2", "gene_name": "AIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12956-1", "protein_name": "DNA repair protein Ku70", "gene_name": "XRCC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13010-1", "protein_name": "DNA repair protein Ku80", "gene_name": "XRCC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78527-1", "protein_name": "DNA-dependent protein kinase catalytic subunit", "gene_name": "PRKDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6Q899-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "Rigi", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19609254", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway.", "journal": "Cell", "date": "2009", "authors": "Chiu YH, Macmillan JB, Chen ZJ", "reference": { "type": "PubMed", "id": "19631370", "url": "https://pubmed.ncbi.nlm.nih.gov/19631370" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14862-1", "protein_name": "Interferon-inducible protein AIM2", "gene_name": "AIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12956-1", "protein_name": "DNA repair protein Ku70", "gene_name": "XRCC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13010-1", "protein_name": "DNA repair protein Ku80", "gene_name": "XRCC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78527-1", "protein_name": "DNA-dependent protein kinase catalytic subunit", "gene_name": "PRKDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6Q899-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "Rigi", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19631370", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Defining the RNA polymerase III transcriptome: Genome-wide localization of the RNA polymerase III transcription machinery in human cells.", "journal": "Genome research", "date": "2010-06", "authors": "Canella Donatella, Praz Viviane, Reina Jaime H, Cousin Pascal, Hernandez Nouria", "reference": { "type": "PubMed", "id": "20413673", "url": "https://pubmed.ncbi.nlm.nih.gov/20413673" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20413673", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cutting edge: Ku70 is a novel cytosolic DNA sensor that induces type III rather than type I IFN.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2011", "authors": "Zhang X, Brann TW, Zhou M, Yang J, Oguariri RM, Lidie KB, Imamichi H, Huang DW, Lempicki RA, Baseler MW, Veenstra TD, Young HA, Lane HC, Imamichi T", "reference": { "type": "PubMed", "id": "21398614", "url": "https://pubmed.ncbi.nlm.nih.gov/21398614" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14862-1", "protein_name": "Interferon-inducible protein AIM2", "gene_name": "AIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12956-1", "protein_name": "DNA repair protein Ku70", "gene_name": "XRCC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13010-1", "protein_name": "DNA repair protein Ku80", "gene_name": "XRCC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78527-1", "protein_name": "DNA-dependent protein kinase catalytic subunit", "gene_name": "PRKDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21398614", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA-PK is a DNA sensor for IRF-3-dependent innate immunity.", "journal": "eLife", "date": "2012", "authors": "Ferguson BJ, Mansur DS, Peters NE, Ren H, Smith GL", "reference": { "type": "PubMed", "id": "23251783", "url": "https://pubmed.ncbi.nlm.nih.gov/23251783" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14862-1", "protein_name": "Interferon-inducible protein AIM2", "gene_name": "AIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12956-1", "protein_name": "DNA repair protein Ku70", "gene_name": "XRCC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13010-1", "protein_name": "DNA repair protein Ku80", "gene_name": "XRCC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78527-1", "protein_name": "DNA-dependent protein kinase catalytic subunit", "gene_name": "PRKDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23251783", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA damage sensor MRE11 recognizes cytosolic double-stranded DNA and induces type I interferon by regulating STING trafficking.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Kondo T, Kobayashi J, Saitoh T, Maruyama K, Ishii KJ, Barber GN, Komatsu K, Akira S, Kawai T", "reference": { "type": "PubMed", "id": "23388631", "url": "https://pubmed.ncbi.nlm.nih.gov/23388631" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14862-1", "protein_name": "Interferon-inducible protein AIM2", "gene_name": "AIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12956-1", "protein_name": "DNA repair protein Ku70", "gene_name": "XRCC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13010-1", "protein_name": "DNA repair protein Ku80", "gene_name": "XRCC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78527-1", "protein_name": "DNA-dependent protein kinase catalytic subunit", "gene_name": "PRKDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23388631", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "S. cerevisiae TFIIIB is the transcription initiation factor proper of RNA polymerase III, while TFIIIA and TFIIIC are assembly factors.", "journal": "Cell", "date": "1990", "authors": "Kassavetis GA, Braun BR, Nguyen LH, Geiduschek EP", "reference": { "type": "PubMed", "id": "2404611", "url": "https://pubmed.ncbi.nlm.nih.gov/2404611" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKN8-1", "protein_name": "General transcription factor 3C polypeptide 4", "gene_name": "GTF3C4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12789-2", "protein_name": "General transcription factor 3C polypeptide 1", "gene_name": "GTF3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q8-1", "protein_name": "General transcription factor 3C polypeptide 5", "gene_name": "GTF3C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUA4-1", "protein_name": "General transcription factor 3C polypeptide 2", "gene_name": "GTF3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q9-1", "protein_name": "General transcription factor 3C polypeptide 3", "gene_name": "GTF3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F1-1", "protein_name": "General transcription factor 3C polypeptide 6", "gene_name": "GTF3C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92664-1", "protein_name": "Transcription factor IIIA", "gene_name": "GTF3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2404611", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of human RNA polymerase III.", "journal": "Nat. Commun.", "date": "2020", "authors": "Ramsay Ewan Phillip, Abascal-Palacios Guillermo, Dai\u00df Julia L, King Helen, Gouge Jerome, Pilsl Michael, Beuron Fabienne, Morris Edward, Gunkel Philip, Engel Christoph, Vannini Alessandro", "reference": { "type": "PubMed", "id": "33335104", "url": "https://pubmed.ncbi.nlm.nih.gov/33335104" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33335104", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.", "journal": "Nat. Struct. Mol. Biol.", "date": "2021", "authors": "Girbig M, Misiaszek AD, Vorlander MK, Lafita A, Grotsch H, Baudin F, Bateman A, Muller CW", "reference": { "type": "PubMed", "id": "33558764", "url": "https://pubmed.ncbi.nlm.nih.gov/33558764" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33558764", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural insights into transcriptional regulation of human RNA polymerase III.", "journal": "Nat. Struct. Mol. Biol.", "date": "2021", "authors": "Wang Q, Li S, Wan F, Xu Y, Wu Z, Cao M, Lan P, Lei M, Wu J", "reference": { "type": "PubMed", "id": "33558766", "url": "https://pubmed.ncbi.nlm.nih.gov/33558766" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33558766", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of human RNA polymerase III elongation complex.", "journal": "Cell Res.", "date": "2021", "authors": "Li Liang, Yu Zishuo, Zhao Dan, Ren Yulei, Hou Haifeng, Xu Yanhui", "reference": { "type": "PubMed", "id": "33674783", "url": "https://pubmed.ncbi.nlm.nih.gov/33674783" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33674783", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural insights into RNA polymerase III-mediated transcription termination through trapping poly-deoxythymidine.", "journal": "Nat. Commun.", "date": "2021", "authors": "Hou Haifeng, Li Yan, Wang Mo, Liu Aijun, Yu Zishuo, Chen Ke, Zhao Dan, Xu Yanhui", "reference": { "type": "PubMed", "id": "34675218", "url": "https://pubmed.ncbi.nlm.nih.gov/34675218" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34675218", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, expression, and function of TFC5, the gene encoding the B` component of the Saccharomyces cerevisiae RNA polymerase III transcription factor TFIIIB.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Kassavetis GA, Nguyen ST, Kobayashi R, Kumar A, Geiduschek EP, Pisano M", "reference": { "type": "PubMed", "id": "7568218", "url": "https://pubmed.ncbi.nlm.nih.gov/7568218" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKN8-1", "protein_name": "General transcription factor 3C polypeptide 4", "gene_name": "GTF3C4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46678-1", "protein_name": "Transcription factor TFIIIB component B''", "gene_name": "BDP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12789-2", "protein_name": "General transcription factor 3C polypeptide 1", "gene_name": "GTF3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q8-1", "protein_name": "General transcription factor 3C polypeptide 5", "gene_name": "GTF3C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUA4-1", "protein_name": "General transcription factor 3C polypeptide 2", "gene_name": "GTF3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q9-1", "protein_name": "General transcription factor 3C polypeptide 3", "gene_name": "GTF3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F1-1", "protein_name": "General transcription factor 3C polypeptide 6", "gene_name": "GTF3C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92664-1", "protein_name": "Transcription factor IIIA", "gene_name": "GTF3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7568218", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 29 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A 14.4 KDa acidic subunit of human RNA polymerase II with a putative leucine-zipper.", "journal": "DNA Seq.", "date": "1994", "authors": "Acker J, Wintzerith M, Vigneron M, Kedinger C", "reference": { "type": "PubMed", "id": "7803819", "url": "https://pubmed.ncbi.nlm.nih.gov/7803819" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7803819", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proximal sequence element-binding transcription factor (PTF) is a multisubunit complex required for transcription of both RNA polymerase II- and RNA polymerase III-dependent small nuclear RNA genes.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Yoon JB, Murphy S, Bai L, Wang Z, Roeder RG", "reference": { "type": "PubMed", "id": "7891697", "url": "https://pubmed.ncbi.nlm.nih.gov/7891697" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14859-1", "protein_name": "POU domain, class 2, transcription factor 1", "gene_name": "POU2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52747-1", "protein_name": "Zinc finger protein 143", "gene_name": "ZNF143", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SXM2-1", "protein_name": "snRNA-activating protein complex subunit 4", "gene_name": "SNAPC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16533-1", "protein_name": "snRNA-activating protein complex subunit 1", "gene_name": "SNAPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13487-1", "protein_name": "snRNA-activating protein complex subunit 2", "gene_name": "SNAPC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75971-1", "protein_name": "snRNA-activating protein complex subunit 5", "gene_name": "SNAPC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAW0-1", "protein_name": "Transcription factor IIIB 50 kDa subunit", "gene_name": "BRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92966-1", "protein_name": "snRNA-activating protein complex subunit 3", "gene_name": "SNAPC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7891697", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Conserved functional domains of the RNA polymerase III general transcription factor BRF.", "journal": "Genes & development", "date": "1994", "authors": "Khoo B, Brophy B, Jackson SP", "reference": { "type": "PubMed", "id": "7995525", "url": "https://pubmed.ncbi.nlm.nih.gov/7995525" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKN8-1", "protein_name": "General transcription factor 3C polypeptide 4", "gene_name": "GTF3C4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12789-2", "protein_name": "General transcription factor 3C polypeptide 1", "gene_name": "GTF3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q8-1", "protein_name": "General transcription factor 3C polypeptide 5", "gene_name": "GTF3C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUA4-1", "protein_name": "General transcription factor 3C polypeptide 2", "gene_name": "GTF3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q9-1", "protein_name": "General transcription factor 3C polypeptide 3", "gene_name": "GTF3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F1-1", "protein_name": "General transcription factor 3C polypeptide 6", "gene_name": "GTF3C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92664-1", "protein_name": "Transcription factor IIIA", "gene_name": "GTF3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7995525", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "La proteins from Drosophila melanogaster and Saccharomyces cerevisiae: a yeast homolog of the La autoantigen is dispensable for growth.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Yoo CJ, Wolin SL", "reference": { "type": "PubMed", "id": "8035818", "url": "https://pubmed.ncbi.nlm.nih.gov/8035818" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00712-1", "protein_name": "Nuclear factor 1 B-type", "gene_name": "NFIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08651-1", "protein_name": "Nuclear factor 1 C-type", "gene_name": "NFIC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33399-1", "protein_name": "La protein homolog", "gene_name": "LHP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40796-1", "protein_name": "La protein homolog", "gene_name": "La", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05455-1", "protein_name": "Lupus La protein", "gene_name": "SSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14938-1", "protein_name": "Nuclear factor 1 X-type", "gene_name": "NFIX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12857-1", "protein_name": "Nuclear factor 1 A-type", "gene_name": "NFIA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8035818", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of RNA chain elongation and termination by Saccharomyces cerevisiae RNA polymerase III.", "journal": "Journal of molecular biology", "date": "1994", "authors": "Matsuzaki H, Kassavetis GA, Geiduschek EP", "reference": { "type": "PubMed", "id": "8308883", "url": "https://pubmed.ncbi.nlm.nih.gov/8308883" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00712-1", "protein_name": "Nuclear factor 1 B-type", "gene_name": "NFIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08651-1", "protein_name": "Nuclear factor 1 C-type", "gene_name": "NFIC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05455-1", "protein_name": "Lupus La protein", "gene_name": "SSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14938-1", "protein_name": "Nuclear factor 1 X-type", "gene_name": "NFIX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12857-1", "protein_name": "Nuclear factor 1 A-type", "gene_name": "NFIA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8308883", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction between a complex of RNA polymerase III subunits and the 70-kDa component of transcription factor IIIB.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Werner M, Chaussivert N, Willis IM, Sentenac A", "reference": { "type": "PubMed", "id": "8407894", "url": "https://pubmed.ncbi.nlm.nih.gov/8407894" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKN8-1", "protein_name": "General transcription factor 3C polypeptide 4", "gene_name": "GTF3C4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12789-2", "protein_name": "General transcription factor 3C polypeptide 1", "gene_name": "GTF3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q8-1", "protein_name": "General transcription factor 3C polypeptide 5", "gene_name": "GTF3C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUA4-1", "protein_name": "General transcription factor 3C polypeptide 2", "gene_name": "GTF3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q9-1", "protein_name": "General transcription factor 3C polypeptide 3", "gene_name": "GTF3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F1-1", "protein_name": "General transcription factor 3C polypeptide 6", "gene_name": "GTF3C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32910-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "RPC34", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92664-1", "protein_name": "Transcription factor IIIA", "gene_name": "GTF3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8407894", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 29 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Orientation and topography of RNA polymerase III in transcription complexes.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Bartholomew B, Durkovich D, Kassavetis GA, Geiduschek EP", "reference": { "type": "PubMed", "id": "8423814", "url": "https://pubmed.ncbi.nlm.nih.gov/8423814" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKN8-1", "protein_name": "General transcription factor 3C polypeptide 4", "gene_name": "GTF3C4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12789-2", "protein_name": "General transcription factor 3C polypeptide 1", "gene_name": "GTF3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q8-1", "protein_name": "General transcription factor 3C polypeptide 5", "gene_name": "GTF3C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUA4-1", "protein_name": "General transcription factor 3C polypeptide 2", "gene_name": "GTF3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q9-1", "protein_name": "General transcription factor 3C polypeptide 3", "gene_name": "GTF3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F1-1", "protein_name": "General transcription factor 3C polypeptide 6", "gene_name": "GTF3C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92664-1", "protein_name": "Transcription factor IIIA", "gene_name": "GTF3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8423814", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic structure of the RNA polymerase II small subunit (hRPB14.4) locus (POLRF) and mapping to 22q13.1 by sequence identity.", "journal": "Genomics", "date": "1996", "authors": "Pusch C, Wang Z, Roe B, Blin N", "reference": { "type": "PubMed", "id": "8786150", "url": "https://pubmed.ncbi.nlm.nih.gov/8786150" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8786150", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of SNAP50, a subunit of the snRNA-activating protein complex SNAPc.", "journal": "The EMBO journal", "date": "1996", "authors": "Henry RW, Ma B, Sadowski CL, Kobayashi R, Hernandez N", "reference": { "type": "PubMed", "id": "9003788", "url": "https://pubmed.ncbi.nlm.nih.gov/9003788" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14859-1", "protein_name": "POU domain, class 2, transcription factor 1", "gene_name": "POU2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52747-1", "protein_name": "Zinc finger protein 143", "gene_name": "ZNF143", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SXM2-1", "protein_name": "snRNA-activating protein complex subunit 4", "gene_name": "SNAPC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16533-1", "protein_name": "snRNA-activating protein complex subunit 1", "gene_name": "SNAPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13487-1", "protein_name": "snRNA-activating protein complex subunit 2", "gene_name": "SNAPC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75971-1", "protein_name": "snRNA-activating protein complex subunit 5", "gene_name": "SNAPC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAW0-1", "protein_name": "Transcription factor IIIB 50 kDa subunit", "gene_name": "BRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92966-1", "protein_name": "snRNA-activating protein complex subunit 3", "gene_name": "SNAPC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9003788", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three human RNA polymerase III-specific subunits form a subcomplex with a selective function in specific transcription initiation.", "journal": "Genes & development", "date": "1997", "authors": "Wang Z, Roeder RG", "reference": { "type": "PubMed", "id": "9171375", "url": "https://pubmed.ncbi.nlm.nih.gov/9171375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKN8-1", "protein_name": "General transcription factor 3C polypeptide 4", "gene_name": "GTF3C4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12789-2", "protein_name": "General transcription factor 3C polypeptide 1", "gene_name": "GTF3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q8-1", "protein_name": "General transcription factor 3C polypeptide 5", "gene_name": "GTF3C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUA4-1", "protein_name": "General transcription factor 3C polypeptide 2", "gene_name": "GTF3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q9-1", "protein_name": "General transcription factor 3C polypeptide 3", "gene_name": "GTF3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F1-1", "protein_name": "General transcription factor 3C polypeptide 6", "gene_name": "GTF3C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92664-1", "protein_name": "Transcription factor IIIA", "gene_name": "GTF3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9171375", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A nucleosome positioned in the distal promoter region activates transcription of the human U6 gene.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Stunkel W, Kober I, Seifart KH", "reference": { "type": "PubMed", "id": "9234698", "url": "https://pubmed.ncbi.nlm.nih.gov/9234698" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14859-1", "protein_name": "POU domain, class 2, transcription factor 1", "gene_name": "POU2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52747-1", "protein_name": "Zinc finger protein 143", "gene_name": "ZNF143", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SXM2-1", "protein_name": "snRNA-activating protein complex subunit 4", "gene_name": "SNAPC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16533-1", "protein_name": "snRNA-activating protein complex subunit 1", "gene_name": "SNAPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13487-1", "protein_name": "snRNA-activating protein complex subunit 2", "gene_name": "SNAPC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75971-1", "protein_name": "snRNA-activating protein complex subunit 5", "gene_name": "SNAPC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAW0-1", "protein_name": "Transcription factor IIIB 50 kDa subunit", "gene_name": "BRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92966-1", "protein_name": "snRNA-activating protein complex subunit 3", "gene_name": "SNAPC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9234698", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dual role of the C34 subunit of RNA polymerase III in transcription initiation.", "journal": "The EMBO journal", "date": "1997", "authors": "Brun I, Sentenac A, Werner M", "reference": { "type": "PubMed", "id": "9312031", "url": "https://pubmed.ncbi.nlm.nih.gov/9312031" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKN8-1", "protein_name": "General transcription factor 3C polypeptide 4", "gene_name": "GTF3C4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92994-1", "protein_name": "Transcription factor IIIB 90 kDa subunit", "gene_name": "BRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12789-2", "protein_name": "General transcription factor 3C polypeptide 1", "gene_name": "GTF3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q8-1", "protein_name": "General transcription factor 3C polypeptide 5", "gene_name": "GTF3C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUA4-1", "protein_name": "General transcription factor 3C polypeptide 2", "gene_name": "GTF3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Q9-1", "protein_name": "General transcription factor 3C polypeptide 3", "gene_name": "GTF3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F1-1", "protein_name": "General transcription factor 3C polypeptide 6", "gene_name": "GTF3C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32910-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "RPC34", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92664-1", "protein_name": "Transcription factor IIIA", "gene_name": "GTF3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 102, "end_pos": 103, "sequence_org": "RE", "sequence_mut": "VA", "comment": "Cold-sensitive. No effect on interaction with BRF1/TDS4.", "evidence": [ { "database": "UniProtKB", "id": "P32910", "url": "https://www.uniprot.org/uniprotkb/P32910" }, { "database": "PubMed", "id": "9312031", "url": "https://pubmed.ncbi.nlm.nih.gov/9312031" } ], "uniprot_canonical_ac": "P32910-1" }, { "start_pos": 135, "end_pos": 135, "sequence_org": "K", "sequence_mut": "A", "comment": "Cold-sensitive. Abolishes interaction with BRF1/TDS4.", "evidence": [ { "database": "UniProtKB", "id": "P32910", "url": "https://www.uniprot.org/uniprotkb/P32910" }, { "database": "PubMed", "id": "9312031", "url": "https://pubmed.ncbi.nlm.nih.gov/9312031" } ], "uniprot_canonical_ac": "P32910-1" }, { "start_pos": 171, "end_pos": 173, "sequence_org": "DIE", "sequence_mut": "AIA", "comment": "Cold-sensitive. Abolishes interaction with BRF1/TDS4.", "evidence": [ { "database": "UniProtKB", "id": "P32910", "url": "https://www.uniprot.org/uniprotkb/P32910" }, { "database": "PubMed", "id": "9312031", "url": "https://pubmed.ncbi.nlm.nih.gov/9312031" } ], "uniprot_canonical_ac": "P32910-1" }, { "start_pos": 89, "end_pos": 89, "sequence_org": "E", "sequence_mut": "A", "comment": "Cold-sensitive. Abolishes interaction with BRF1/TDS4.", "evidence": [ { "database": "UniProtKB", "id": "P32910", "url": "https://www.uniprot.org/uniprotkb/P32910" }, { "database": "PubMed", "id": "9312031", "url": "https://pubmed.ncbi.nlm.nih.gov/9312031" } ], "uniprot_canonical_ac": "P32910-1" } ], "record_id": "pubmed.9312031", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 29 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The large subunit of basal transcription factor SNAPc is a Myb domain protein that interacts with Oct-1.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Wong MW, Henry RW, Ma B, Kobayashi R, Klages N, Matthias P, Strubin M, Hernandez N", "reference": { "type": "PubMed", "id": "9418884", "url": "https://pubmed.ncbi.nlm.nih.gov/9418884" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14859-1", "protein_name": "POU domain, class 2, transcription factor 1", "gene_name": "POU2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52747-1", "protein_name": "Zinc finger protein 143", "gene_name": "ZNF143", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SXM2-1", "protein_name": "snRNA-activating protein complex subunit 4", "gene_name": "SNAPC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16533-1", "protein_name": "snRNA-activating protein complex subunit 1", "gene_name": "SNAPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13487-1", "protein_name": "snRNA-activating protein complex subunit 2", "gene_name": "SNAPC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20226-1", "protein_name": "TATA-box-binding protein", "gene_name": "TBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75971-1", "protein_name": "snRNA-activating protein complex subunit 5", "gene_name": "SNAPC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6H8Y1-1", "protein_name": "Transcription factor TFIIIB component B'' homolog", "gene_name": "BDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAW0-1", "protein_name": "Transcription factor IIIB 50 kDa subunit", "gene_name": "BRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92966-1", "protein_name": "snRNA-activating protein complex subunit 3", "gene_name": "SNAPC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9418884", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA topoisomerase I and PC4 can interact with human TFIIIC to promote both accurate termination and transcription reinitiation by RNA polymerase III.", "journal": "Molecular cell", "date": "1998", "authors": "Wang Z, Roeder RG", "reference": { "type": "PubMed", "id": "9660958", "url": "https://pubmed.ncbi.nlm.nih.gov/9660958" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61218-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "POLR2F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y535-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC8", "gene_name": "POLR3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00712-1", "protein_name": "Nuclear factor 1 B-type", "gene_name": "NFIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08651-1", "protein_name": "Nuclear factor 1 C-type", "gene_name": "NFIC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15318-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7", "gene_name": "POLR3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1D9-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC6", "gene_name": "POLR3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPB6-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "POLR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW08-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC2", "gene_name": "POLR3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05423-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC4", "gene_name": "POLR3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14802-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC1", "gene_name": "POLR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19388-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "POLR2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVU0-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC5", "gene_name": "POLR3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53803-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "POLR2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "POLR2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Y1-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC10", "gene_name": "POLR3K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62875-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5", "gene_name": "POLR2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15160-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC1", "gene_name": "POLR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT43-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC7-like", "gene_name": "POLR3GL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05455-1", "protein_name": "Lupus La protein", "gene_name": "SSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUI4-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC3", "gene_name": "POLR3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75575-1", "protein_name": "DNA-directed RNA polymerase III subunit RPC9", "gene_name": "CRCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14938-1", "protein_name": "Nuclear factor 1 X-type", "gene_name": "NFIX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12857-1", "protein_name": "Nuclear factor 1 A-type", "gene_name": "NFIA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P61218", "url": "https://www.uniprot.org/uniprotkb/P61218" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9660958", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polymorphisms of amiloride-sensitive sodium channel subunits in five sporadic cases of pseudohypoaldosteronism: do they have pathologic potential?", "journal": "J. Clin. Endocrinol. Metab.", "date": "1999", "authors": "Arai K, Zachman K, Shibasaki T, Chrousos G P", "reference": { "type": "PubMed", "id": "10404817", "url": "https://pubmed.ncbi.nlm.nih.gov/10404817" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10404817", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hormonal regulation and genomic organization of the human amiloride-sensitive epithelial sodium channel alpha subunit gene.", "journal": "Pediatr. Res.", "date": "1999", "authors": "Chow Y H, Wang Y, Plumb J, O'Brodovich H, Hu J", "reference": { "type": "PubMed", "id": "10447117", "url": "https://pubmed.ncbi.nlm.nih.gov/10447117" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10447117", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic variants in the epithelial sodium channel in relation to aldosterone and potassium excretion and risk for hypertension.", "journal": "Hypertension (Dallas, Tex. : 1979)", "date": "1999", "authors": "Ambrosius WT, Bloem LJ, Zhou L, Rebhun JF, Snyder PM, Wagner MA, Guo C, Pratt JH", "reference": { "type": "PubMed", "id": "10523338", "url": "https://pubmed.ncbi.nlm.nih.gov/10523338" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10523338", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of an acid-activated Cl(-) channel from human skeletal muscles.", "journal": "The American journal of physiology", "date": "1999", "authors": "Kawasaki M, Fukuma T, Yamauchi K, Sakamoto H, Marumo F, Sasaki S", "reference": { "type": "PubMed", "id": "10564087", "url": "https://pubmed.ncbi.nlm.nih.gov/10564087" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10564087", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lung symptoms in pseudohypoaldosteronism type 1 are associated with deficiency of the alpha-subunit of the epithelial sodium channel.", "journal": "The Journal of pediatrics", "date": "1999", "authors": "Schaedel C, Marthinsen L, Kristoffersson AC, Kornfalt R, Nilsson KO, Orlenius B, Holmberg L", "reference": { "type": "PubMed", "id": "10586178", "url": "https://pubmed.ncbi.nlm.nih.gov/10586178" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10586178", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human Nedd4 interacts with the human epithelial Na+ channel: WW3 but not WW1 binds to Na+-channel subunits.", "journal": "The Biochemical journal", "date": "2000", "authors": "Farr TJ, Coddington-Lawson SJ, Snyder PM, McDonald FJ", "reference": { "type": "PubMed", "id": "10642508", "url": "https://pubmed.ncbi.nlm.nih.gov/10642508" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10642508", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of the epithelial Na+ channel by Nedd4 and ubiquitination.", "journal": "Kidney international", "date": "2000", "authors": "Staub O, Abriel H, Plant P, Ishikawa T, Kanelis V, Saleki R, Horisberger JD, Schild L, Rotin D", "reference": { "type": "PubMed", "id": "10720933", "url": "https://pubmed.ncbi.nlm.nih.gov/10720933" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10720933", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning, functional expression and chromosomal localization of an amiloride-sensitive Na(+) channel from human small intestine.", "journal": "FEBS letters", "date": "2000", "authors": "Schaefer L, Sakai H, Mattei M, Lazdunski M, Lingueglia E", "reference": { "type": "PubMed", "id": "10767424", "url": "https://pubmed.ncbi.nlm.nih.gov/10767424" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 443, "end_pos": 443, "sequence_org": "A", "sequence_mut": "C", "comment": "Slightly activates the channel.", "evidence": [ { "database": "UniProtKB", "id": "Q9NY37", "url": "https://www.uniprot.org/uniprotkb/Q9NY37" }, { "database": "PubMed", "id": "10767424", "url": "https://pubmed.ncbi.nlm.nih.gov/10767424" } ], "uniprot_canonical_ac": "Q9NY37-1" }, { "start_pos": 443, "end_pos": 443, "sequence_org": "A", "sequence_mut": "F", "comment": "Activates the channel.", "evidence": [ { "database": "UniProtKB", "id": "Q9NY37", "url": "https://www.uniprot.org/uniprotkb/Q9NY37" }, { "database": "PubMed", "id": "10767424", "url": "https://pubmed.ncbi.nlm.nih.gov/10767424" } ], "uniprot_canonical_ac": "Q9NY37-1" }, { "start_pos": 443, "end_pos": 443, "sequence_org": "A", "sequence_mut": "T", "comment": "Activates the channel.", "evidence": [ { "database": "UniProtKB", "id": "Q9NY37", "url": "https://www.uniprot.org/uniprotkb/Q9NY37" }, { "database": "PubMed", "id": "10767424", "url": "https://pubmed.ncbi.nlm.nih.gov/10767424" } ], "uniprot_canonical_ac": "Q9NY37-1" } ], "record_id": "pubmed.10767424", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PKA phosphorylation dissociates FKBP12.6 from the calcium release channel (ryanodine receptor): defective regulation in failing hearts.", "journal": "Cell", "date": "2000", "authors": "Marx SO, Reiken S, Hisamatsu Y, Jayaraman T, Burkhoff D, Rosemblit N, Marks AR", "reference": { "type": "PubMed", "id": "10830164", "url": "https://pubmed.ncbi.nlm.nih.gov/10830164" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 2808, "end_pos": 2808, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation by PKA.", "evidence": [ { "database": "UniProtKB", "id": "Q92736", "url": "https://www.uniprot.org/uniprotkb/Q92736" }, { "database": "PubMed", "id": "10830164", "url": "https://pubmed.ncbi.nlm.nih.gov/10830164" } ], "uniprot_canonical_ac": "Q92736-1" } ], "phosphorylation": [ { "start_pos": 2808, "end_pos": 2808, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92736", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92736" }, { "database": "PubMed", "id": "10830164", "url": "https://pubmed.ncbi.nlm.nih.gov/10830164" } ], "site_lbl": "Ser2808", "uniprot_canonical_ac": "Q92736-1" }, { "start_pos": 2808, "end_pos": 2808, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CaMK2D and PKA", "evidence": [ { "database": "UniProtKB", "id": "Q92736", "url": "https://www.uniprot.org/uniprotkb/Q92736" }, { "database": "iPTMnet", "id": "Q92736", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92736" }, { "database": "PubMed", "id": "10830164", "url": "https://pubmed.ncbi.nlm.nih.gov/10830164" }, { "database": "PubMed", "id": "14715536", "url": "https://pubmed.ncbi.nlm.nih.gov/14715536" }, { "database": "PubMed", "id": "16407108", "url": "https://pubmed.ncbi.nlm.nih.gov/16407108" }, { "database": "PubMed", "id": "16626281", "url": "https://pubmed.ncbi.nlm.nih.gov/16626281" }, { "database": "PubMed", "id": "17606610", "url": "https://pubmed.ncbi.nlm.nih.gov/17606610" }, { "database": "PubMed", "id": "22456474", "url": "https://pubmed.ncbi.nlm.nih.gov/22456474" }, { "database": "PubMed", "id": "24778430", "url": "https://pubmed.ncbi.nlm.nih.gov/24778430" }, { "database": "PubMed", "id": "27647848", "url": "https://pubmed.ncbi.nlm.nih.gov/27647848" }, { "database": "PubMed", "id": "28131631", "url": "https://pubmed.ncbi.nlm.nih.gov/28131631" }, { "database": "PubMed", "id": "30219899", "url": "https://pubmed.ncbi.nlm.nih.gov/30219899" }, { "database": "PubMed", "id": "30356673", "url": "https://pubmed.ncbi.nlm.nih.gov/30356673" }, { "database": "PubMed", "id": "30399185", "url": "https://pubmed.ncbi.nlm.nih.gov/30399185" }, { "database": "PubMed", "id": "35356048", "url": "https://pubmed.ncbi.nlm.nih.gov/35356048" }, { "database": "PubMed", "id": "35885069", "url": "https://pubmed.ncbi.nlm.nih.gov/35885069" }, { "database": "PubMed", "id": "20056922", "url": "https://pubmed.ncbi.nlm.nih.gov/20056922" } ], "site_lbl": "Ser2808", "uniprot_canonical_ac": "Q92736-1" } ], "record_id": "pubmed.10830164", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional and structural analysis of ClC-K chloride channels involved in renal disease.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Waldegger S, Jentsch TJ", "reference": { "type": "PubMed", "id": "10831588", "url": "https://pubmed.ncbi.nlm.nih.gov/10831588" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10831588", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disruption of ClC-3, a chloride channel expressed on synaptic vesicles, leads to a loss of the hippocampus.", "journal": "Neuron", "date": "2001", "authors": "Stobrawa SM, Breiderhoff T, Takamori S, Engel D, Schweizer M, Zdebik AA, Bosl MR, Ruether K, Jahn H, Draguhn A, Jahn R, Jentsch TJ", "reference": { "type": "PubMed", "id": "11182090", "url": "https://pubmed.ncbi.nlm.nih.gov/11182090" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11182090", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Nedd4-like protein KIAA0439 is a potential regulator of the epithelial sodium channel.", "journal": "The Journal of biological chemistry", "date": "2001-03-16", "authors": "Harvey K F, Dinudom A, Cook D I, Kumar S", "reference": { "type": "PubMed", "id": "11244092", "url": "https://pubmed.ncbi.nlm.nih.gov/11244092" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8CFI0-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "Nedd4l", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9WU38-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "Scnn1b", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q61180-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "Scnn1a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9WU39-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "Scnn1g", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11244092", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The alpha-subunit of the epithelial sodium channel is an aldosterone-induced transcript in mammalian collecting ducts, and this transcriptional response is mediated via distinct cis-elements in the 5'-flanking region of the gene.", "journal": "Mol. Endocrinol.", "date": "2001", "authors": "Mick V E, Itani O A, Loftus R W, Husted R F, Schmidt T J, Thomas C P", "reference": { "type": "PubMed", "id": "11266509", "url": "https://pubmed.ncbi.nlm.nih.gov/11266509" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11266509", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nonsteroid anti-inflammatory drugs inhibit both the activity and the inflammation-induced expression of acid-sensing ion channels in nociceptors.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2001", "authors": "Voilley N, de Weille J, Mamet J, Lazdunski M", "reference": { "type": "PubMed", "id": "11588175", "url": "https://pubmed.ncbi.nlm.nih.gov/11588175" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "O35240-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "Asic3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P55926-1", "protein_name": "Acid-sensing ion channel 1", "gene_name": "Asic1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62962-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "Asic2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11588175", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 80 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutation of BSND causes Bartter syndrome with sensorineural deafness and kidney failure.", "journal": "Nature genetics", "date": "2001", "authors": "Birkenhager R, Otto E, Schurmann MJ, Vollmer M, Ruf EM, Maier-Lutz I, Beekmann F, Fekete A, Omran H, Feldmann D, Milford DV, Jeck N, Konrad M, Landau D, Knoers NV, Antignac C, Sudbrak R, Kispert A, Hildebrandt F", "reference": { "type": "PubMed", "id": "11687798", "url": "https://pubmed.ncbi.nlm.nih.gov/11687798" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VIM4-1", "protein_name": "Barttin", "gene_name": "Bsnd", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11687798", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 78 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Serum and glucocorticoid-regulated kinase modulates Nedd4-2-mediated inhibition of the epithelial Na+ channel.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Snyder PM, Olson DR, Thomas BC", "reference": { "type": "PubMed", "id": "11696533", "url": "https://pubmed.ncbi.nlm.nih.gov/11696533" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 127, "end_pos": 127, "sequence_org": "K", "sequence_mut": "M", "comment": "Abolishes enzymatic activity.", "evidence": [ { "database": "UniProtKB", "id": "O00141", "url": "https://www.uniprot.org/uniprotkb/O00141" }, { "database": "PubMed", "id": "15040001", "url": "https://pubmed.ncbi.nlm.nih.gov/15040001" }, { "database": "PubMed", "id": "11696533", "url": "https://pubmed.ncbi.nlm.nih.gov/11696533" }, { "database": "PubMed", "id": "12911626", "url": "https://pubmed.ncbi.nlm.nih.gov/12911626" } ], "uniprot_canonical_ac": "O00141-1" }, { "start_pos": 298, "end_pos": 298, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes interaction with NEDD4 and NEDD4L.", "evidence": [ { "database": "UniProtKB", "id": "O00141", "url": "https://www.uniprot.org/uniprotkb/O00141" }, { "database": "PubMed", "id": "11696533", "url": "https://pubmed.ncbi.nlm.nih.gov/11696533" } ], "uniprot_canonical_ac": "O00141-1" }, { "start_pos": 422, "end_pos": 422, "sequence_org": "S", "sequence_mut": "A", "comment": "Low activity.", "evidence": [ { "database": "UniProtKB", "id": "O00141", "url": "https://www.uniprot.org/uniprotkb/O00141" }, { "database": "PubMed", "id": "10191262", "url": "https://pubmed.ncbi.nlm.nih.gov/10191262" }, { "database": "PubMed", "id": "15040001", "url": "https://pubmed.ncbi.nlm.nih.gov/15040001" }, { "database": "PubMed", "id": "11696533", "url": "https://pubmed.ncbi.nlm.nih.gov/11696533" }, { "database": "PubMed", "id": "12911626", "url": "https://pubmed.ncbi.nlm.nih.gov/12911626" } ], "uniprot_canonical_ac": "O00141-1" }, { "start_pos": 422, "end_pos": 422, "sequence_org": "S", "sequence_mut": "D", "comment": "10-fold activation.", "evidence": [ { "database": "UniProtKB", "id": "O00141", "url": "https://www.uniprot.org/uniprotkb/O00141" }, { "database": "PubMed", "id": "10191262", "url": "https://pubmed.ncbi.nlm.nih.gov/10191262" }, { "database": "PubMed", "id": "15040001", "url": "https://pubmed.ncbi.nlm.nih.gov/15040001" }, { "database": "PubMed", "id": "11696533", "url": "https://pubmed.ncbi.nlm.nih.gov/11696533" }, { "database": "PubMed", "id": "12911626", "url": "https://pubmed.ncbi.nlm.nih.gov/12911626" } ], "uniprot_canonical_ac": "O00141-1" } ], "record_id": "pubmed.11696533", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Barttin is a Cl- channel beta-subunit crucial for renal Cl- reabsorption and inner ear K+ secretion.", "journal": "Nature", "date": "2001", "authors": "Estevez R, Boettger T, Stein V, Birkenhager R, Otto E, Hildebrandt F, Jentsch TJ", "reference": { "type": "PubMed", "id": "11734858", "url": "https://pubmed.ncbi.nlm.nih.gov/11734858" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9WUB7-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "Clcnka", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9WUB6-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "Clcnkb", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VIM4-1", "protein_name": "Barttin", "gene_name": "Bsnd", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 98, "end_pos": 98, "sequence_org": "Y", "sequence_mut": "A", "comment": "Stimulation of CLCNKA and CLCNKB currents enhanced; intense localization in the plasma membrane with no intracellular localization observed.", "evidence": [ { "database": "UniProtKB", "id": "Q8WZ55", "url": "https://www.uniprot.org/uniprotkb/Q8WZ55" }, { "database": "PubMed", "id": "11734858", "url": "https://pubmed.ncbi.nlm.nih.gov/11734858" }, { "database": "PubMed", "id": "12761627", "url": "https://pubmed.ncbi.nlm.nih.gov/12761627" } ], "uniprot_canonical_ac": "Q8WZ55-1" } ], "record_id": "pubmed.11734858", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 80 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A calcium-activated chloride channel (HCLCA1) is strongly related to IL-9 expression and mucus production in bronchial epithelium of patients with asthma.", "journal": "The Journal of allergy and clinical immunology", "date": "2002", "authors": "Toda M, Tulic MK, Levitt RC, Hamid Q", "reference": { "type": "PubMed", "id": "11842292", "url": "https://pubmed.ncbi.nlm.nih.gov/11842292" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11842292", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The vitelliform macular dystrophy protein defines a new family of chloride channels.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Sun H, Tsunenari T, Yau KW, Nathans J", "reference": { "type": "PubMed", "id": "11904445", "url": "https://pubmed.ncbi.nlm.nih.gov/11904445" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 221, "end_pos": 221, "sequence_org": "C", "sequence_mut": "A", "comment": "Impairs inactivation of ligand-gated anion channel activity by sulfhydryl-reactive agents; when associated with A-23; A-42; A-69 and A-251.", "evidence": [ { "database": "UniProtKB", "id": "O76090", "url": "https://www.uniprot.org/uniprotkb/O76090" }, { "database": "PubMed", "id": "11904445", "url": "https://pubmed.ncbi.nlm.nih.gov/11904445" } ], "uniprot_canonical_ac": "O76090-1" }, { "start_pos": 23, "end_pos": 23, "sequence_org": "C", "sequence_mut": "A", "comment": "Impairs inactivation of ligand-gated anion channel activity by sulfhydryl-reactive agents; when associated with A-42; A-69; A-221 and A-251.", "evidence": [ { "database": "UniProtKB", "id": "O76090", "url": "https://www.uniprot.org/uniprotkb/O76090" }, { "database": "PubMed", "id": "11904445", "url": "https://pubmed.ncbi.nlm.nih.gov/11904445" } ], "uniprot_canonical_ac": "O76090-1" }, { "start_pos": 251, "end_pos": 251, "sequence_org": "C", "sequence_mut": "A", "comment": "Impairs inactivation of ligand-gated anion channel activity by sulfhydryl-reactive agents; when associated with A-23; A-42; A-69 and A-221.", "evidence": [ { "database": "UniProtKB", "id": "O76090", "url": "https://www.uniprot.org/uniprotkb/O76090" }, { "database": "PubMed", "id": "11904445", "url": "https://pubmed.ncbi.nlm.nih.gov/11904445" } ], "uniprot_canonical_ac": "O76090-1" }, { "start_pos": 42, "end_pos": 42, "sequence_org": "C", "sequence_mut": "A", "comment": "Impairs inactivation of ligand-gated anion channel activity by sulfhydryl-reactive agents; when associated with A-23; A-69; A-221 and A-251.", "evidence": [ { "database": "UniProtKB", "id": "O76090", "url": "https://www.uniprot.org/uniprotkb/O76090" }, { "database": "PubMed", "id": "11904445", "url": "https://pubmed.ncbi.nlm.nih.gov/11904445" } ], "uniprot_canonical_ac": "O76090-1" }, { "start_pos": 69, "end_pos": 69, "sequence_org": "C", "sequence_mut": "A", "comment": "Impairs inactivation of ligand-gated anion channel activity by sulfhydryl-reactive agents; when associated with A-23; A-42; A-221 and A-251.", "evidence": [ { "database": "UniProtKB", "id": "O76090", "url": "https://www.uniprot.org/uniprotkb/O76090" }, { "database": "PubMed", "id": "11904445", "url": "https://pubmed.ncbi.nlm.nih.gov/11904445" } ], "uniprot_canonical_ac": "O76090-1" } ], "record_id": "pubmed.11904445", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Increased expression of the human Ca2+-activated Cl- channel 1 (CaCC1) gene in the asthmatic airway.", "journal": "American journal of respiratory and critical care medicine", "date": "2002", "authors": "Hoshino M, Morita S, Iwashita H, Sagiya Y, Nagi T, Nakanishi A, Ashida Y, Nishimura O, Fujisawa Y, Fujino M", "reference": { "type": "PubMed", "id": "11956057", "url": "https://pubmed.ncbi.nlm.nih.gov/11956057" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11956057", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel mutations responsible for autosomal recessive multisystem pseudohypoaldosteronism and sequence variants in epithelial sodium channel alpha-, beta-, and gamma-subunit genes.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002", "authors": "Saxena A, Hanukoglu I, Saxena D, Thompson RJ, Gardiner RM, Hanukoglu A", "reference": { "type": "PubMed", "id": "12107247", "url": "https://pubmed.ncbi.nlm.nih.gov/12107247" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12107247", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitin-protein ligase WWP2 binds to and downregulates the epithelial Na(+) channel.", "journal": "American journal of physiology. Renal physiology", "date": "2002", "authors": "McDonald FJ, Western AH, McNeil JD, Thomas BC, Olson DR, Snyder PM", "reference": { "type": "PubMed", "id": "12167593", "url": "https://pubmed.ncbi.nlm.nih.gov/12167593" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00308-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP2", "gene_name": "WWP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12167593", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Amiloride-blockable acid-sensing ion channels are leading acid sensors expressed in human nociceptors.", "journal": "The Journal of clinical investigation", "date": "2002", "authors": "Ugawa S, Ueda T, Ishida Y, Nishigaki M, Shibata Y, Shimada S", "reference": { "type": "PubMed", "id": "12393854", "url": "https://pubmed.ncbi.nlm.nih.gov/12393854" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12393854", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure-function analysis of the bestrophin family of anion channels.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tsunenari T, Sun H, Williams J, Cahill H, Smallwood P, Yau KW, Nathans J", "reference": { "type": "PubMed", "id": "12907679", "url": "https://pubmed.ncbi.nlm.nih.gov/12907679" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12907679", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The skeletal muscle chloride channel in dominant and recessive human myotonia.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "Koch MC, Steinmeyer K, Lorenz C, Ricker K, Wolf F, Otto M, Zoll B, Lehmann-Horn F, Grzeschik KH, Jentsch TJ", "reference": { "type": "PubMed", "id": "1379744", "url": "https://pubmed.ncbi.nlm.nih.gov/1379744" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1379744", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chloride channel ClCN7 mutations are responsible for severe recessive, dominant, and intermediate osteopetrosis.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2003", "authors": "Frattini A, Pangrazio A, Susani L, Sobacchi C, Mirolo M, Abinun M, Andolina M, Flanagan A, Horwitz EM, Mihci E, Notarangelo LD, Ramenghi U, Teti A, Van Hove J, Vujic D, Young T, Albertini A, Orchard PJ, Vezzoni P, Villa A", "reference": { "type": "PubMed", "id": "14584882", "url": "https://pubmed.ncbi.nlm.nih.gov/14584882" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14584882", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A new sperm-specific Na+/H+ exchanger required for sperm motility and fertility.", "journal": "Nature cell biology", "date": "2003", "authors": "Wang D, King SM, Quill TA, Doolittle LK, Garbers DL", "reference": { "type": "PubMed", "id": "14634667", "url": "https://pubmed.ncbi.nlm.nih.gov/14634667" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UJY2-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "Slc9c1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14634667", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 78 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel human Cl(-) channel family related to Drosophila flightless locus.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Suzuki M, Mizuno A", "reference": { "type": "PubMed", "id": "15010458", "url": "https://pubmed.ncbi.nlm.nih.gov/15010458" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D3A9-1", "protein_name": "Protein tweety homolog 1", "gene_name": "Ttyh1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H313-1", "protein_name": "Protein tweety homolog 1", "gene_name": "TTYH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P5F7-1", "protein_name": "Protein tweety homolog 3", "gene_name": "Ttyh3", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7P5C&bu=0&command=select+.B:351;+center+selection;+zoom+selection" }, "start_pos": 351, "start_aa": "Asn", "end_pos": 351, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn351", "evidence": [ { "id": "Q9C0H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9C0H2#ptm_processing" }, { "id": "34385445", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34385445" }, { "id": "15010458", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15010458" }, { "id": "18260827", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18260827" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "7P5C", "database": "PDB", "url": "https://www.rcsb.org/structure/7P5C" }, { "id": "9QNR", "database": "PDB", "url": "https://www.rcsb.org/structure/9QNR" } ], "filter_code": "001000000000000000000.00010000000000.00.01101", "uniprot_canonical_ac": "Q9C0H2-1" } ], "mutagenesis": [ { "start_pos": 128, "end_pos": 128, "sequence_org": "T", "sequence_mut": "A", "comment": "Does not affect N-glycosylation state.", "evidence": [ { "database": "UniProtKB", "id": "Q9C0H2", "url": "https://www.uniprot.org/uniprotkb/Q9C0H2" }, { "database": "PubMed", "id": "15010458", "url": "https://pubmed.ncbi.nlm.nih.gov/15010458" } ], "uniprot_canonical_ac": "Q9C0H2-1" }, { "start_pos": 146, "end_pos": 146, "sequence_org": "T", "sequence_mut": "A", "comment": "Does not affect N-glycosylation state.", "evidence": [ { "database": "UniProtKB", "id": "Q9C0H2", "url": "https://www.uniprot.org/uniprotkb/Q9C0H2" }, { "database": "PubMed", "id": "15010458", "url": "https://pubmed.ncbi.nlm.nih.gov/15010458" } ], "uniprot_canonical_ac": "Q9C0H2-1" }, { "start_pos": 353, "end_pos": 353, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes N-glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9C0H2", "url": "https://www.uniprot.org/uniprotkb/Q9C0H2" }, { "database": "PubMed", "id": "15010458", "url": "https://pubmed.ncbi.nlm.nih.gov/15010458" }, { "database": "PubMed", "id": "18260827", "url": "https://pubmed.ncbi.nlm.nih.gov/18260827" } ], "uniprot_canonical_ac": "Q9C0H2-1" }, { "start_pos": 367, "end_pos": 367, "sequence_org": "R", "sequence_mut": "Q", "comment": "Induces a stronger permeability to cations.", "evidence": [ { "database": "UniProtKB", "id": "Q9C0H2", "url": "https://www.uniprot.org/uniprotkb/Q9C0H2" }, { "database": "PubMed", "id": "15010458", "url": "https://pubmed.ncbi.nlm.nih.gov/15010458" } ], "uniprot_canonical_ac": "Q9C0H2-1" }, { "start_pos": 370, "end_pos": 370, "sequence_org": "H", "sequence_mut": "D", "comment": "Shows a different ion selectivity.", "evidence": [ { "database": "UniProtKB", "id": "Q9C0H2", "url": "https://www.uniprot.org/uniprotkb/Q9C0H2" }, { "database": "PubMed", "id": "15010458", "url": "https://pubmed.ncbi.nlm.nih.gov/15010458" } ], "uniprot_canonical_ac": "Q9C0H2-1" } ], "record_id": "pubmed.15010458", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 80 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Salt wasting and deafness resulting from mutations in two chloride channels.", "journal": "The New England journal of medicine", "date": "2004", "authors": "Schlingmann KP, Konrad M, Jeck N, Waldegger P, Reinalter SC, Holder M, Seyberth HW, Waldegger S", "reference": { "type": "PubMed", "id": "15044642", "url": "https://pubmed.ncbi.nlm.nih.gov/15044642" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15044642", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CLIC-2 modulates cardiac ryanodine receptor Ca2+ release channels.", "journal": "The international journal of biochemistry & cell biology", "date": "2004", "authors": "Board PG, Coggan M, Watson S, Gage PW, Dulhunty AF", "reference": { "type": "PubMed", "id": "15147738", "url": "https://pubmed.ncbi.nlm.nih.gov/15147738" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15147738", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of the hCLCA1 gene with childhood and adult asthma.", "journal": "Genes and immunity", "date": "2004", "authors": "Kamada F, Suzuki Y, Shao C, Tamari M, Hasegawa K, Hirota T, Shimizu M, Takahashi N, Mao XQ, Doi S, Fujiwara H, Miyatake A, Fujita K, Chiba Y, Aoki Y, Kure S, Tamura G, Shirakawa T, Matsubara Y", "reference": { "type": "PubMed", "id": "15318163", "url": "https://pubmed.ncbi.nlm.nih.gov/15318163" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15318163", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ClC-3 chloride channels facilitate endosomal acidification and chloride accumulation.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Hara-Chikuma M, Yang B, Sonawane ND, Sasaki S, Uchida S, Verkman AS", "reference": { "type": "PubMed", "id": "15504734", "url": "https://pubmed.ncbi.nlm.nih.gov/15504734" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51791-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "Clcn3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15504734", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 78 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NPT4, a new microsomal phosphate transporter: mutation analysis in glycogen storage disease type Ic.", "journal": "Journal of inherited metabolic disease", "date": "2004", "authors": "Melis D, Havelaar AC, Verbeek E, Smit GP, Benedetti A, Mancini GM, Verheijen F", "reference": { "type": "PubMed", "id": "15505377", "url": "https://pubmed.ncbi.nlm.nih.gov/15505377" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15505377", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Impact of alphaENaC polymorphisms on the risk of ischemic cerebrovascular events: a multicenter case-control study.", "journal": "Clin. Chem.", "date": "2005", "authors": "Hsieh Kety, Lalouschek Wolfgang, Schillinger Martin, Endler Georg, Reisinger Manuela, Janisiw Michael, Lang Wilfried, Cheng Suzanne, Wagner Oswald, Mannhalter Christine", "reference": { "type": "PubMed", "id": "15734793", "url": "https://pubmed.ncbi.nlm.nih.gov/15734793" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15734793", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel mutations in epithelial sodium channel (ENaC) subunit genes and phenotypic expression of multisystem pseudohypoaldosteronism.", "journal": "Clinical endocrinology", "date": "2005", "authors": "Edelheit O, Hanukoglu I, Gizewska M, Kandemir N, Tenenbaum-Rakover Y, Yurdakok M, Zajaczek S, Hanukoglu A", "reference": { "type": "PubMed", "id": "15853823", "url": "https://pubmed.ncbi.nlm.nih.gov/15853823" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15853823", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A recently identified member of the glutathione transferase structural family modifies cardiac RyR2 substate activity, coupled gating and activation by Ca2+ and ATP.", "journal": "The Biochemical journal", "date": "2005", "authors": "Dulhunty AF, Pouliquin P, Coggan M, Gage PW, Board PG", "reference": { "type": "PubMed", "id": "15916532", "url": "https://pubmed.ncbi.nlm.nih.gov/15916532" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15916532", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "hCLCA1 and mCLCA3 are secreted non-integral membrane proteins and therefore are not ion channels.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Gibson A, Lewis AP, Affleck K, Aitken AJ, Meldrum E, Thompson N", "reference": { "type": "PubMed", "id": "15919655", "url": "https://pubmed.ncbi.nlm.nih.gov/15919655" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D7Z6-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "Clca1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15919655", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 78 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the beta-subunit of the epithelial Na+ channel in patients with a cystic fibrosis-like syndrome.", "journal": "Human molecular genetics", "date": "2005", "authors": "Sheridan MB, Fong P, Groman JD, Conrad C, Flume P, Diaz R, Harris C, Knowles M, Cutting GR", "reference": { "type": "PubMed", "id": "16207733", "url": "https://pubmed.ncbi.nlm.nih.gov/16207733" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16207733", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila tweety family: molecular candidates for large-conductance Ca2+-activated Cl- channels.", "journal": "Experimental physiology", "date": "2006", "authors": "Suzuki M", "reference": { "type": "PubMed", "id": "16219661", "url": "https://pubmed.ncbi.nlm.nih.gov/16219661" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9W5A5-1", "protein_name": "Protein movement modulator", "gene_name": "Motor", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16219661", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 78 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in OSTM1 (grey lethal) define a particularly severe form of autosomal recessive osteopetrosis with neural involvement.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2006", "authors": "Pangrazio A, Poliani PL, Megarbane A, Lefranc G, Lanino E, Di Rocco M, Rucci F, Lucchini F, Ravanini M, Facchetti F, Abinun M, Vezzoni P, Villa A, Frattini A", "reference": { "type": "PubMed", "id": "16813530", "url": "https://pubmed.ncbi.nlm.nih.gov/16813530" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16813530", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Barttin modulates trafficking and function of ClC-K channels.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Scholl U, Hebeisen S, Janssen AG, Muller-Newen G, Alekov A, Fahlke C", "reference": { "type": "PubMed", "id": "16849430", "url": "https://pubmed.ncbi.nlm.nih.gov/16849430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06393-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "Clcnka", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 166, "end_pos": 166, "sequence_org": "V", "sequence_mut": "E", "comment": "Inverts the voltage dependence of channel gating, with fast protopore gating upon membrane depolarization and slow common gating upon hyperpolarization; activated upon hyperpolarization when coexpressed with BSND/Barttin.", "evidence": [ { "database": "UniProtKB", "id": "Q06393", "url": "https://www.uniprot.org/uniprotkb/Q06393" }, { "database": "PubMed", "id": "20538786", "url": "https://pubmed.ncbi.nlm.nih.gov/20538786" }, { "database": "PubMed", "id": "16849430", "url": "https://pubmed.ncbi.nlm.nih.gov/16849430" } ], "uniprot_canonical_ac": "Q06393-1" }, { "start_pos": 115, "end_pos": 320, "sequence_org": "SHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG", "sequence_mut": "", "comment": "No effect on CLCNKB channel conductance.", "evidence": [ { "database": "UniProtKB", "id": "Q8WZ55", "url": "https://www.uniprot.org/uniprotkb/Q8WZ55" }, { "database": "PubMed", "id": "16849430", "url": "https://pubmed.ncbi.nlm.nih.gov/16849430" } ], "uniprot_canonical_ac": "Q8WZ55-1" }, { "start_pos": 243, "end_pos": 320, "sequence_org": "LIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG", "sequence_mut": "", "comment": "No effect on CLCNKB channel conductance.", "evidence": [ { "database": "UniProtKB", "id": "Q8WZ55", "url": "https://www.uniprot.org/uniprotkb/Q8WZ55" }, { "database": "PubMed", "id": "16849430", "url": "https://pubmed.ncbi.nlm.nih.gov/16849430" } ], "uniprot_canonical_ac": "Q8WZ55-1" }, { "start_pos": 54, "end_pos": 320, "sequence_org": "CQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG", "sequence_mut": "", "comment": "Abolishes CLCNKB channel conductance.", "evidence": [ { "database": "UniProtKB", "id": "Q8WZ55", "url": "https://www.uniprot.org/uniprotkb/Q8WZ55" }, { "database": "PubMed", "id": "16849430", "url": "https://pubmed.ncbi.nlm.nih.gov/16849430" } ], "uniprot_canonical_ac": "Q8WZ55-1" }, { "start_pos": 57, "end_pos": 320, "sequence_org": "YPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG", "sequence_mut": "", "comment": "Abolishes CLCNKB channel conductance.", "evidence": [ { "database": "UniProtKB", "id": "Q8WZ55", "url": "https://www.uniprot.org/uniprotkb/Q8WZ55" }, { "database": "PubMed", "id": "16849430", "url": "https://pubmed.ncbi.nlm.nih.gov/16849430" } ], "uniprot_canonical_ac": "Q8WZ55-1" }, { "start_pos": 61, "end_pos": 320, "sequence_org": "TFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG", "sequence_mut": "", "comment": "Abolishes CLCNKB channel conductance.", "evidence": [ { "database": "UniProtKB", "id": "Q8WZ55", "url": "https://www.uniprot.org/uniprotkb/Q8WZ55" }, { "database": "PubMed", "id": "16849430", "url": "https://pubmed.ncbi.nlm.nih.gov/16849430" } ], "uniprot_canonical_ac": "Q8WZ55-1" }, { "start_pos": 72, "end_pos": 320, "sequence_org": "ILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG", "sequence_mut": "", "comment": "Decreases the amplitude of CLCNKB channel current but does not affect the open probability.", "evidence": [ { "database": "UniProtKB", "id": "Q8WZ55", "url": "https://www.uniprot.org/uniprotkb/Q8WZ55" }, { "database": "PubMed", "id": "16849430", "url": "https://pubmed.ncbi.nlm.nih.gov/16849430" } ], "uniprot_canonical_ac": "Q8WZ55-1" }, { "start_pos": 85, "end_pos": 320, "sequence_org": "LAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG", "sequence_mut": "", "comment": "Decreases the amplitude of CLCNKB channel current but does not affect the open probability.", "evidence": [ { "database": "UniProtKB", "id": "Q8WZ55", "url": "https://www.uniprot.org/uniprotkb/Q8WZ55" }, { "database": "PubMed", "id": "16849430", "url": "https://pubmed.ncbi.nlm.nih.gov/16849430" } ], "uniprot_canonical_ac": "Q8WZ55-1" } ], "record_id": "pubmed.16849430", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 78 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of a novel human NHEDC1 (Na+/H+ exchanger like domain containing 1) gene expressed specifically in testis.", "journal": "Molecular biology reports", "date": "2006", "authors": "Ye G, Chen C, Han D, Xiong X, Kong Y, Wan B, Yu L", "reference": { "type": "PubMed", "id": "16850186", "url": "https://pubmed.ncbi.nlm.nih.gov/16850186" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16850186", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epithelial sodium channel (ENaC) is multi-ubiquitinated at the cell surface.", "journal": "The Biochemical journal", "date": "2007", "authors": "Wiemuth D, Ke Y, Rohlfs M, McDonald FJ", "reference": { "type": "PubMed", "id": "17381423", "url": "https://pubmed.ncbi.nlm.nih.gov/17381423" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17381423", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The neuronal channel NALCN contributes resting sodium permeability and is required for normal respiratory rhythm.", "journal": "Cell", "date": "2007", "authors": "Lu B, Su Y, Das S, Liu J, Xia J, Ren D", "reference": { "type": "PubMed", "id": "17448995", "url": "https://pubmed.ncbi.nlm.nih.gov/17448995" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6Q760-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "Nalcn", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BXR5-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "Nalcn", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17448995", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 79 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nedd4-2 catalyzes ubiquitination and degradation of cell surface ENaC.", "journal": "The Journal of biological chemistry", "date": "2007-07-13", "authors": "Zhou Ruifeng, Patel Saumil V, Snyder Peter M", "reference": { "type": "PubMed", "id": "17502380", "url": "https://pubmed.ncbi.nlm.nih.gov/17502380" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 644, "end_pos": 644, "sequence_org": "Y", "sequence_mut": "A", "comment": "Prevents ubiquitination by NEDD4L.", "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" }, { "database": "PubMed", "id": "17502380", "url": "https://pubmed.ncbi.nlm.nih.gov/17502380" } ], "uniprot_canonical_ac": "P37088-1" }, { "start_pos": 627, "end_pos": 627, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of ubiquitination by NEDD4L.", "evidence": [ { "database": "UniProtKB", "id": "P51170", "url": "https://www.uniprot.org/uniprotkb/P51170" }, { "database": "PubMed", "id": "17502380", "url": "https://pubmed.ncbi.nlm.nih.gov/17502380" } ], "uniprot_canonical_ac": "P51170-1" }, { "start_pos": 620, "end_pos": 620, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of inhibition of the ENaC channel by NEDD4. Loss of ubiquitination by NEDD4L.", "evidence": [ { "database": "UniProtKB", "id": "P51168", "url": "https://www.uniprot.org/uniprotkb/P51168" }, { "database": "PubMed", "id": "9792722", "url": "https://pubmed.ncbi.nlm.nih.gov/9792722" }, { "database": "PubMed", "id": "17502380", "url": "https://pubmed.ncbi.nlm.nih.gov/17502380" } ], "uniprot_canonical_ac": "P51168-1" } ], "record_id": "pubmed.17502380", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis for the impaired function of the natural F112L sorcin mutant: X-ray crystal structure, calcium affinity, and interaction with annexin VII and the ryanodine receptor.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2008", "authors": "Franceschini S, Ilari A, Verzili D, Zamparelli C, Antaramian A, Rueda A, Valdivia HH, Chiancone E, Colotti G", "reference": { "type": "PubMed", "id": "17699613", "url": "https://pubmed.ncbi.nlm.nih.gov/17699613" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17699613", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Upregulated expression of ENaC in human CF nasal epithelium.", "journal": "J. Cyst. Fibros.", "date": "2008", "authors": "Bangel Nadine, Dahlhoff Christoph, Sobczak Katja, Weber Wolf-Michael, Kusche-Vihrog Kristina", "reference": { "type": "PubMed", "id": "17766193", "url": "https://pubmed.ncbi.nlm.nih.gov/17766193" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17766193", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of human cardiac calsequestrin and its deleterious mutants.", "journal": "Journal of molecular biology", "date": "2007", "authors": "Kim E, Youn B, Kemper L, Campbell C, Milting H, Varsanyi M, Kang C", "reference": { "type": "PubMed", "id": "17881003", "url": "https://pubmed.ncbi.nlm.nih.gov/17881003" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17881003", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A human Na+/H+ antiporter sharing evolutionary origins with bacterial NhaA may be a candidate gene for essential hypertension.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Xiang M, Feng M, Muend S, Rao R", "reference": { "type": "PubMed", "id": "18000046", "url": "https://pubmed.ncbi.nlm.nih.gov/18000046" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5BKR2-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "Slc9b2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 278, "end_pos": 279, "sequence_org": "DD", "sequence_mut": "CC", "comment": "Loss of ion transport activity; Does not rescue insulin secretion defect induced by knockdown of SLC9B2 in Min6 cells.", "evidence": [ { "database": "UniProtKB", "id": "Q86UD5", "url": "https://www.uniprot.org/uniprotkb/Q86UD5" }, { "database": "PubMed", "id": "23720317", "url": "https://pubmed.ncbi.nlm.nih.gov/23720317" }, { "database": "PubMed", "id": "18000046", "url": "https://pubmed.ncbi.nlm.nih.gov/18000046" } ], "uniprot_canonical_ac": "Q86UD5-1" } ], "record_id": "pubmed.18000046", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 78 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Determinants of anion-proton coupling in mammalian endosomal CLC proteins.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zdebik AA, Zifarelli G, Bergsdorf EY, Soliani P, Scheel O, Jentsch TJ, Pusch M", "reference": { "type": "PubMed", "id": "18063579", "url": "https://pubmed.ncbi.nlm.nih.gov/18063579" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 224, "end_pos": 224, "sequence_org": "E", "sequence_mut": "A", "comment": "Restores chloride translocation, but not proton transport; when associated with A-281.", "evidence": [ { "database": "UniProtKB", "id": "P51793", "url": "https://www.uniprot.org/uniprotkb/P51793" }, { "database": "PubMed", "id": "18063579", "url": "https://pubmed.ncbi.nlm.nih.gov/18063579" } ], "uniprot_canonical_ac": "P51793-1" }, { "start_pos": 281, "end_pos": 281, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes translocation of protons and chloride ions.", "evidence": [ { "database": "UniProtKB", "id": "P51793", "url": "https://www.uniprot.org/uniprotkb/P51793" }, { "database": "PubMed", "id": "18063579", "url": "https://pubmed.ncbi.nlm.nih.gov/18063579" } ], "uniprot_canonical_ac": "P51793-1" } ], "record_id": "pubmed.18063579", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nedd4-2 induces endocytosis and degradation of proteolytically cleaved epithelial Na+ channels.", "journal": "The Journal of biological chemistry", "date": "2008-03-07", "authors": "Kabra Rajesh, Knight Kristin K, Zhou Ruifeng, Snyder Peter M", "reference": { "type": "PubMed", "id": "18174164", "url": "https://pubmed.ncbi.nlm.nih.gov/18174164" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18174164", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular analysis of digenic inheritance in Bartter syndrome with sensorineural deafness.", "journal": "Journal of medical genetics", "date": "2008", "authors": "Nozu K, Inagaki T, Fu XJ, Nozu Y, Kaito H, Kanda K, Sekine T, Igarashi T, Nakanishi K, Yoshikawa N, Iijima K, Matsuo M", "reference": { "type": "PubMed", "id": "18310267", "url": "https://pubmed.ncbi.nlm.nih.gov/18310267" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18310267", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bestrophin Cl- channels are highly permeable to HCO3-.", "journal": "American journal of physiology. Cell physiology", "date": "2008", "authors": "Qu Z, Hartzell HC", "reference": { "type": "PubMed", "id": "18400985", "url": "https://pubmed.ncbi.nlm.nih.gov/18400985" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BGM5-1", "protein_name": "Bestrophin-2", "gene_name": "Best2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18400985", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 78 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Cl-/H+ antiporter ClC-7 is the primary chloride permeation pathway in lysosomes.", "journal": "Nature", "date": "2008", "authors": "Graves AR, Curran PK, Smith CL, Mindell JA", "reference": { "type": "PubMed", "id": "18449189", "url": "https://pubmed.ncbi.nlm.nih.gov/18449189" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37088-1", "protein_name": "Epithelial sodium channel subunit alpha", "gene_name": "SCNN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00141-1", "protein_name": "Serine/threonine-protein kinase Sgk1", "gene_name": "SGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51170-1", "protein_name": "Epithelial sodium channel subunit gamma", "gene_name": "SCNN1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99576-1", "protein_name": "TSC22 domain family protein 3", "gene_name": "TSC22D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3S1-1", "protein_name": "Serine/threonine-protein kinase WNK2", "gene_name": "WNK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35523-1", "protein_name": "Chloride channel protein 1", "gene_name": "CLCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12797-1", "protein_name": "Aspartyl/asparaginyl beta-hydroxylase", "gene_name": "ASPH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78348-2", "protein_name": "Acid-sensing ion channel 1", "gene_name": "ASIC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHC3-1", "protein_name": "Acid-sensing ion channel 3", "gene_name": "ASIC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4A3-1", "protein_name": "Serine/threonine-protein kinase WNK1", "gene_name": "WNK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J92-1", "protein_name": "Serine/threonine-protein kinase WNK4", "gene_name": "WNK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51798-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "CLCN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8K7I4-1", "protein_name": "Calcium-activated chloride channel regulator 1", "gene_name": "CLCA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51797-1", "protein_name": "H(+)/Cl(-) exchange transporter 6", "gene_name": "CLCN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51800-1", "protein_name": "Chloride channel protein ClC-Ka", "gene_name": "CLCNKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51788-1", "protein_name": "Chloride channel protein 2", "gene_name": "CLCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51172-3", "protein_name": "Epithelial sodium channel subunit delta", "gene_name": "SCNN1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51799-1", "protein_name": "H(+)/Cl(-) exchange transporter 7", "gene_name": "Clcn7", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q15413-1", "protein_name": "Ryanodine receptor 3", "gene_name": "RYR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBY8-2", "protein_name": "Serine/threonine-protein kinase Sgk2", "gene_name": "SGK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4ZJI4-1", "protein_name": "Sodium/hydrogen exchanger 9B1", "gene_name": "SLC9B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G0N8-1", "protein_name": "Solute carrier family 9 member C1", "gene_name": "SLC9C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UD5-1", "protein_name": "Sodium/hydrogen exchanger 9B2", "gene_name": "SLC9B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16515-1", "protein_name": "Acid-sensing ion channel 2", "gene_name": "ASIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FT7-4", "protein_name": "Acid-sensing ion channel 4", "gene_name": "ASIC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY37-1", "protein_name": "Bile acid-sensitive ion channel", "gene_name": "ASIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31415-1", "protein_name": "Calsequestrin-1", "gene_name": "CASQ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14958-1", "protein_name": "Calsequestrin-2", "gene_name": "CASQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAH2-1", "protein_name": "Sodium/hydrogen exchanger 11", "gene_name": "SLC9C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BR1-1", "protein_name": "Serine/threonine-protein kinase Sgk3", "gene_name": "SGK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15247-1", "protein_name": "Chloride intracellular channel protein 2", "gene_name": "CLIC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92736-1", "protein_name": "Ryanodine receptor 2", "gene_name": "RYR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68106-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1B", "gene_name": "FKBP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU1-1", "protein_name": "Bestrophin-2a", "gene_name": "BEST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1M1-2", "protein_name": "Bestrophin-3", "gene_name": "BEST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30626-1", "protein_name": "Sorcin", "gene_name": "SRI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC4-1", "protein_name": "Osteopetrosis-associated transmembrane protein 1", "gene_name": "OSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAV4-1", "protein_name": "Stomatin-like protein 3", "gene_name": "STOML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13061-1", "protein_name": "Triadin", "gene_name": "TRDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D8-1", "protein_name": "Protein unc-79 homolog", "gene_name": "UNC79", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSA4-1", "protein_name": "Protein tweety homolog 2", "gene_name": "TTYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFU0-1", "protein_name": "Bestrophin-4", "gene_name": "BEST4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ55-1", "protein_name": "Barttin", "gene_name": "BSND", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51793-1", "protein_name": "H(+)/Cl(-) exchange transporter 4", "gene_name": "CLCN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51790-1", "protein_name": "H(+)/Cl(-) exchange transporter 3", "gene_name": "CLCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51795-2", "protein_name": "H(+)/Cl(-) exchange transporter 5", "gene_name": "CLCN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51801-1", "protein_name": "Chloride channel protein ClC-Kb", "gene_name": "CLCNKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CN2-1", "protein_name": "Calcium-activated chloride channel regulator 4", "gene_name": "CLCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC9-1", "protein_name": "Calcium-activated chloride channel regulator 2", "gene_name": "CLCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULQ1-1", "protein_name": "Two pore channel protein 1", "gene_name": "TPCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHX9-1", "protein_name": "Two pore channel protein 2", "gene_name": "TPCN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00476-1", "protein_name": "Sodium-dependent phosphate transport protein 4", "gene_name": "SLC17A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51168-1", "protein_name": "Epithelial sodium channel subunit beta", "gene_name": "SCNN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21817-1", "protein_name": "Ryanodine receptor 1", "gene_name": "RYR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2C7-1", "protein_name": "Protein unc-80 homolog", "gene_name": "UNC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZF0-1", "protein_name": "Sodium leak channel NALCN", "gene_name": "NALCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04049-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "RAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37088", "url": "https://www.uniprot.org/uniprotkb/P37088" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18449189", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 78 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]