[ { "title": "CNTN6 copy number variations: Uncertain clinical significance in individuals with neurodevelopmental disorders.", "journal": "European journal of medical genetics", "date": "2020", "authors": "Repnikova EA, Lyalin DA, McDonald K, Astbury C, Hansen-Kiss E, Cooley LD, Pfau R, Herman GE, Pyatt RE, Hickey SE", "reference": { "type": "PubMed", "id": "30836150", "url": "https://pubmed.ncbi.nlm.nih.gov/30836150" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UQ52-1", "protein_name": "Contactin-6", "gene_name": "CNTN6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UQ52", "url": "https://www.uniprot.org/uniprotkb/Q9UQ52" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30836150", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Contactin 6, A Novel Causative Gene for Congenital Hypothyroidism, Mediates Thyroid Hormone Biosynthesis Through Notch Signaling.", "journal": "Thyroid : official journal of the American Thyroid Association", "date": "2024-03", "authors": "Zhang Hai-Yang, Wu Feng-Yao, Zhang Cao-Xu, Wu Chen-Yang, Cui Ren-Jie, Liu Xiao-Yu, Yang Liu, Zhang Yue, Sun Feng, Cheng Feng, Yang Rui-Meng, Song Huai-Dong, Zhao Shuang-Xia", "reference": { "type": "PubMed", "id": "38183624", "url": "https://pubmed.ncbi.nlm.nih.gov/38183624" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UQ52-1", "protein_name": "Contactin-6", "gene_name": "CNTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9JMB8-1", "protein_name": "Contactin-6", "gene_name": "Cntn6", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UQ52", "url": "https://www.uniprot.org/uniprotkb/Q9UQ52" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38183624", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA cloning and chromosomal localization of neural adhesion molecule, NB-3 in human.", "journal": "J. Neurosci. Res.", "date": "1998", "authors": "Kamei Y, Tsutsumi O, Taketani Y, Watanabe K", "reference": { "type": "PubMed", "id": "9486763", "url": "https://pubmed.ncbi.nlm.nih.gov/9486763" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UQ52-1", "protein_name": "Contactin-6", "gene_name": "CNTN6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UQ52", "url": "https://www.uniprot.org/uniprotkb/Q9UQ52" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9486763", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The conserved mitochondrial twin Cx9C protein Cmc2 Is a Cmc1 homologue essential for cytochrome c oxidase biogenesis.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Horn D, Zhou W, Trevisson E, Al-Ali H, Harris TK, Salviati L, Barrientos A", "reference": { "type": "PubMed", "id": "20220131", "url": "https://pubmed.ncbi.nlm.nih.gov/20220131" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NRP2-1", "protein_name": "COX assembly mitochondrial protein 2 homolog", "gene_name": "CMC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36064-1", "protein_name": "COX assembly mitochondrial protein", "gene_name": "CMC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q3E7A4-1", "protein_name": "COX assembly mitochondrial protein 2", "gene_name": "CMC2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NRP2", "url": "https://www.uniprot.org/uniprotkb/Q9NRP2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20220131", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A new inborn error of glycosylation due to a Cog8 deficiency reveals a critical role for the Cog1-Cog8 interaction in COG complex formation.", "journal": "Human molecular genetics", "date": "2007-04-01", "authors": "Foulquier Fran\u00e7ois, Ungar Daniel, Reynders Ellen, Zeevaert Renate, Mills Philippa, Garc\u00eda-Silva Maria Teresa, Briones Paz, Winchester Bryan, Morelle Willy, Krieger Monty, Annaert Willem, Matthijs Gert", "reference": { "type": "PubMed", "id": "17220172", "url": "https://pubmed.ncbi.nlm.nih.gov/17220172" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MW5", "url": "https://www.uniprot.org/uniprotkb/Q96MW5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs121434387", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121434387" }, { "id": "rs121434387", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs121434387" }, { "id": "rs121434387", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121434387" }, { "id": "rs121434387", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs121434387" }, { "id": "17220172", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17220172" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 537, "end_pos": 537, "sequence_org": "Y", "sequence_mut": "*", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, cogs.", "chr_id": "16", "chr_pos": "69331067", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y537", "disease": [ { "disease_id": "DOID:0070260", "recommended_name": { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "congenital disorder of glycosylation type IIh", "description": "A congenital disorder of glycosylation type II that has_material_basis_in a mutation of the COG8 gene on chromosome 16q22.1." }, "synonyms": [ { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "CDG IIh", "description": "" }, { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "CDG2H", "description": "" }, { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "COG8-CDG", "description": "" }, { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "Congenital disorder of glycosylation type 2h", "description": "" }, { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "Carbohydrate deficient glycoprotein syndrome type IIh", "description": "" }, { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "CDGIIh", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "COG8-congenital disorder of glycosylation", "description": "The CDG (Congenital Disorders of Glycosylation) syndromes are a group of autosomal recessive disorders affecting glycoprotein synthesis. CDG syndrome type IIh is characterized by severe psychomotor retardation, failure to thrive and intolerance to wheat and dairy products." }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "CDG syndrome type IIh", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "CDG-IIh", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "CDG2H", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "COG8-CDG", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "COG8-congenital disorder of glycosylation", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "carbohydrate deficient glycoprotein syndrome type IIh", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "congenital disorder of glycosylation type 2h", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "congenital disorder of glycosylation type IIh", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "COG8-CDG (CDG-IIh)", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "congenital disorder of glycosylation, type IIh", "description": "" }, { "id": "MIM:611182", "resource": "MIM", "url": "https://www.omim.org/entry/611182", "name": "Congenital disorder of glycosylation 2H", "description": "Congenital disorder of glycosylation 2H" } ], "unlinked_id_list": [], "evidence": [ { "id": "0012635", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635" }, { "id": "611182", "database": "MIM", "url": "https://www.omim.org/entry/611182" }, { "id": "COG8", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/COG8/#!details" }, { "id": "84342", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/84342#disease" }, { "id": "0070260", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070260" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000000100.00000000000000.000000000001000000.00001.10.000.001", "uniprot_canonical_ac": "Q96MW5-1" } ], "record_id": "pubmed.17220172", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "COG8 deficiency causes new congenital disorder of glycosylation type IIh.", "journal": "Hum. Mol. Genet.", "date": "2007", "authors": "Kranz Christian, Ng Bobby G, Sun Liangwu, Sharma Vandana, Eklund Erik A, Miura Yoshiaki, Ungar Daniel, Lupashin Vladimir, Winkel R Dennis, Cipollo John F, Costello Catherine E, Loh Eva, Hong Wanjin, Freeze Hudson H", "reference": { "type": "PubMed", "id": "17331980", "url": "https://pubmed.ncbi.nlm.nih.gov/17331980" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MW5", "url": "https://www.uniprot.org/uniprotkb/Q96MW5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs766244312", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766244312" }, { "id": "17331980", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17331980" } ], "glycoeffect": [], "start_pos": 563, "end_pos": 563, "sequence_org": "F", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, cogs.", "chr_id": "16", "chr_pos": "69330992_69330993", "ref_nt": "l", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "F563", "disease": [ { "disease_id": "DOID:0070260", "recommended_name": { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "congenital disorder of glycosylation type IIh", "description": "A congenital disorder of glycosylation type II that has_material_basis_in a mutation of the COG8 gene on chromosome 16q22.1." }, "synonyms": [ { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "CDG IIh", "description": "" }, { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "CDG2H", "description": "" }, { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "COG8-CDG", "description": "" }, { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "Congenital disorder of glycosylation type 2h", "description": "" }, { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "Carbohydrate deficient glycoprotein syndrome type IIh", "description": "" }, { "id": "DOID:0070260", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070260", "name": "CDGIIh", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "COG8-congenital disorder of glycosylation", "description": "The CDG (Congenital Disorders of Glycosylation) syndromes are a group of autosomal recessive disorders affecting glycoprotein synthesis. CDG syndrome type IIh is characterized by severe psychomotor retardation, failure to thrive and intolerance to wheat and dairy products." }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "CDG syndrome type IIh", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "CDG-IIh", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "CDG2H", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "COG8-CDG", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "COG8-congenital disorder of glycosylation", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "carbohydrate deficient glycoprotein syndrome type IIh", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "congenital disorder of glycosylation type 2h", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "congenital disorder of glycosylation type IIh", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "COG8-CDG (CDG-IIh)", "description": "" }, { "id": "MONDO:0012635", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635", "name": "congenital disorder of glycosylation, type IIh", "description": "" }, { "id": "MIM:611182", "resource": "MIM", "url": "https://www.omim.org/entry/611182", "name": "Congenital disorder of glycosylation 2H", "description": "Congenital disorder of glycosylation 2H" } ], "unlinked_id_list": [], "evidence": [ { "id": "0012635", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012635" }, { "id": "611182", "database": "MIM", "url": "https://www.omim.org/entry/611182" }, { "id": "COG8", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/COG8/#!details" }, { "id": "84342", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/84342#disease" }, { "id": "0070260", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070260" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000010000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q96MW5-1" } ], "record_id": "pubmed.17331980", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Further delineation of COG8-CDG: A case with novel compound heterozygous mutations diagnosed by targeted exome sequencing.", "journal": "Clinica chimica acta; international journal of clinical chemistry", "date": "2017", "authors": "Yang A, Cho SY, Jang JH, Kim J, Kim SZ, Lee BH, Yoo HW, Jin DK", "reference": { "type": "PubMed", "id": "28619360", "url": "https://pubmed.ncbi.nlm.nih.gov/28619360" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MW5", "url": "https://www.uniprot.org/uniprotkb/Q96MW5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28619360", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Membrane detachment is not essential for COG complex function.", "journal": "Molecular biology of the cell", "date": "2018", "authors": "Climer LK, Pokrovskaya ID, Blackburn JB, Lupashin VV", "reference": { "type": "PubMed", "id": "29467253", "url": "https://pubmed.ncbi.nlm.nih.gov/29467253" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MW5", "url": "https://www.uniprot.org/uniprotkb/Q96MW5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29467253", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence alterations within CYP7B1 implicate defective cholesterol homeostasis in motor-neuron degeneration.", "journal": "American journal of human genetics", "date": "2008", "authors": "Tsaousidou MK, Ouahchi K, Warner TT, Yang Y, Simpson MA, Laing NG, Wilkinson PA, Madrid RE, Patel H, Hentati F, Patton MA, Hentati A, Lamont PJ, Siddique T, Crosby AH", "reference": { "type": "PubMed", "id": "18252231", "url": "https://pubmed.ncbi.nlm.nih.gov/18252231" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75881-1", "protein_name": "Cytochrome P450 7B1", "gene_name": "CYP7B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75881", "url": "https://www.uniprot.org/uniprotkb/O75881" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18252231", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of CYP7B1 in non-consanguineous cases of hereditary spastic paraplegia.", "journal": "Neurogenetics", "date": "2009", "authors": "Schule R, Brandt E, Karle KN, Tsaousidou M, Klebe S, Klimpe S, Auer-Grumbach M, Crosby AH, Hubner CA, Schols L, Deufel T, Beetz C", "reference": { "type": "PubMed", "id": "18855023", "url": "https://pubmed.ncbi.nlm.nih.gov/18855023" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75881-1", "protein_name": "Cytochrome P450 7B1", "gene_name": "CYP7B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75881", "url": "https://www.uniprot.org/uniprotkb/O75881" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18855023", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CYP7B1 mutations in pure and complex forms of hereditary spastic paraplegia type 5.", "journal": "Brain : a journal of neurology", "date": "2009", "authors": "Goizet C, Boukhris A, Durr A, Beetz C, Truchetto J, Tesson C, Tsaousidou M, Forlani S, Guyant-Marechal L, Fontaine B, Guimaraes J, Isidor B, Chazouilleres O, Wendum D, Grid D, Chevy F, Chinnery PF, Coutinho P, Azulay JP, Feki I, Mochel F, Wolf C, Mhiri C, Crosby A, Brice A, Stevanin G", "reference": { "type": "PubMed", "id": "19439420", "url": "https://pubmed.ncbi.nlm.nih.gov/19439420" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75881-1", "protein_name": "Cytochrome P450 7B1", "gene_name": "CYP7B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75881", "url": "https://www.uniprot.org/uniprotkb/O75881" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19439420", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clinical phenotype variability in patients with hereditary spastic paraplegia type 5 associated with CYP7B1 mutations.", "journal": "Clinical genetics", "date": "2012", "authors": "Arnoldi A, Crimella C, Tenderini E, Martinuzzi A, D'Angelo MG, Musumeci O, Toscano A, Scarlato M, Fantin M, Bresolin N, Bassi MT", "reference": { "type": "PubMed", "id": "21214876", "url": "https://pubmed.ncbi.nlm.nih.gov/21214876" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75881-1", "protein_name": "Cytochrome P450 7B1", "gene_name": "CYP7B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75881", "url": "https://www.uniprot.org/uniprotkb/O75881" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21214876", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CYP7B1: novel mutations and magnetic resonance spectroscopy abnormalities in hereditary spastic paraplegia type 5A.", "journal": "Acta neurologica Scandinavica", "date": "2014", "authors": "Roos P, Svenstrup K, Danielsen ER, Thomsen C, Nielsen JE", "reference": { "type": "PubMed", "id": "24117163", "url": "https://pubmed.ncbi.nlm.nih.gov/24117163" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75881-1", "protein_name": "Cytochrome P450 7B1", "gene_name": "CYP7B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75881", "url": "https://www.uniprot.org/uniprotkb/O75881" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24117163", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human steroid and oxysterol 7\u03b1-hydroxylase CYP7B1: substrate specificity, azole binding and misfolding of clinically relevant mutants.", "journal": "The FEBS journal", "date": "2014-03", "authors": "Yantsevich Aleksei V, Dichenko Yaroslav V, Mackenzie Farrell, Mukha Dmitry V, Baranovsky Alexander V, Gilep Andrei A, Usanov Sergey A, Strushkevich Natallia V", "reference": { "type": "PubMed", "id": "24491228", "url": "https://pubmed.ncbi.nlm.nih.gov/24491228" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75881-1", "protein_name": "Cytochrome P450 7B1", "gene_name": "CYP7B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75881", "url": "https://www.uniprot.org/uniprotkb/O75881" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24491228", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutational analysis of the CYP7B1, PNPLA6 and C19orf12 genes in autosomal recessive hereditary spastic paraplegia.", "journal": "Molecular and cellular probes", "date": "2016", "authors": "Schubert SF, Hoffjan S, Dekomien G", "reference": { "type": "PubMed", "id": "26714052", "url": "https://pubmed.ncbi.nlm.nih.gov/26714052" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75881-1", "protein_name": "Cytochrome P450 7B1", "gene_name": "CYP7B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75881", "url": "https://www.uniprot.org/uniprotkb/O75881" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26714052", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic and phenotypic characterization of complex hereditary spastic paraplegia.", "journal": "Brain : a journal of neurology", "date": "2016", "authors": "Kara E, Tucci A, Manzoni C, Lynch DS, Elpidorou M, Bettencourt C, Chelban V, Manole A, Hamed SA, Haridy NA, Federoff M, Preza E, Hughes D, Pittman A, Jaunmuktane Z, Brandner S, Xiromerisiou G, Wiethoff S, Schottlaender L, Proukakis C, Morris H, Warner T, Bhatia KP, Korlipara LV, Singleton AB, Hardy J, Wood NW, Lewis PA, Houlden H", "reference": { "type": "PubMed", "id": "27217339", "url": "https://pubmed.ncbi.nlm.nih.gov/27217339" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75881-1", "protein_name": "Cytochrome P450 7B1", "gene_name": "CYP7B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ90-1", "protein_name": "Mitochondrial inner membrane m-AAA protease component paraplegin", "gene_name": "SPG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JI7-1", "protein_name": "Spatacsin", "gene_name": "SPG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ11-1", "protein_name": "Polyamine-transporting ATPase 13A2", "gene_name": "ATP13A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75881", "url": "https://www.uniprot.org/uniprotkb/O75881" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27217339", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The effect of CYP7B1 polymorphisms on the risk of coronary heart disease in Hainan Han population.", "journal": "BMC medical genomics", "date": "2021-09-07", "authors": "Liang Tiebiao, Zhang Xianbo, Liang Anshan, Wu Haiqing, Wang Qi, He Jun, Long Ming, Jin Tianbo", "reference": { "type": "PubMed", "id": "34493281", "url": "https://pubmed.ncbi.nlm.nih.gov/34493281" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75881-1", "protein_name": "Cytochrome P450 7B1", "gene_name": "CYP7B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75881", "url": "https://www.uniprot.org/uniprotkb/O75881" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34493281", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phenoconversion from Spastic Paraplegia to ALS/FTD Associated with CYP7B1 Compound Heterozygous Mutations.", "journal": "Genes", "date": "2021", "authors": "Theuriet J, Pegat A, Leblanc P, Vukusic S, Cazeneuve C, Millecamps S, Banneau G, Guillaud-Bataille M, Bernard E", "reference": { "type": "PubMed", "id": "34946825", "url": "https://pubmed.ncbi.nlm.nih.gov/34946825" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75881-1", "protein_name": "Cytochrome P450 7B1", "gene_name": "CYP7B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75881", "url": "https://www.uniprot.org/uniprotkb/O75881" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34946825", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a new inborn error in bile acid synthesis: mutation of the oxysterol 7alpha-hydroxylase gene causes severe neonatal liver disease.", "journal": "The Journal of clinical investigation", "date": "1998", "authors": "Setchell KD, Schwarz M, O'Connell NC, Lund EG, Davis DL, Lathe R, Thompson HR, Weslie Tyson R, Sokol RJ, Russell DW", "reference": { "type": "PubMed", "id": "9802883", "url": "https://pubmed.ncbi.nlm.nih.gov/9802883" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75881-1", "protein_name": "Cytochrome P450 7B1", "gene_name": "CYP7B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75881", "url": "https://www.uniprot.org/uniprotkb/O75881" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9802883", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human NB-2 of the contactin subgroup molecules: chromosomal localization of the gene (CNTN5) and distinct expression pattern from other subgroup members.", "journal": "Genomics", "date": "2000", "authors": "Kamei Y, Takeda Y, Teramoto K, Tsutsumi O, Taketani Y, Watanabe K", "reference": { "type": "PubMed", "id": "11013081", "url": "https://pubmed.ncbi.nlm.nih.gov/11013081" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94779-1", "protein_name": "Contactin-5", "gene_name": "CNTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P232-1", "protein_name": "Contactin-3", "gene_name": "CNTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWV2-1", "protein_name": "Contactin-4", "gene_name": "CNTN4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94779", "url": "https://www.uniprot.org/uniprotkb/O94779" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11013081", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Framingham Heart Study 100K project: genome-wide associations for cardiovascular disease outcomes.", "journal": "BMC medical genetics", "date": "2007", "authors": "Larson MG, Atwood LD, Benjamin EJ, Cupples LA, D'Agostino RB Sr, Fox CS, Govindaraju DR, Guo CY, Heard-Costa NL, Hwang SJ, Murabito JM, Newton-Cheh C, O'Donnell CJ, Seshadri S, Vasan RS, Wang TJ, Wolf PA, Levy D", "reference": { "type": "PubMed", "id": "17903304", "url": "https://pubmed.ncbi.nlm.nih.gov/17903304" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94779-1", "protein_name": "Contactin-5", "gene_name": "CNTN5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94779", "url": "https://www.uniprot.org/uniprotkb/O94779" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17903304", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of rs1568885, rs1813443 and rs4411591 polymorphisms with anti-TNF medication response in Greek patients with Crohn's disease.", "journal": "World journal of gastroenterology", "date": "2014", "authors": "Thomas D, Gazouli M, Karantanos T, Rigoglou S, Karamanolis G, Bramis K, Zografos G, Theodoropoulos GE", "reference": { "type": "PubMed", "id": "24707144", "url": "https://pubmed.ncbi.nlm.nih.gov/24707144" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94779-1", "protein_name": "Contactin-5", "gene_name": "CNTN5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94779", "url": "https://www.uniprot.org/uniprotkb/O94779" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24707144", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CNTN5(-)(/+)or EHMT2(-)(/+)human iPSC-derived neurons from individuals with autism develop hyperactive neuronal networks.", "journal": "eLife", "date": "2019", "authors": "Deneault E, Faheem M, White SH, Rodrigues DC, Sun S, Wei W, Piekna A, Thompson T, Howe JL, Chalil L, Kwan V, Walker S, Pasceri P, Roth FP, Yuen RK, Singh KK, Ellis J, Scherer SW", "reference": { "type": "PubMed", "id": "30747104", "url": "https://pubmed.ncbi.nlm.nih.gov/30747104" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94779-1", "protein_name": "Contactin-5", "gene_name": "CNTN5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94779", "url": "https://www.uniprot.org/uniprotkb/O94779" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30747104", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide association study revealed novel loci which aggravate asymptomatic hyperuricaemia into gout.", "journal": "Annals of the rheumatic diseases", "date": "2019", "authors": "Kawamura Y, Nakaoka H, Nakayama A, Okada Y, Yamamoto K, Higashino T, Sakiyama M, Shimizu T, Ooyama H, Ooyama K, Nagase M, Hidaka Y, Shirahama Y, Hosomichi K, Nishida Y, Shimoshikiryo I, Hishida A, Katsuura-Kamano S, Shimizu S, Kawaguchi M, Uemura H, Ibusuki R, Hara M, Naito M, Takao M, Nakajima M, Iwasawa S, Nakashima H, Ohnaka K, Nakamura T, Stiburkova B, Merriman TR, Nakatochi M, Ichihara S, Yokota M, Takada T, Saitoh T, Kamatani Y, Takahashi A, Arisawa K, Takezaki T, Tanaka K, Wakai K, Kubo M, Hosoya T, Ichida K, Inoue I, Shinomiya N, Matsuo H", "reference": { "type": "PubMed", "id": "31289104", "url": "https://pubmed.ncbi.nlm.nih.gov/31289104" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94779-1", "protein_name": "Contactin-5", "gene_name": "CNTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MTY0-1", "protein_name": "Zinc finger protein 724", "gene_name": "ZNF724", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94779", "url": "https://www.uniprot.org/uniprotkb/O94779" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31289104", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the contactin 5 protein and its risk-associated polymorphic variant throughout the Alzheimer's disease spectrum.", "journal": "Alzheimer's & dementia : the journal of the Alzheimer's Association", "date": "2023-07", "authors": "Dauar Marina Tedeschi, Labont\u00e9 Anne, Picard Cynthia, Miron Justin, Rosa-Neto Pedro, Zetterberg Henrik, Blennow Kaj, Villeneuve Sylvia, Poirier Judes", "reference": { "type": "PubMed", "id": "36583624", "url": "https://pubmed.ncbi.nlm.nih.gov/36583624" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94779-1", "protein_name": "Contactin-5", "gene_name": "CNTN5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94779", "url": "https://www.uniprot.org/uniprotkb/O94779" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36583624", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel family of calmodulin-binding transcription activators in multicellular organisms.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Bouche N, Scharlat A, Snedden W, Bouchez D, Fromm H", "reference": { "type": "PubMed", "id": "11925432", "url": "https://pubmed.ncbi.nlm.nih.gov/11925432" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94983-1", "protein_name": "Calmodulin-binding transcription activator 2", "gene_name": "CAMTA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9FYG2-1", "protein_name": "Calmodulin-binding transcription activator 4", "gene_name": "CAMTA4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9Y6Y1-1", "protein_name": "Calmodulin-binding transcription activator 1", "gene_name": "CAMTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O23463-1", "protein_name": "Calmodulin-binding transcription activator 5", "gene_name": "CAMTA5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GSA7-1", "protein_name": "Calmodulin-binding transcription activator 3", "gene_name": "CAMTA3; SR1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FY74-1", "protein_name": "Calmodulin-binding transcription activator 1", "gene_name": "CAMTA1; EICBPB", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LSP8-1", "protein_name": "Calmodulin-binding transcription activator 6", "gene_name": "CAMTA6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NPP4-1", "protein_name": "Calmodulin-binding transcription activator 2", "gene_name": "CAMTA2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94983", "url": "https://www.uniprot.org/uniprotkb/O94983" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11925432", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell cycle-dependent transcriptional regulation of calmodulin-binding transcription activator 1 in neuroblastoma cells.", "journal": "Int. J. Oncol.", "date": "2004", "authors": "Nakatani Kaname, Nishioka Junji, Itakura Tatsuo, Nakanishi Yoshio, Horinouchi Jun-Ichi, Abe Yasunori, Wada Hideo, Nobori Tsutomu", "reference": { "type": "PubMed", "id": "15138581", "url": "https://pubmed.ncbi.nlm.nih.gov/15138581" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94983-1", "protein_name": "Calmodulin-binding transcription activator 2", "gene_name": "CAMTA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y1-1", "protein_name": "Calmodulin-binding transcription activator 1", "gene_name": "CAMTA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94983", "url": "https://www.uniprot.org/uniprotkb/O94983" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15138581", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a novel genetic locus underlying tremor and dystonia.", "journal": "Human genomics", "date": "2017", "authors": "Monies D, Abou Al-Shaar H, Goljan EA, Al-Younes B, Al-Breacan MMA, Al-Saif MM, Wakil SM, Meyer BF, Khabar KSA, Bohlega S", "reference": { "type": "PubMed", "id": "29110692", "url": "https://pubmed.ncbi.nlm.nih.gov/29110692" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94983-1", "protein_name": "Calmodulin-binding transcription activator 2", "gene_name": "CAMTA2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94983", "url": "https://www.uniprot.org/uniprotkb/O94983" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29110692", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell specific transformation by c-fms activating loop mutations is attributable to constitutive receptor degradation.", "journal": "Oncogene", "date": "1999", "authors": "Morley GM, Uden M, Gullick WJ, Dibb NJ", "reference": { "type": "PubMed", "id": "10340379", "url": "https://pubmed.ncbi.nlm.nih.gov/10340379" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 708, "end_pos": 708, "sequence_org": "Y", "sequence_mut": "F", "comment": "Impairs degradation of activated CSF1R.", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "PubMed", "id": "10340379", "url": "https://pubmed.ncbi.nlm.nih.gov/10340379" } ], "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 802, "end_pos": 802, "sequence_org": "D", "sequence_mut": "V", "comment": "Constitutive kinase activity. Loss of inhibition by imatinib.", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "PubMed", "id": "16170366", "url": "https://pubmed.ncbi.nlm.nih.gov/16170366" }, { "database": "PubMed", "id": "10340379", "url": "https://pubmed.ncbi.nlm.nih.gov/10340379" } ], "uniprot_canonical_ac": "P07333-1" } ], "record_id": "pubmed.10340379", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutational analysis of class III receptor tyrosine kinases (C-KIT, C-FMS, FLT3) in idiopathic myelofibrosis.", "journal": "British journal of haematology", "date": "2003", "authors": "Abu-Duhier FM, Goodeve AC, Care RS, Gari M, Wilson GA, Peake IR, Reilly JT", "reference": { "type": "PubMed", "id": "12580961", "url": "https://pubmed.ncbi.nlm.nih.gov/12580961" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10721-1", "protein_name": "Mast/stem cell growth factor receptor Kit", "gene_name": "KIT", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12580961", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autocrine CSF-1R activation promotes Src-dependent disruption of mammary epithelial architecture.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Wrobel CN, Debnath J, Lin E, Beausoleil S, Roussel MF, Brugge JS", "reference": { "type": "PubMed", "id": "15117969", "url": "https://pubmed.ncbi.nlm.nih.gov/15117969" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 301, "end_pos": 301, "sequence_org": "L", "sequence_mut": "S", "comment": "Constitutive kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "PubMed", "id": "15117969", "url": "https://pubmed.ncbi.nlm.nih.gov/15117969" } ], "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 969, "end_pos": 969, "sequence_org": "Y", "sequence_mut": "F", "comment": "Abolishes down-regulation of activated CSF1R.", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "PubMed", "id": "15117969", "url": "https://pubmed.ncbi.nlm.nih.gov/15117969" } ], "uniprot_canonical_ac": "P07333-1" } ], "phosphorylation": [ { "start_pos": 419, "end_pos": 419, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FAK2", "evidence": [ { "database": "UniProtKB", "id": "P12931", "url": "https://www.uniprot.org/uniprotkb/P12931" }, { "database": "IntAct", "id": "P12931", "url": "https://www.ebi.ac.uk/intact/interactors/id:P12931*" }, { "database": "iPTMnet", "id": "P12931", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12931" }, { "database": "PubMed", "id": "11007774", "url": "https://pubmed.ncbi.nlm.nih.gov/11007774" }, { "database": "PRO", "id": "P12931", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P12931" }, { "database": "PubMed", "id": "8789131", "url": "https://pubmed.ncbi.nlm.nih.gov/8789131" }, { "database": "PubMed", "id": "12509223", "url": "https://pubmed.ncbi.nlm.nih.gov/12509223" }, { "database": "PubMed", "id": "15117969", "url": "https://pubmed.ncbi.nlm.nih.gov/15117969" }, { "database": "PubMed", "id": "15489898", "url": "https://pubmed.ncbi.nlm.nih.gov/15489898" }, { "database": "PubMed", "id": "17148760", "url": "https://pubmed.ncbi.nlm.nih.gov/17148760" }, { "database": "PubMed", "id": "18198129", "url": "https://pubmed.ncbi.nlm.nih.gov/18198129" }, { "database": "PubMed", "id": "19212436", "url": "https://pubmed.ncbi.nlm.nih.gov/19212436" }, { "database": "PubMed", "id": "19602594", "url": "https://pubmed.ncbi.nlm.nih.gov/19602594" }, { "database": "PubMed", "id": "19878566", "url": "https://pubmed.ncbi.nlm.nih.gov/19878566" }, { "database": "PubMed", "id": "20501847", "url": "https://pubmed.ncbi.nlm.nih.gov/20501847" }, { "database": "PubMed", "id": "20565769", "url": "https://pubmed.ncbi.nlm.nih.gov/20565769" }, { "database": "PubMed", "id": "20863376", "url": "https://pubmed.ncbi.nlm.nih.gov/20863376" }, { "database": "PubMed", "id": "21636306", "url": "https://pubmed.ncbi.nlm.nih.gov/21636306" }, { "database": "PubMed", "id": "22761868", "url": "https://pubmed.ncbi.nlm.nih.gov/22761868" }, { "database": "PubMed", "id": "22848421", "url": "https://pubmed.ncbi.nlm.nih.gov/22848421" }, { "database": "PubMed", "id": "23360994", "url": "https://pubmed.ncbi.nlm.nih.gov/23360994" }, { "database": "PubMed", "id": "24632723", "url": "https://pubmed.ncbi.nlm.nih.gov/24632723" }, { "database": "PubMed", "id": "24810047", "url": "https://pubmed.ncbi.nlm.nih.gov/24810047" }, { "database": "PubMed", "id": "25339152", "url": "https://pubmed.ncbi.nlm.nih.gov/25339152" }, { "database": "PubMed", "id": "25585026", "url": "https://pubmed.ncbi.nlm.nih.gov/25585026" }, { "database": "PubMed", "id": "25644401", "url": "https://pubmed.ncbi.nlm.nih.gov/25644401" }, { "database": "PubMed", "id": "25672415", "url": "https://pubmed.ncbi.nlm.nih.gov/25672415" }, { "database": "PubMed", "id": "25751262", "url": "https://pubmed.ncbi.nlm.nih.gov/25751262" }, { "database": "PubMed", "id": "25779657", "url": "https://pubmed.ncbi.nlm.nih.gov/25779657" }, { "database": "PubMed", "id": "26091350", "url": "https://pubmed.ncbi.nlm.nih.gov/26091350" }, { "database": "PubMed", "id": "26234813", "url": "https://pubmed.ncbi.nlm.nih.gov/26234813" }, { "database": "PubMed", "id": "26453921", "url": "https://pubmed.ncbi.nlm.nih.gov/26453921" }, { "database": "PubMed", "id": "26923594", "url": "https://pubmed.ncbi.nlm.nih.gov/26923594" }, { "database": "PubMed", "id": "26984511", "url": "https://pubmed.ncbi.nlm.nih.gov/26984511" }, { "database": "PubMed", "id": "27105527", "url": "https://pubmed.ncbi.nlm.nih.gov/27105527" }, { "database": "PubMed", "id": "27166196", "url": "https://pubmed.ncbi.nlm.nih.gov/27166196" }, { "database": "PubMed", "id": "27391433", "url": "https://pubmed.ncbi.nlm.nih.gov/27391433" }, { "database": "PubMed", "id": "28141839", "url": "https://pubmed.ncbi.nlm.nih.gov/28141839" }, { "database": "PubMed", "id": "28656243", "url": "https://pubmed.ncbi.nlm.nih.gov/28656243" }, { "database": "PubMed", "id": "29069627", "url": "https://pubmed.ncbi.nlm.nih.gov/29069627" }, { "database": "PubMed", "id": "29190494", "url": "https://pubmed.ncbi.nlm.nih.gov/29190494" }, { "database": "PubMed", "id": "29844682", "url": "https://pubmed.ncbi.nlm.nih.gov/29844682" }, { "database": "PubMed", "id": "29954829", "url": "https://pubmed.ncbi.nlm.nih.gov/29954829" }, { "database": "PubMed", "id": "30304684", "url": "https://pubmed.ncbi.nlm.nih.gov/30304684" }, { "database": "PubMed", "id": "30341294", "url": "https://pubmed.ncbi.nlm.nih.gov/30341294" }, { "database": "PubMed", "id": "31428570", "url": "https://pubmed.ncbi.nlm.nih.gov/31428570" }, { "database": "PubMed", "id": "31671408", "url": "https://pubmed.ncbi.nlm.nih.gov/31671408" }, { "database": "PubMed", "id": "31827720", "url": "https://pubmed.ncbi.nlm.nih.gov/31827720" }, { "database": "PubMed", "id": "32098194", "url": "https://pubmed.ncbi.nlm.nih.gov/32098194" }, { "database": "PubMed", "id": "32792487", "url": "https://pubmed.ncbi.nlm.nih.gov/32792487" }, { "database": "PubMed", "id": "32839549", "url": "https://pubmed.ncbi.nlm.nih.gov/32839549" }, { "database": "PubMed", "id": "32876513", "url": "https://pubmed.ncbi.nlm.nih.gov/32876513" }, { "database": "PubMed", "id": "32977471", "url": "https://pubmed.ncbi.nlm.nih.gov/32977471" }, { "database": "PubMed", "id": "32981934", "url": "https://pubmed.ncbi.nlm.nih.gov/32981934" }, { "database": "PubMed", "id": "33112055", "url": "https://pubmed.ncbi.nlm.nih.gov/33112055" }, { "database": "PubMed", "id": "33503805", "url": "https://pubmed.ncbi.nlm.nih.gov/33503805" }, { "database": "PubMed", "id": "34335982", "url": "https://pubmed.ncbi.nlm.nih.gov/34335982" }, { "database": "PubMed", "id": "8755732", "url": "https://pubmed.ncbi.nlm.nih.gov/8755732" }, { "database": "PubMed", "id": "18936167", "url": "https://pubmed.ncbi.nlm.nih.gov/18936167" }, { "database": "PubMed", "id": "19307596", "url": "https://pubmed.ncbi.nlm.nih.gov/19307596" }, { "database": "PubMed", "id": "25731159", "url": "https://pubmed.ncbi.nlm.nih.gov/25731159" }, { "database": "PubMed", "id": "26936507", "url": "https://pubmed.ncbi.nlm.nih.gov/26936507" }, { "database": "PubMed", "id": "6273838", "url": "https://pubmed.ncbi.nlm.nih.gov/6273838" } ], "site_lbl": "Tyr419", "uniprot_canonical_ac": "P12931-1" } ], "record_id": "pubmed.15117969", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CSF-1 regulation of the wandering macrophage: complexity in action.", "journal": "Trends Cell Biol.", "date": "2004", "authors": "Pixley Fiona J, Stanley E Richard", "reference": { "type": "PubMed", "id": "15519852", "url": "https://pubmed.ncbi.nlm.nih.gov/15519852" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15519852", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FMS receptor for M-CSF (CSF-1) is sensitive to the kinase inhibitor imatinib and mutation of Asp-802 to Val confers resistance.", "journal": "Oncogene", "date": "2006", "authors": "Taylor JR, Brownlow N, Domin J, Dibb NJ", "reference": { "type": "PubMed", "id": "16170366", "url": "https://pubmed.ncbi.nlm.nih.gov/16170366" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 802, "end_pos": 802, "sequence_org": "D", "sequence_mut": "V", "comment": "Constitutive kinase activity. Loss of inhibition by imatinib.", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "PubMed", "id": "16170366", "url": "https://pubmed.ncbi.nlm.nih.gov/16170366" }, { "database": "PubMed", "id": "10340379", "url": "https://pubmed.ncbi.nlm.nih.gov/10340379" } ], "uniprot_canonical_ac": "P07333-1" } ], "record_id": "pubmed.16170366", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Colony-stimulating factor-1 in immunity and inflammation.", "journal": "Current opinion in immunology", "date": "2006-02", "authors": "Chitu Violeta, Stanley E Richard", "reference": { "type": "PubMed", "id": "16337366", "url": "https://pubmed.ncbi.nlm.nih.gov/16337366" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16337366", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of phosphorylation of the colony-stimulating factor-1 receptor (c-Fms) tyrosine kinase in transfected cells by ABT-869 and other tyrosine kinase inhibitors.", "journal": "Molecular cancer therapeutics", "date": "2006-04", "authors": "Guo Jun, Marcotte Patrick A, McCall J Owen, Dai Yujia, Pease Lori J, Michaelides Michael R, Davidsen Steven K, Glaser Keith B", "reference": { "type": "PubMed", "id": "16648572", "url": "https://pubmed.ncbi.nlm.nih.gov/16648572" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16648572", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A c-fms tyrosine kinase inhibitor, Ki20227, suppresses osteoclast differentiation and osteolytic bone destruction in a bone metastasis model.", "journal": "Molecular cancer therapeutics", "date": "2006-11", "authors": "Ohno Hiroaki, Kubo Kazuo, Murooka Hideko, Kobayashi Yoshiko, Nishitoba Tsuyoshi, Shibuya Masabumi, Yoneda Toshiyuki, Isoe Toshiyuki", "reference": { "type": "PubMed", "id": "17121910", "url": "https://pubmed.ncbi.nlm.nih.gov/17121910" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00495-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "Csf1r", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17121910", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of the tyrosine kinase domain of colony-stimulating factor-1 receptor (cFMS) in complex with two inhibitors.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Schubert Carsten, Schalk-Hihi C\u00e9line, Struble Geoffrey T, Ma Hong-Chang, Petrounia Ioanna P, Brandt Benjamin, Deckman Ingrid C, Patch Raymond J, Player Mark R, Spurlino John C, Springer Barry A", "reference": { "type": "PubMed", "id": "17132624", "url": "https://pubmed.ncbi.nlm.nih.gov/17132624" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17132624", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The 2.7 A crystal structure of the autoinhibited human c-Fms kinase domain.", "journal": "J. Mol. Biol.", "date": "2007", "authors": "Walter Mark, Lucet Isabelle S, Patel Onisha, Broughton Sophie E, Bamert Rebecca, Williams Neal K, Fantino Emmanuelle, Wilks Andrew F, Rossjohn Jamie", "reference": { "type": "PubMed", "id": "17292918", "url": "https://pubmed.ncbi.nlm.nih.gov/17292918" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17292918", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Myc rescue of a mutant CSF-1 receptor impaired in mitogenic signalling.", "journal": "Nature", "date": "1991", "authors": "Roussel MF, Cleveland JL, Shurtleff SA, Sherr CJ", "reference": { "type": "PubMed", "id": "1833648", "url": "https://pubmed.ncbi.nlm.nih.gov/1833648" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 809, "end_pos": 809, "kinase_uniprot_canonical_ac": "P07333-1", "kinase_gene_name": "CSF1R", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "1833648", "url": "https://pubmed.ncbi.nlm.nih.gov/1833648" }, { "database": "PubMed", "id": "15297464", "url": "https://pubmed.ncbi.nlm.nih.gov/15297464" }, { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "PubMed", "id": "20489731", "url": "https://pubmed.ncbi.nlm.nih.gov/20489731" } ], "site_lbl": "Tyr809", "uniprot_canonical_ac": "P07333-1" } ], "record_id": "pubmed.1833648", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Design and synthesis of a pyrido[2,3-d]pyrimidin-5-one class of anti-inflammatory FMS inhibitors.", "journal": "Bioorg. Med. Chem. Lett.", "date": "2008", "authors": "Huang Hui, Hutta Daniel A, Hu Huaping, DesJarlais Renee L, Schubert Carsten, Petrounia Ioanna P, Chaikin Margery A, Manthey Carl L, Player Mark R", "reference": { "type": "PubMed", "id": "18342505", "url": "https://pubmed.ncbi.nlm.nih.gov/18342505" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18342505", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Macrophage colony stimulating factor: not just for macrophages anymore! A gateway into complex biologies.", "journal": "Int. Immunopharmacol.", "date": "2008", "authors": "Douglass Thomas G, Driggers Lara, Zhang Jian Gang, Hoa Neil, Delgado Christina, Williams Christopher C, Dan Qinhong, Sanchez Ramon, Jeffes Edward W B, Wepsic H Terry, Myers Michael P, Koths Kirston, Jadus Martin R", "reference": { "type": "PubMed", "id": "18687298", "url": "https://pubmed.ncbi.nlm.nih.gov/18687298" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18687298", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Blood monocytes: development, heterogeneity, and relationship with dendritic cells.", "journal": "Annu. Rev. Immunol.", "date": "2009", "authors": "Auffray Cedric, Sieweke Michael H, Geissmann Frederic", "reference": { "type": "PubMed", "id": "19132917", "url": "https://pubmed.ncbi.nlm.nih.gov/19132917" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19132917", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pyrido[2,3-d]pyrimidin-5-ones: a novel class of antiinflammatory macrophage colony-stimulating factor-1 receptor inhibitors.", "journal": "Journal of medicinal chemistry", "date": "2009-02-26", "authors": "Huang Hui, Hutta Daniel A, Rinker James M, Hu Huaping, Parsons William H, Schubert Carsten, DesJarlais Renee L, Crysler Carl S, Chaikin Margery A, Donatelli Robert R, Chen Yanmin, Cheng Deping, Zhou Zhao, Yurkow Edward, Manthey Carl L, Player Mark R", "reference": { "type": "PubMed", "id": "19193011", "url": "https://pubmed.ncbi.nlm.nih.gov/19193011" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19193011", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Invasion of human breast cancer cells in vivo requires both paracrine and autocrine loops involving the colony-stimulating factor-1 receptor.", "journal": "Cancer research", "date": "2009-12-15", "authors": "Patsialou Antonia, Wyckoff Jeffrey, Wang Yarong, Goswami Sumanta, Stanley E Richard, Condeelis John S", "reference": { "type": "PubMed", "id": "19934330", "url": "https://pubmed.ncbi.nlm.nih.gov/19934330" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19934330", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure-based drug design enables conversion of a DFG-in binding CSF-1R kinase inhibitor to a DFG-out binding mode.", "journal": "Bioorg. Med. Chem. Lett.", "date": "2010", "authors": "Meyers Marvin J, Pelc Matthew, Kamtekar Satwik, Day Jacqueline, Poda Gennadiy I, Hall Molly K, Michener Marshall L, Reitz Beverly A, Mathis Karl J, Pierce Betsy S, Parikh Mihir D, Mischke Deborah A, Long Scott A, Parlow John J, Anderson David R, Thorarensen Atli", "reference": { "type": "PubMed", "id": "20137931", "url": "https://pubmed.ncbi.nlm.nih.gov/20137931" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20137931", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Colony stimulating factor-1 receptor as a target for small molecule inhibitors.", "journal": "Bioorg. Med. Chem.", "date": "2010", "authors": "Mashkani Baratali, Griffith Renate, Ashman Leonie K", "reference": { "type": "PubMed", "id": "20156689", "url": "https://pubmed.ncbi.nlm.nih.gov/20156689" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20156689", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Macrophage-colony stimulating factor and interleukin-34 induce chemokines in human whole blood.", "journal": "Cytokine", "date": "2010-12", "authors": "Eda Hiroyuki, Zhang Jian, Keith Robert H, Michener Marshall, Beidler David R, Monahan Joseph B", "reference": { "type": "PubMed", "id": "20829061", "url": "https://pubmed.ncbi.nlm.nih.gov/20829061" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMJ4-1", "protein_name": "Interleukin-34", "gene_name": "IL34", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20829061", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Macrophage colony-stimulating factor and its receptor signaling augment glycated albumin-induced retinal microglial inflammation in vitro.", "journal": "BMC cell biology", "date": "2011", "authors": "Liu W, Xu GZ, Jiang CH, Tian J", "reference": { "type": "PubMed", "id": "21266043", "url": "https://pubmed.ncbi.nlm.nih.gov/21266043" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 723, "end_pos": 723, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "9191055", "url": "https://pubmed.ncbi.nlm.nih.gov/9191055" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "21266043", "url": "https://pubmed.ncbi.nlm.nih.gov/21266043" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" } ], "site_lbl": "Tyr723", "uniprot_canonical_ac": "P07333-1" } ], "record_id": "pubmed.21266043", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A point mutation at tyrosine-809 in the human colony-stimulating factor 1 receptor impairs mitogenesis without abrogating tyrosine kinase activity, association with phosphatidylinositol 3-kinase, or induction of c-fos and junB genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Roussel MF, Shurtleff SA, Downing JR, Sherr CJ", "reference": { "type": "PubMed", "id": "2168557", "url": "https://pubmed.ncbi.nlm.nih.gov/2168557" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 809, "end_pos": 809, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "7681396", "url": "https://pubmed.ncbi.nlm.nih.gov/7681396" }, { "database": "PubMed", "id": "2168557", "url": "https://pubmed.ncbi.nlm.nih.gov/2168557" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "31827782", "url": "https://pubmed.ncbi.nlm.nih.gov/31827782" } ], "site_lbl": "Tyr809", "uniprot_canonical_ac": "P07333-1" } ], "record_id": "pubmed.2168557", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the colony stimulating factor 1 receptor (CSF1R) gene cause hereditary diffuse leukoencephalopathy with spheroids.", "journal": "Nature genetics", "date": "2011", "authors": "Rademakers R, Baker M, Nicholson AM, Rutherford NJ, Finch N, Soto-Ortolaza A, Lash J, Wider C, Wojtas A, DeJesus-Hernandez M, Adamson J, Kouri N, Sundal C, Shuster EA, Aasly J, MacKenzie J, Roeber S, Kretzschmar HA, Boeve BF, Knopman DS, Petersen RC, Cairns NJ, Ghetti B, Spina S, Garbern J, Tselis AC, Uitti R, Das P, Van Gerpen JA, Meschia JF, Levy S, Broderick DF, Graff-Radford N, Ross OA, Miller BB, Swerdlow RH, Dickson DW, Wszolek ZK", "reference": { "type": "PubMed", "id": "22197934", "url": "https://pubmed.ncbi.nlm.nih.gov/22197934" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13639-1", "protein_name": "5-hydroxytryptamine receptor 4", "gene_name": "HTR4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22197934", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and expression of porcine Colony Stimulating Factor-1 (CSF-1) and Colony Stimulating Factor-1 Receptor (CSF-1R) and analysis of the species specificity of stimulation by CSF-1 and Interleukin 34.", "journal": "Cytokine", "date": "2012", "authors": "Gow DJ, Garceau V, Kapetanovic R, Sester DP, Fici GJ, Shelly JA, Wilson TL, Hume DA", "reference": { "type": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 546, "end_pos": 546, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" }, { "database": "PubMed", "id": "31827782", "url": "https://pubmed.ncbi.nlm.nih.gov/31827782" } ], "site_lbl": "Tyr546", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 699, "end_pos": 699, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "21049007", "url": "https://pubmed.ncbi.nlm.nih.gov/21049007" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "31827782", "url": "https://pubmed.ncbi.nlm.nih.gov/31827782" }, { "database": "PubMed", "id": "20489731", "url": "https://pubmed.ncbi.nlm.nih.gov/20489731" } ], "site_lbl": "Tyr699", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 708, "end_pos": 708, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" } ], "site_lbl": "Tyr708", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 723, "end_pos": 723, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "9191055", "url": "https://pubmed.ncbi.nlm.nih.gov/9191055" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "21266043", "url": "https://pubmed.ncbi.nlm.nih.gov/21266043" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" } ], "site_lbl": "Tyr723", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 809, "end_pos": 809, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "7681396", "url": "https://pubmed.ncbi.nlm.nih.gov/7681396" }, { "database": "PubMed", "id": "2168557", "url": "https://pubmed.ncbi.nlm.nih.gov/2168557" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "31827782", "url": "https://pubmed.ncbi.nlm.nih.gov/31827782" } ], "site_lbl": "Tyr809", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 923, "end_pos": 923, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "21049007", "url": "https://pubmed.ncbi.nlm.nih.gov/21049007" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" } ], "site_lbl": "Tyr923", "uniprot_canonical_ac": "P07333-1" } ], "record_id": "pubmed.22974529", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CSF1R mutations link POLD and HDLS as a single disease entity.", "journal": "Neurology", "date": "2013", "authors": "Nicholson AM, Baker MC, Finch NA, Rutherford NJ, Wider C, Graff-Radford NR, Nelson PT, Clark HB, Wszolek ZK, Dickson DW, Knopman DS, Rademakers R", "reference": { "type": "PubMed", "id": "23408870", "url": "https://pubmed.ncbi.nlm.nih.gov/23408870" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23408870", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A unique anti-CD115 monoclonal antibody which inhibits osteolysis and skews human monocyte differentiation from M2-polarized macrophages toward dendritic cells.", "journal": "mAbs", "date": "2013", "authors": "Haegel H, Thioudellet C, Hallet R, Geist M, Menguy T, Le Pogam F, Marchand JB, Toh ML, Duong V, Calcei A, Settelen N, Preville X, Hennequi M, Grellier B, Ancian P, Rissanen J, Clayette P, Guillen C, Rooke R, Bonnefoy JY", "reference": { "type": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 708, "end_pos": 708, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" } ], "site_lbl": "Tyr708", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 723, "end_pos": 723, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "9191055", "url": "https://pubmed.ncbi.nlm.nih.gov/9191055" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "21266043", "url": "https://pubmed.ncbi.nlm.nih.gov/21266043" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" } ], "site_lbl": "Tyr723", "uniprot_canonical_ac": "P07333-1" } ], "record_id": "pubmed.23924795", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CSF1 is a novel p53 target gene whose protein product functions in a feed-forward manner to suppress apoptosis and enhance p53-mediated growth arrest.", "journal": "PloS one", "date": "2013", "authors": "Azzam G, Wang X, Bell D, Murphy ME", "reference": { "type": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 723, "end_pos": 723, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "9191055", "url": "https://pubmed.ncbi.nlm.nih.gov/9191055" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "21266043", "url": "https://pubmed.ncbi.nlm.nih.gov/21266043" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" } ], "site_lbl": "Tyr723", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5, PRPK, AMPK, NUAK1 and ATM", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "10864201", "url": "https://pubmed.ncbi.nlm.nih.gov/10864201" }, { "database": "PubMed", "id": "15580310", "url": "https://pubmed.ncbi.nlm.nih.gov/15580310" }, { "database": "IntAct", "id": "P04637", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04637*" }, { "database": "PubMed", "id": "19883646", "url": "https://pubmed.ncbi.nlm.nih.gov/19883646" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "15866171", "url": "https://pubmed.ncbi.nlm.nih.gov/15866171" }, { "database": "PubMed", "id": "17591690", "url": "https://pubmed.ncbi.nlm.nih.gov/17591690" }, { "database": "PubMed", "id": "19828454", "url": "https://pubmed.ncbi.nlm.nih.gov/19828454" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PubMed", "id": "9925639", "url": "https://pubmed.ncbi.nlm.nih.gov/9925639" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "10202145", "url": "https://pubmed.ncbi.nlm.nih.gov/10202145" }, { "database": "PubMed", "id": "10606744", "url": "https://pubmed.ncbi.nlm.nih.gov/10606744" }, { "database": "PubMed", "id": "14712210", "url": "https://pubmed.ncbi.nlm.nih.gov/14712210" }, { "database": "PubMed", "id": "15642743", "url": "https://pubmed.ncbi.nlm.nih.gov/15642743" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "10082548", "url": "https://pubmed.ncbi.nlm.nih.gov/10082548" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10435622", "url": "https://pubmed.ncbi.nlm.nih.gov/10435622" }, { "database": "PubMed", "id": "10485486", "url": "https://pubmed.ncbi.nlm.nih.gov/10485486" }, { "database": "PubMed", "id": "10500142", "url": "https://pubmed.ncbi.nlm.nih.gov/10500142" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10544021", "url": "https://pubmed.ncbi.nlm.nih.gov/10544021" }, { "database": "PubMed", "id": "10570149", "url": "https://pubmed.ncbi.nlm.nih.gov/10570149" }, { "database": "PubMed", "id": "10601022", "url": "https://pubmed.ncbi.nlm.nih.gov/10601022" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10713094", "url": "https://pubmed.ncbi.nlm.nih.gov/10713094" }, { "database": "PubMed", "id": "10723129", "url": "https://pubmed.ncbi.nlm.nih.gov/10723129" }, { "database": "PubMed", "id": "10734067", "url": "https://pubmed.ncbi.nlm.nih.gov/10734067" }, { "database": "PubMed", "id": "10734308", "url": "https://pubmed.ncbi.nlm.nih.gov/10734308" }, { "database": "PubMed", "id": "10749144", "url": "https://pubmed.ncbi.nlm.nih.gov/10749144" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10860736", "url": "https://pubmed.ncbi.nlm.nih.gov/10860736" }, { "database": "PubMed", "id": "10930428", "url": "https://pubmed.ncbi.nlm.nih.gov/10930428" }, { "database": "PubMed", "id": "11042698", "url": "https://pubmed.ncbi.nlm.nih.gov/11042698" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11096068", "url": "https://pubmed.ncbi.nlm.nih.gov/11096068" }, { "database": "PubMed", "id": "11099484", "url": "https://pubmed.ncbi.nlm.nih.gov/11099484" }, { "database": "PubMed", "id": "11103796", "url": "https://pubmed.ncbi.nlm.nih.gov/11103796" }, { "database": "PubMed", "id": "11121242", "url": "https://pubmed.ncbi.nlm.nih.gov/11121242" }, { "database": "PubMed", "id": "11149936", "url": "https://pubmed.ncbi.nlm.nih.gov/11149936" }, { "database": "PubMed", "id": "11244509", "url": "https://pubmed.ncbi.nlm.nih.gov/11244509" }, { "database": "PubMed", "id": "11245472", "url": "https://pubmed.ncbi.nlm.nih.gov/11245472" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11313957", "url": "https://pubmed.ncbi.nlm.nih.gov/11313957" }, { "database": "PubMed", "id": "11314044", "url": "https://pubmed.ncbi.nlm.nih.gov/11314044" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11326311", "url": "https://pubmed.ncbi.nlm.nih.gov/11326311" }, { "database": "PubMed", "id": "11397945", "url": "https://pubmed.ncbi.nlm.nih.gov/11397945" }, { "database": "PubMed", "id": "11447225", "url": "https://pubmed.ncbi.nlm.nih.gov/11447225" }, { "database": "PubMed", "id": "11470744", "url": "https://pubmed.ncbi.nlm.nih.gov/11470744" }, { "database": "PubMed", "id": "11483158", "url": "https://pubmed.ncbi.nlm.nih.gov/11483158" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11495913", "url": "https://pubmed.ncbi.nlm.nih.gov/11495913" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11568365", "url": "https://pubmed.ncbi.nlm.nih.gov/11568365" }, { "database": "PubMed", "id": "11583595", "url": "https://pubmed.ncbi.nlm.nih.gov/11583595" }, { "database": "PubMed", "id": "11602639", "url": "https://pubmed.ncbi.nlm.nih.gov/11602639" }, { "database": "PubMed", "id": "11706017", "url": "https://pubmed.ncbi.nlm.nih.gov/11706017" }, { "database": "PubMed", "id": "11709713", "url": "https://pubmed.ncbi.nlm.nih.gov/11709713" }, { "database": "PubMed", "id": "11751391", "url": "https://pubmed.ncbi.nlm.nih.gov/11751391" }, { "database": "PubMed", "id": "11850826", "url": "https://pubmed.ncbi.nlm.nih.gov/11850826" }, { "database": "PubMed", "id": "11857452", "url": "https://pubmed.ncbi.nlm.nih.gov/11857452" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11865061", "url": "https://pubmed.ncbi.nlm.nih.gov/11865061" }, { "database": "PubMed", "id": "11875057", "url": "https://pubmed.ncbi.nlm.nih.gov/11875057" }, { "database": "PubMed", "id": "11877452", "url": "https://pubmed.ncbi.nlm.nih.gov/11877452" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "11927575", "url": "https://pubmed.ncbi.nlm.nih.gov/11927575" }, { "database": "PubMed", "id": "11965244", "url": "https://pubmed.ncbi.nlm.nih.gov/11965244" }, { "database": "PubMed", "id": "11973611", "url": "https://pubmed.ncbi.nlm.nih.gov/11973611" }, { "database": "PubMed", "id": "12066222", "url": "https://pubmed.ncbi.nlm.nih.gov/12066222" }, { "database": "PubMed", "id": "12071847", "url": "https://pubmed.ncbi.nlm.nih.gov/12071847" }, { "database": "PubMed", "id": "12082025", "url": "https://pubmed.ncbi.nlm.nih.gov/12082025" }, { "database": "PubMed", "id": "12082529", "url": "https://pubmed.ncbi.nlm.nih.gov/12082529" }, { "database": "PubMed", "id": "12091386", "url": "https://pubmed.ncbi.nlm.nih.gov/12091386" }, { "database": "PubMed", "id": "12131363", "url": "https://pubmed.ncbi.nlm.nih.gov/12131363" }, { "database": "PubMed", "id": "12145207", "url": "https://pubmed.ncbi.nlm.nih.gov/12145207" }, { "database": "PubMed", "id": "12151394", "url": "https://pubmed.ncbi.nlm.nih.gov/12151394" }, { "database": "PubMed", "id": "12238331", "url": "https://pubmed.ncbi.nlm.nih.gov/12238331" }, { "database": "PubMed", "id": "12381304", "url": "https://pubmed.ncbi.nlm.nih.gov/12381304" }, { "database": "PubMed", "id": "12393500", "url": "https://pubmed.ncbi.nlm.nih.gov/12393500" }, { "database": "PubMed", "id": "12419181", "url": "https://pubmed.ncbi.nlm.nih.gov/12419181" }, { "database": "PubMed", "id": "12427754", "url": "https://pubmed.ncbi.nlm.nih.gov/12427754" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12478472", "url": "https://pubmed.ncbi.nlm.nih.gov/12478472" }, { "database": "PubMed", "id": "12518062", "url": "https://pubmed.ncbi.nlm.nih.gov/12518062" }, { "database": "PubMed", "id": "12519780", "url": "https://pubmed.ncbi.nlm.nih.gov/12519780" }, { "database": "PubMed", "id": "12531896", "url": "https://pubmed.ncbi.nlm.nih.gov/12531896" }, { "database": "PubMed", "id": "12534344", "url": "https://pubmed.ncbi.nlm.nih.gov/12534344" }, { "database": "PubMed", "id": "12584171", "url": "https://pubmed.ncbi.nlm.nih.gov/12584171" }, { "database": "PubMed", "id": "12606123", "url": "https://pubmed.ncbi.nlm.nih.gov/12606123" }, { "database": "PubMed", "id": "12612087", "url": "https://pubmed.ncbi.nlm.nih.gov/12612087" }, { "database": "PubMed", "id": "12644594", "url": "https://pubmed.ncbi.nlm.nih.gov/12644594" }, { "database": "PubMed", "id": "12659830", "url": "https://pubmed.ncbi.nlm.nih.gov/12659830" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12698201", "url": "https://pubmed.ncbi.nlm.nih.gov/12698201" }, { "database": "PubMed", "id": "12702572", "url": "https://pubmed.ncbi.nlm.nih.gov/12702572" }, { "database": "PubMed", "id": "12719724", "url": "https://pubmed.ncbi.nlm.nih.gov/12719724" }, { "database": "PubMed", "id": "12756247", "url": "https://pubmed.ncbi.nlm.nih.gov/12756247" }, { "database": "PubMed", "id": "12767922", "url": "https://pubmed.ncbi.nlm.nih.gov/12767922" }, { "database": "PubMed", "id": "12811820", "url": "https://pubmed.ncbi.nlm.nih.gov/12811820" }, { "database": "PubMed", "id": "12853888", "url": "https://pubmed.ncbi.nlm.nih.gov/12853888" }, { "database": "PubMed", "id": "12857758", "url": "https://pubmed.ncbi.nlm.nih.gov/12857758" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12902982", "url": "https://pubmed.ncbi.nlm.nih.gov/12902982" }, { "database": "PubMed", "id": "12912974", "url": "https://pubmed.ncbi.nlm.nih.gov/12912974" }, { "database": "PubMed", "id": "12919932", "url": "https://pubmed.ncbi.nlm.nih.gov/12919932" }, { "database": "PubMed", "id": "12939400", "url": "https://pubmed.ncbi.nlm.nih.gov/12939400" }, { "database": "PubMed", "id": "12951835", "url": "https://pubmed.ncbi.nlm.nih.gov/12951835" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "12968928", "url": "https://pubmed.ncbi.nlm.nih.gov/12968928" }, { "database": "PubMed", "id": "13678348", "url": "https://pubmed.ncbi.nlm.nih.gov/13678348" }, { "database": "PubMed", "id": "1406679", "url": "https://pubmed.ncbi.nlm.nih.gov/1406679" }, { "database": "PubMed", "id": "14511359", "url": "https://pubmed.ncbi.nlm.nih.gov/14511359" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14527925", "url": "https://pubmed.ncbi.nlm.nih.gov/14527925" }, { "database": "PubMed", "id": "14559802", "url": "https://pubmed.ncbi.nlm.nih.gov/14559802" }, { "database": "PubMed", "id": "14612532", "url": "https://pubmed.ncbi.nlm.nih.gov/14612532" }, { "database": "PubMed", "id": "14617104", "url": "https://pubmed.ncbi.nlm.nih.gov/14617104" }, { "database": "PubMed", "id": "14623946", "url": "https://pubmed.ncbi.nlm.nih.gov/14623946" }, { "database": "PubMed", "id": "14637186", "url": "https://pubmed.ncbi.nlm.nih.gov/14637186" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14755247", "url": "https://pubmed.ncbi.nlm.nih.gov/14755247" }, { "database": "PubMed", "id": "14757188", "url": "https://pubmed.ncbi.nlm.nih.gov/14757188" }, { "database": "PubMed", "id": "14871840", "url": "https://pubmed.ncbi.nlm.nih.gov/14871840" }, { "database": "PubMed", "id": "14965474", "url": "https://pubmed.ncbi.nlm.nih.gov/14965474" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "14968111", "url": "https://pubmed.ncbi.nlm.nih.gov/14968111" }, { "database": "PubMed", "id": "14993250", "url": "https://pubmed.ncbi.nlm.nih.gov/14993250" }, { "database": "PubMed", "id": "15001399", "url": "https://pubmed.ncbi.nlm.nih.gov/15001399" }, { "database": "PubMed", "id": "15026814", "url": "https://pubmed.ncbi.nlm.nih.gov/15026814" }, { "database": "PubMed", "id": "15077171", "url": "https://pubmed.ncbi.nlm.nih.gov/15077171" }, { "database": "PubMed", "id": "15081425", "url": "https://pubmed.ncbi.nlm.nih.gov/15081425" }, { "database": "PubMed", "id": "15095398", "url": "https://pubmed.ncbi.nlm.nih.gov/15095398" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15159397", "url": "https://pubmed.ncbi.nlm.nih.gov/15159397" }, { "database": "PubMed", "id": "15159417", "url": "https://pubmed.ncbi.nlm.nih.gov/15159417" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15178317", "url": "https://pubmed.ncbi.nlm.nih.gov/15178317" }, { "database": "PubMed", "id": "15178764", "url": "https://pubmed.ncbi.nlm.nih.gov/15178764" }, { "database": "PubMed", "id": "15181149", "url": "https://pubmed.ncbi.nlm.nih.gov/15181149" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15199542", "url": "https://pubmed.ncbi.nlm.nih.gov/15199542" }, { "database": "PubMed", "id": "15226436", "url": "https://pubmed.ncbi.nlm.nih.gov/15226436" }, { "database": "PubMed", "id": "15252149", "url": "https://pubmed.ncbi.nlm.nih.gov/15252149" }, { "database": "PubMed", "id": "15254178", "url": "https://pubmed.ncbi.nlm.nih.gov/15254178" }, { "database": "PubMed", "id": "15289875", "url": "https://pubmed.ncbi.nlm.nih.gov/15289875" }, { "database": "PubMed", "id": "15310764", "url": "https://pubmed.ncbi.nlm.nih.gov/15310764" }, { "database": "PubMed", "id": "15322239", "url": "https://pubmed.ncbi.nlm.nih.gov/15322239" }, { "database": "PubMed", "id": "15355354", "url": "https://pubmed.ncbi.nlm.nih.gov/15355354" }, { "database": "PubMed", "id": "15381086", "url": "https://pubmed.ncbi.nlm.nih.gov/15381086" }, { "database": "PubMed", "id": "15456759", "url": "https://pubmed.ncbi.nlm.nih.gov/15456759" }, { "database": "PubMed", "id": "15464845", "url": "https://pubmed.ncbi.nlm.nih.gov/15464845" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15474986", "url": "https://pubmed.ncbi.nlm.nih.gov/15474986" }, { "database": "PubMed", "id": "15489892", "url": "https://pubmed.ncbi.nlm.nih.gov/15489892" }, { "database": "PubMed", "id": "15492510", "url": "https://pubmed.ncbi.nlm.nih.gov/15492510" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15533933", "url": "https://pubmed.ncbi.nlm.nih.gov/15533933" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15542774", "url": "https://pubmed.ncbi.nlm.nih.gov/15542774" }, { "database": "PubMed", "id": "15557124", "url": "https://pubmed.ncbi.nlm.nih.gov/15557124" }, { "database": "PubMed", "id": "15613785", "url": "https://pubmed.ncbi.nlm.nih.gov/15613785" }, { "database": "PubMed", "id": "15650224", "url": "https://pubmed.ncbi.nlm.nih.gov/15650224" }, { "database": "PubMed", "id": "15657356", "url": "https://pubmed.ncbi.nlm.nih.gov/15657356" }, { "database": "PubMed", "id": "15710360", "url": "https://pubmed.ncbi.nlm.nih.gov/15710360" }, { "database": "PubMed", "id": "15713892", "url": "https://pubmed.ncbi.nlm.nih.gov/15713892" }, { "database": "PubMed", "id": "15720815", "url": "https://pubmed.ncbi.nlm.nih.gov/15720815" }, { "database": "PubMed", "id": "15735102", "url": "https://pubmed.ncbi.nlm.nih.gov/15735102" }, { "database": "PubMed", "id": "15752772", "url": "https://pubmed.ncbi.nlm.nih.gov/15752772" }, { "database": "PubMed", "id": "15782130", "url": "https://pubmed.ncbi.nlm.nih.gov/15782130" }, { "database": "PubMed", "id": "15794754", "url": "https://pubmed.ncbi.nlm.nih.gov/15794754" }, { "database": "PubMed", "id": "15795939", "url": "https://pubmed.ncbi.nlm.nih.gov/15795939" }, { "database": "PubMed", "id": "15837074", "url": "https://pubmed.ncbi.nlm.nih.gov/15837074" }, { "database": "PubMed", "id": "15845651", "url": "https://pubmed.ncbi.nlm.nih.gov/15845651" }, { "database": "PubMed", "id": "15867353", "url": "https://pubmed.ncbi.nlm.nih.gov/15867353" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "15908423", "url": "https://pubmed.ncbi.nlm.nih.gov/15908423" }, { "database": "PubMed", "id": "16024610", "url": "https://pubmed.ncbi.nlm.nih.gov/16024610" }, { "database": "PubMed", "id": "16024799", "url": "https://pubmed.ncbi.nlm.nih.gov/16024799" }, { "database": "PubMed", "id": "16043514", "url": "https://pubmed.ncbi.nlm.nih.gov/16043514" }, { "database": "PubMed", "id": "16082226", "url": "https://pubmed.ncbi.nlm.nih.gov/16082226" }, { "database": "PubMed", "id": "16096427", "url": "https://pubmed.ncbi.nlm.nih.gov/16096427" }, { "database": "PubMed", "id": "16103197", "url": "https://pubmed.ncbi.nlm.nih.gov/16103197" }, { "database": "PubMed", "id": "16140041", "url": "https://pubmed.ncbi.nlm.nih.gov/16140041" }, { "database": "PubMed", "id": "16177561", "url": "https://pubmed.ncbi.nlm.nih.gov/16177561" }, { "database": "PubMed", "id": "16179498", "url": "https://pubmed.ncbi.nlm.nih.gov/16179498" }, { "database": "PubMed", "id": "16180010", "url": "https://pubmed.ncbi.nlm.nih.gov/16180010" }, { "database": "PubMed", "id": "16227412", "url": "https://pubmed.ncbi.nlm.nih.gov/16227412" }, { "database": "PubMed", "id": "16229013", "url": "https://pubmed.ncbi.nlm.nih.gov/16229013" }, { "database": "PubMed", "id": "16302093", "url": "https://pubmed.ncbi.nlm.nih.gov/16302093" }, { "database": "PubMed", "id": "16313886", "url": "https://pubmed.ncbi.nlm.nih.gov/16313886" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16322229", "url": "https://pubmed.ncbi.nlm.nih.gov/16322229" }, { "database": "PubMed", "id": "16397295", "url": "https://pubmed.ncbi.nlm.nih.gov/16397295" }, { "database": "PubMed", "id": "16414131", "url": "https://pubmed.ncbi.nlm.nih.gov/16414131" }, { "database": "PubMed", "id": "16433685", "url": "https://pubmed.ncbi.nlm.nih.gov/16433685" }, { "database": "PubMed", "id": "16436515", "url": "https://pubmed.ncbi.nlm.nih.gov/16436515" }, { "database": "PubMed", "id": "16474133", "url": "https://pubmed.ncbi.nlm.nih.gov/16474133" }, { "database": "PubMed", "id": "16489034", "url": "https://pubmed.ncbi.nlm.nih.gov/16489034" }, { "database": "PubMed", "id": "16501611", "url": "https://pubmed.ncbi.nlm.nih.gov/16501611" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16538517", "url": "https://pubmed.ncbi.nlm.nih.gov/16538517" }, { "database": "PubMed", "id": "16584535", "url": "https://pubmed.ncbi.nlm.nih.gov/16584535" }, { "database": "PubMed", "id": "16600182", "url": "https://pubmed.ncbi.nlm.nih.gov/16600182" }, { "database": "PubMed", "id": "16611888", "url": "https://pubmed.ncbi.nlm.nih.gov/16611888" }, { "database": "PubMed", "id": "16618811", "url": "https://pubmed.ncbi.nlm.nih.gov/16618811" }, { "database": "PubMed", "id": "16630142", "url": "https://pubmed.ncbi.nlm.nih.gov/16630142" }, { "database": "PubMed", "id": "16632641", "url": "https://pubmed.ncbi.nlm.nih.gov/16632641" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16705155", "url": "https://pubmed.ncbi.nlm.nih.gov/16705155" }, { "database": "PubMed", "id": "16714289", "url": "https://pubmed.ncbi.nlm.nih.gov/16714289" }, { "database": "PubMed", "id": "16715525", "url": "https://pubmed.ncbi.nlm.nih.gov/16715525" }, { "database": "PubMed", "id": "16731759", "url": "https://pubmed.ncbi.nlm.nih.gov/16731759" }, { "database": "PubMed", "id": "16751801", "url": "https://pubmed.ncbi.nlm.nih.gov/16751801" }, { "database": "PubMed", "id": "16753148", "url": "https://pubmed.ncbi.nlm.nih.gov/16753148" }, { "database": "PubMed", "id": "16777994", "url": "https://pubmed.ncbi.nlm.nih.gov/16777994" }, { "database": "PubMed", "id": "16778146", "url": "https://pubmed.ncbi.nlm.nih.gov/16778146" }, { "database": "PubMed", "id": "16801388", "url": "https://pubmed.ncbi.nlm.nih.gov/16801388" }, { "database": "PubMed", "id": "16814113", "url": "https://pubmed.ncbi.nlm.nih.gov/16814113" }, { "database": "PubMed", "id": "16815295", "url": "https://pubmed.ncbi.nlm.nih.gov/16815295" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16827804", "url": "https://pubmed.ncbi.nlm.nih.gov/16827804" }, { "database": "PubMed", "id": "16891474", "url": "https://pubmed.ncbi.nlm.nih.gov/16891474" }, { "database": "PubMed", "id": "16912307", "url": "https://pubmed.ncbi.nlm.nih.gov/16912307" }, { "database": "PubMed", "id": "16928824", "url": "https://pubmed.ncbi.nlm.nih.gov/16928824" }, { "database": "PubMed", "id": "16966622", "url": "https://pubmed.ncbi.nlm.nih.gov/16966622" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "16971507", "url": "https://pubmed.ncbi.nlm.nih.gov/16971507" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "17113036", "url": "https://pubmed.ncbi.nlm.nih.gov/17113036" }, { "database": "PubMed", "id": "17126818", "url": "https://pubmed.ncbi.nlm.nih.gov/17126818" }, { "database": "PubMed", "id": "17172431", "url": "https://pubmed.ncbi.nlm.nih.gov/17172431" }, { "database": "PubMed", "id": "17174366", "url": "https://pubmed.ncbi.nlm.nih.gov/17174366" }, { "database": "PubMed", "id": "17230520", "url": "https://pubmed.ncbi.nlm.nih.gov/17230520" }, { "database": "PubMed", "id": "17241873", "url": "https://pubmed.ncbi.nlm.nih.gov/17241873" }, { "database": "PubMed", "id": "17257432", "url": "https://pubmed.ncbi.nlm.nih.gov/17257432" }, { "database": "PubMed", "id": "17292432", "url": "https://pubmed.ncbi.nlm.nih.gov/17292432" }, { "database": "PubMed", "id": "17297446", "url": "https://pubmed.ncbi.nlm.nih.gov/17297446" }, { "database": "PubMed", "id": "17301063", "url": "https://pubmed.ncbi.nlm.nih.gov/17301063" }, { "database": "PubMed", "id": "17332930", "url": "https://pubmed.ncbi.nlm.nih.gov/17332930" }, { "database": "PubMed", "id": "17334779", "url": "https://pubmed.ncbi.nlm.nih.gov/17334779" }, { "database": "PubMed", "id": "17456577", "url": "https://pubmed.ncbi.nlm.nih.gov/17456577" }, { "database": "PubMed", "id": "17509529", "url": "https://pubmed.ncbi.nlm.nih.gov/17509529" }, { "database": "PubMed", "id": "17510082", "url": "https://pubmed.ncbi.nlm.nih.gov/17510082" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17512204", "url": "https://pubmed.ncbi.nlm.nih.gov/17512204" }, { "database": "PubMed", "id": "17517898", "url": "https://pubmed.ncbi.nlm.nih.gov/17517898" }, { "database": "PubMed", "id": "17524349", "url": "https://pubmed.ncbi.nlm.nih.gov/17524349" }, { "database": "PubMed", "id": "17535811", "url": "https://pubmed.ncbi.nlm.nih.gov/17535811" }, { "database": "PubMed", "id": "17575952", "url": "https://pubmed.ncbi.nlm.nih.gov/17575952" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17596534", "url": "https://pubmed.ncbi.nlm.nih.gov/17596534" }, { "database": "PubMed", "id": "17610031", "url": "https://pubmed.ncbi.nlm.nih.gov/17610031" }, { "database": "PubMed", "id": "17612589", "url": "https://pubmed.ncbi.nlm.nih.gov/17612589" }, { "database": "PubMed", "id": "17616578", "url": "https://pubmed.ncbi.nlm.nih.gov/17616578" }, { "database": "PubMed", "id": "17668048", "url": "https://pubmed.ncbi.nlm.nih.gov/17668048" }, { "database": "PubMed", "id": "17707793", "url": "https://pubmed.ncbi.nlm.nih.gov/17707793" }, { "database": "PubMed", "id": "17712528", "url": "https://pubmed.ncbi.nlm.nih.gov/17712528" }, { "database": "PubMed", "id": "17727682", "url": "https://pubmed.ncbi.nlm.nih.gov/17727682" }, { "database": "PubMed", "id": "17803907", "url": "https://pubmed.ncbi.nlm.nih.gov/17803907" }, { "database": "PubMed", "id": "17854787", "url": "https://pubmed.ncbi.nlm.nih.gov/17854787" }, { "database": "PubMed", "id": "17855337", "url": "https://pubmed.ncbi.nlm.nih.gov/17855337" }, { "database": "PubMed", "id": "17894897", "url": "https://pubmed.ncbi.nlm.nih.gov/17894897" }, { "database": "PubMed", "id": "17903248", "url": "https://pubmed.ncbi.nlm.nih.gov/17903248" }, { "database": "PubMed", "id": "17918180", "url": "https://pubmed.ncbi.nlm.nih.gov/17918180" }, { "database": "PubMed", "id": "17919456", "url": "https://pubmed.ncbi.nlm.nih.gov/17919456" }, { "database": "PubMed", "id": "17932621", "url": "https://pubmed.ncbi.nlm.nih.gov/17932621" }, { "database": "PubMed", "id": "17932951", "url": "https://pubmed.ncbi.nlm.nih.gov/17932951" }, { "database": "PubMed", "id": "17940507", "url": "https://pubmed.ncbi.nlm.nih.gov/17940507" }, { "database": "PubMed", "id": "17967874", "url": "https://pubmed.ncbi.nlm.nih.gov/17967874" }, { "database": "PubMed", "id": "17971768", "url": "https://pubmed.ncbi.nlm.nih.gov/17971768" }, { "database": "PubMed", "id": "17977830", "url": "https://pubmed.ncbi.nlm.nih.gov/17977830" }, { "database": "PubMed", "id": "18032786", "url": "https://pubmed.ncbi.nlm.nih.gov/18032786" }, { "database": "PubMed", "id": "18048073", "url": "https://pubmed.ncbi.nlm.nih.gov/18048073" }, { "database": "PubMed", "id": "18082226", "url": "https://pubmed.ncbi.nlm.nih.gov/18082226" }, { "database": "PubMed", "id": "18085531", "url": "https://pubmed.ncbi.nlm.nih.gov/18085531" }, { "database": "PubMed", "id": "18187512", "url": "https://pubmed.ncbi.nlm.nih.gov/18187512" }, { "database": "PubMed", "id": "18191923", "url": "https://pubmed.ncbi.nlm.nih.gov/18191923" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18272544", "url": "https://pubmed.ncbi.nlm.nih.gov/18272544" }, { "database": "PubMed", "id": "18289623", "url": "https://pubmed.ncbi.nlm.nih.gov/18289623" }, { "database": "PubMed", "id": "18294283", "url": "https://pubmed.ncbi.nlm.nih.gov/18294283" }, { "database": "PubMed", "id": "18311036", "url": "https://pubmed.ncbi.nlm.nih.gov/18311036" }, { "database": "PubMed", "id": "18339864", "url": "https://pubmed.ncbi.nlm.nih.gov/18339864" }, { "database": "PubMed", "id": "18344606", "url": "https://pubmed.ncbi.nlm.nih.gov/18344606" }, { "database": "PubMed", "id": "18348731", "url": "https://pubmed.ncbi.nlm.nih.gov/18348731" }, { "database": "PubMed", "id": "18366759", "url": "https://pubmed.ncbi.nlm.nih.gov/18366759" }, { "database": "PubMed", "id": "18381438", "url": "https://pubmed.ncbi.nlm.nih.gov/18381438" }, { "database": "PubMed", "id": "18406507", "url": "https://pubmed.ncbi.nlm.nih.gov/18406507" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18446786", "url": "https://pubmed.ncbi.nlm.nih.gov/18446786" }, { "database": "PubMed", "id": "18455128", "url": "https://pubmed.ncbi.nlm.nih.gov/18455128" }, { "database": "PubMed", "id": "18479896", "url": "https://pubmed.ncbi.nlm.nih.gov/18479896" }, { "database": "PubMed", "id": "18497347", "url": "https://pubmed.ncbi.nlm.nih.gov/18497347" }, { "database": "PubMed", "id": "18504176", "url": "https://pubmed.ncbi.nlm.nih.gov/18504176" }, { "database": "PubMed", "id": "18511169", "url": "https://pubmed.ncbi.nlm.nih.gov/18511169" }, { "database": "PubMed", "id": "18519674", "url": "https://pubmed.ncbi.nlm.nih.gov/18519674" }, { "database": "PubMed", "id": "18523653", "url": "https://pubmed.ncbi.nlm.nih.gov/18523653" }, { "database": "PubMed", "id": "18540044", "url": "https://pubmed.ncbi.nlm.nih.gov/18540044" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18585854", "url": "https://pubmed.ncbi.nlm.nih.gov/18585854" }, { "database": "PubMed", "id": "18589416", "url": "https://pubmed.ncbi.nlm.nih.gov/18589416" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18604166", "url": "https://pubmed.ncbi.nlm.nih.gov/18604166" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18642443", "url": "https://pubmed.ncbi.nlm.nih.gov/18642443" }, { "database": "PubMed", "id": "18660513", "url": "https://pubmed.ncbi.nlm.nih.gov/18660513" }, { "database": "PubMed", "id": "18661100", "url": "https://pubmed.ncbi.nlm.nih.gov/18661100" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18760266", "url": "https://pubmed.ncbi.nlm.nih.gov/18760266" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "18785202", "url": "https://pubmed.ncbi.nlm.nih.gov/18785202" }, { "database": "PubMed", "id": "18791269", "url": "https://pubmed.ncbi.nlm.nih.gov/18791269" }, { "database": "PubMed", "id": "18802408", "url": "https://pubmed.ncbi.nlm.nih.gov/18802408" }, { "database": "PubMed", "id": "18847491", "url": "https://pubmed.ncbi.nlm.nih.gov/18847491" }, { "database": "PubMed", "id": "18852884", "url": "https://pubmed.ncbi.nlm.nih.gov/18852884" }, { "database": "PubMed", "id": "18947885", "url": "https://pubmed.ncbi.nlm.nih.gov/18947885" }, { "database": "PubMed", "id": "19064630", "url": "https://pubmed.ncbi.nlm.nih.gov/19064630" }, { "database": "PubMed", "id": "19067706", "url": "https://pubmed.ncbi.nlm.nih.gov/19067706" }, { "database": "PubMed", "id": "19095450", "url": "https://pubmed.ncbi.nlm.nih.gov/19095450" }, { "database": "PubMed", "id": "19112505", "url": "https://pubmed.ncbi.nlm.nih.gov/19112505" }, { "database": "PubMed", "id": "19139065", "url": "https://pubmed.ncbi.nlm.nih.gov/19139065" }, { "database": "PubMed", "id": "19148495", "url": "https://pubmed.ncbi.nlm.nih.gov/19148495" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19166313", "url": "https://pubmed.ncbi.nlm.nih.gov/19166313" }, { "database": "PubMed", "id": "19221002", "url": "https://pubmed.ncbi.nlm.nih.gov/19221002" }, { "database": "PubMed", "id": "19225536", "url": "https://pubmed.ncbi.nlm.nih.gov/19225536" }, { "database": "PubMed", "id": "19295133", "url": "https://pubmed.ncbi.nlm.nih.gov/19295133" }, { "database": "PubMed", "id": "19303885", "url": "https://pubmed.ncbi.nlm.nih.gov/19303885" }, { "database": "PubMed", "id": "19357962", "url": "https://pubmed.ncbi.nlm.nih.gov/19357962" }, { "database": "PubMed", "id": "19363523", "url": "https://pubmed.ncbi.nlm.nih.gov/19363523" }, { "database": "PubMed", "id": "19373864", "url": "https://pubmed.ncbi.nlm.nih.gov/19373864" }, { "database": "PubMed", "id": "19397953", "url": "https://pubmed.ncbi.nlm.nih.gov/19397953" }, { "database": "PubMed", "id": "19398950", "url": "https://pubmed.ncbi.nlm.nih.gov/19398950" }, { "database": "PubMed", "id": "19426797", "url": "https://pubmed.ncbi.nlm.nih.gov/19426797" }, { "database": "PubMed", "id": "19454177", "url": "https://pubmed.ncbi.nlm.nih.gov/19454177" }, { "database": "PubMed", "id": "19459175", "url": "https://pubmed.ncbi.nlm.nih.gov/19459175" }, { "database": "PubMed", "id": "19525231", "url": "https://pubmed.ncbi.nlm.nih.gov/19525231" }, { "database": "PubMed", "id": "19536869", "url": "https://pubmed.ncbi.nlm.nih.gov/19536869" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19649319", "url": "https://pubmed.ncbi.nlm.nih.gov/19649319" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19660097", "url": "https://pubmed.ncbi.nlm.nih.gov/19660097" }, { "database": "PubMed", "id": "19674456", "url": "https://pubmed.ncbi.nlm.nih.gov/19674456" }, { "database": "PubMed", "id": "19705844", "url": "https://pubmed.ncbi.nlm.nih.gov/19705844" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19821510", "url": "https://pubmed.ncbi.nlm.nih.gov/19821510" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19934315", "url": "https://pubmed.ncbi.nlm.nih.gov/19934315" }, { "database": "PubMed", "id": "19952118", "url": "https://pubmed.ncbi.nlm.nih.gov/19952118" }, { "database": "PubMed", "id": "19960411", "url": "https://pubmed.ncbi.nlm.nih.gov/19960411" }, { "database": "PubMed", "id": "20005456", "url": "https://pubmed.ncbi.nlm.nih.gov/20005456" }, { "database": "PubMed", "id": "20005840", "url": "https://pubmed.ncbi.nlm.nih.gov/20005840" }, { "database": "PubMed", "id": "20016737", "url": "https://pubmed.ncbi.nlm.nih.gov/20016737" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20060030", "url": "https://pubmed.ncbi.nlm.nih.gov/20060030" }, { "database": "PubMed", "id": "20085646", "url": "https://pubmed.ncbi.nlm.nih.gov/20085646" }, { "database": "PubMed", "id": "20092938", "url": "https://pubmed.ncbi.nlm.nih.gov/20092938" }, { "database": "PubMed", "id": "20097305", "url": "https://pubmed.ncbi.nlm.nih.gov/20097305" }, { "database": "PubMed", "id": "20123963", "url": "https://pubmed.ncbi.nlm.nih.gov/20123963" }, { "database": "PubMed", "id": "20187950", "url": "https://pubmed.ncbi.nlm.nih.gov/20187950" }, { "database": "PubMed", "id": "20219657", "url": "https://pubmed.ncbi.nlm.nih.gov/20219657" }, { "database": "PubMed", "id": "20226587", "url": "https://pubmed.ncbi.nlm.nih.gov/20226587" }, { "database": "PubMed", "id": "20308316", "url": "https://pubmed.ncbi.nlm.nih.gov/20308316" }, { "database": "PubMed", "id": "20353948", "url": "https://pubmed.ncbi.nlm.nih.gov/20353948" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20413215", "url": "https://pubmed.ncbi.nlm.nih.gov/20413215" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20432447", "url": "https://pubmed.ncbi.nlm.nih.gov/20432447" }, { "database": "PubMed", "id": "20456495", "url": "https://pubmed.ncbi.nlm.nih.gov/20456495" }, { "database": "PubMed", "id": "20484174", "url": "https://pubmed.ncbi.nlm.nih.gov/20484174" }, { "database": "PubMed", "id": "20499882", "url": "https://pubmed.ncbi.nlm.nih.gov/20499882" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20543986", "url": "https://pubmed.ncbi.nlm.nih.gov/20543986" }, { "database": "PubMed", "id": "20549306", "url": "https://pubmed.ncbi.nlm.nih.gov/20549306" }, { "database": "PubMed", "id": "20566882", "url": "https://pubmed.ncbi.nlm.nih.gov/20566882" }, { "database": "PubMed", "id": "20622265", "url": "https://pubmed.ncbi.nlm.nih.gov/20622265" }, { "database": "PubMed", "id": "20663147", "url": "https://pubmed.ncbi.nlm.nih.gov/20663147" }, { "database": "PubMed", "id": "20693977", "url": "https://pubmed.ncbi.nlm.nih.gov/20693977" }, { "database": "PubMed", "id": "20708607", "url": "https://pubmed.ncbi.nlm.nih.gov/20708607" }, { "database": "PubMed", "id": "20717878", "url": "https://pubmed.ncbi.nlm.nih.gov/20717878" }, { "database": "PubMed", "id": "20809980", "url": "https://pubmed.ncbi.nlm.nih.gov/20809980" }, { "database": "PubMed", "id": "20840867", "url": "https://pubmed.ncbi.nlm.nih.gov/20840867" }, { "database": "PubMed", "id": "20886098", "url": "https://pubmed.ncbi.nlm.nih.gov/20886098" }, { "database": "PubMed", "id": "20931131", "url": "https://pubmed.ncbi.nlm.nih.gov/20931131" }, { "database": "PubMed", "id": "20948430", "url": "https://pubmed.ncbi.nlm.nih.gov/20948430" }, { "database": "PubMed", "id": "20974518", "url": "https://pubmed.ncbi.nlm.nih.gov/20974518" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "21045015", "url": "https://pubmed.ncbi.nlm.nih.gov/21045015" }, { "database": "PubMed", "id": "21078665", "url": "https://pubmed.ncbi.nlm.nih.gov/21078665" }, { "database": "PubMed", "id": "21114963", "url": "https://pubmed.ncbi.nlm.nih.gov/21114963" }, { "database": "PubMed", "id": "21118815", "url": "https://pubmed.ncbi.nlm.nih.gov/21118815" }, { "database": "PubMed", "id": "21163364", "url": "https://pubmed.ncbi.nlm.nih.gov/21163364" }, { "database": "PubMed", "id": "21167122", "url": "https://pubmed.ncbi.nlm.nih.gov/21167122" }, { "database": "PubMed", "id": "21225623", "url": "https://pubmed.ncbi.nlm.nih.gov/21225623" }, { "database": "PubMed", "id": "21261644", "url": "https://pubmed.ncbi.nlm.nih.gov/21261644" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21361779", "url": "https://pubmed.ncbi.nlm.nih.gov/21361779" }, { "database": "PubMed", "id": "21368894", "url": "https://pubmed.ncbi.nlm.nih.gov/21368894" }, { "database": "PubMed", "id": "21376392", "url": "https://pubmed.ncbi.nlm.nih.gov/21376392" }, { "database": "PubMed", "id": "21383020", "url": "https://pubmed.ncbi.nlm.nih.gov/21383020" }, { "database": "PubMed", "id": "21383696", "url": "https://pubmed.ncbi.nlm.nih.gov/21383696" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21394211", "url": "https://pubmed.ncbi.nlm.nih.gov/21394211" }, { "database": "PubMed", "id": "21432907", "url": "https://pubmed.ncbi.nlm.nih.gov/21432907" }, { "database": "PubMed", "id": "21451571", "url": "https://pubmed.ncbi.nlm.nih.gov/21451571" }, { "database": "PubMed", "id": "21465263", "url": "https://pubmed.ncbi.nlm.nih.gov/21465263" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21532991", "url": "https://pubmed.ncbi.nlm.nih.gov/21532991" }, { "database": "PubMed", "id": "21549095", "url": "https://pubmed.ncbi.nlm.nih.gov/21549095" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21576488", "url": "https://pubmed.ncbi.nlm.nih.gov/21576488" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21653549", "url": "https://pubmed.ncbi.nlm.nih.gov/21653549" }, { "database": "PubMed", "id": "21663643", "url": "https://pubmed.ncbi.nlm.nih.gov/21663643" }, { "database": "PubMed", "id": "21687937", "url": "https://pubmed.ncbi.nlm.nih.gov/21687937" }, { "database": "PubMed", "id": "21725357", "url": "https://pubmed.ncbi.nlm.nih.gov/21725357" }, { "database": "PubMed", "id": "21783897", "url": "https://pubmed.ncbi.nlm.nih.gov/21783897" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21809388", "url": "https://pubmed.ncbi.nlm.nih.gov/21809388" }, { "database": "PubMed", "id": "21840268", "url": "https://pubmed.ncbi.nlm.nih.gov/21840268" }, { "database": "PubMed", "id": "21857991", "url": "https://pubmed.ncbi.nlm.nih.gov/21857991" }, { "database": "PubMed", "id": "21866568", "url": "https://pubmed.ncbi.nlm.nih.gov/21866568" }, { "database": "PubMed", "id": "21887275", "url": "https://pubmed.ncbi.nlm.nih.gov/21887275" }, { "database": "PubMed", "id": "21909130", "url": "https://pubmed.ncbi.nlm.nih.gov/21909130" }, { "database": "PubMed", "id": "21918620", "url": "https://pubmed.ncbi.nlm.nih.gov/21918620" }, { "database": "PubMed", "id": "21945951", "url": "https://pubmed.ncbi.nlm.nih.gov/21945951" }, { "database": "PubMed", "id": "21960246", "url": "https://pubmed.ncbi.nlm.nih.gov/21960246" }, { "database": "PubMed", "id": "21965754", "url": "https://pubmed.ncbi.nlm.nih.gov/21965754" }, { "database": "PubMed", "id": "21983885", "url": "https://pubmed.ncbi.nlm.nih.gov/21983885" }, { "database": "PubMed", "id": "21997969", "url": "https://pubmed.ncbi.nlm.nih.gov/21997969" }, { "database": "PubMed", "id": "22002314", "url": "https://pubmed.ncbi.nlm.nih.gov/22002314" }, { "database": "PubMed", "id": "22030623", "url": "https://pubmed.ncbi.nlm.nih.gov/22030623" }, { "database": "PubMed", "id": "22114676", "url": "https://pubmed.ncbi.nlm.nih.gov/22114676" }, { "database": "PubMed", "id": "22142405", "url": "https://pubmed.ncbi.nlm.nih.gov/22142405" }, { "database": "PubMed", "id": "22174788", "url": "https://pubmed.ncbi.nlm.nih.gov/22174788" }, { "database": "PubMed", "id": "22190353", "url": "https://pubmed.ncbi.nlm.nih.gov/22190353" }, { "database": "PubMed", "id": "22198295", "url": "https://pubmed.ncbi.nlm.nih.gov/22198295" }, { "database": "PubMed", "id": "22266868", "url": "https://pubmed.ncbi.nlm.nih.gov/22266868" }, { "database": "PubMed", "id": "22288499", "url": "https://pubmed.ncbi.nlm.nih.gov/22288499" }, { "database": "PubMed", "id": "22290291", "url": "https://pubmed.ncbi.nlm.nih.gov/22290291" }, { "database": "PubMed", "id": "22312557", "url": "https://pubmed.ncbi.nlm.nih.gov/22312557" }, { "database": "PubMed", "id": "22331558", "url": "https://pubmed.ncbi.nlm.nih.gov/22331558" }, { "database": "PubMed", "id": "22414726", "url": "https://pubmed.ncbi.nlm.nih.gov/22414726" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22435726", "url": "https://pubmed.ncbi.nlm.nih.gov/22435726" }, { "database": "PubMed", "id": "22447336", "url": "https://pubmed.ncbi.nlm.nih.gov/22447336" }, { "database": "PubMed", "id": "22514710", "url": "https://pubmed.ncbi.nlm.nih.gov/22514710" }, { "database": "PubMed", "id": "22523681", "url": "https://pubmed.ncbi.nlm.nih.gov/22523681" }, { "database": "PubMed", "id": "22555805", "url": "https://pubmed.ncbi.nlm.nih.gov/22555805" }, { "database": "PubMed", "id": "22564437", "url": "https://pubmed.ncbi.nlm.nih.gov/22564437" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22622028", "url": "https://pubmed.ncbi.nlm.nih.gov/22622028" }, { "database": "PubMed", "id": "22627294", "url": "https://pubmed.ncbi.nlm.nih.gov/22627294" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22662266", "url": "https://pubmed.ncbi.nlm.nih.gov/22662266" }, { "database": "PubMed", "id": "22722496", "url": "https://pubmed.ncbi.nlm.nih.gov/22722496" }, { "database": "PubMed", "id": "22767080", "url": "https://pubmed.ncbi.nlm.nih.gov/22767080" }, { "database": "PubMed", "id": "22768036", "url": "https://pubmed.ncbi.nlm.nih.gov/22768036" }, { "database": "PubMed", "id": "22797063", "url": "https://pubmed.ncbi.nlm.nih.gov/22797063" }, { "database": "PubMed", "id": "22807682", "url": "https://pubmed.ncbi.nlm.nih.gov/22807682" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22848370", "url": "https://pubmed.ncbi.nlm.nih.gov/22848370" }, { "database": "PubMed", "id": "22859938", "url": "https://pubmed.ncbi.nlm.nih.gov/22859938" }, { "database": "PubMed", "id": "22888789", "url": "https://pubmed.ncbi.nlm.nih.gov/22888789" }, { "database": "PubMed", "id": "22911714", "url": "https://pubmed.ncbi.nlm.nih.gov/22911714" }, { "database": "PubMed", "id": "22947118", "url": "https://pubmed.ncbi.nlm.nih.gov/22947118" }, { "database": "PubMed", "id": "22954457", "url": "https://pubmed.ncbi.nlm.nih.gov/22954457" }, { "database": "PubMed", "id": "22962590", "url": "https://pubmed.ncbi.nlm.nih.gov/22962590" }, { "database": "PubMed", "id": "22983795", "url": "https://pubmed.ncbi.nlm.nih.gov/22983795" }, { "database": "PubMed", "id": "22996738", "url": "https://pubmed.ncbi.nlm.nih.gov/22996738" }, { "database": "PubMed", "id": "23027622", "url": "https://pubmed.ncbi.nlm.nih.gov/23027622" }, { "database": "PubMed", "id": "23028738", "url": "https://pubmed.ncbi.nlm.nih.gov/23028738" }, { "database": "PubMed", "id": "23034333", "url": "https://pubmed.ncbi.nlm.nih.gov/23034333" }, { "database": "PubMed", "id": "23050037", "url": "https://pubmed.ncbi.nlm.nih.gov/23050037" }, { "database": "PubMed", "id": "23091651", "url": "https://pubmed.ncbi.nlm.nih.gov/23091651" }, { "database": "PubMed", "id": "23108402", "url": "https://pubmed.ncbi.nlm.nih.gov/23108402" }, { "database": "PubMed", "id": "23124353", "url": "https://pubmed.ncbi.nlm.nih.gov/23124353" }, { "database": "PubMed", "id": "23128467", "url": "https://pubmed.ncbi.nlm.nih.gov/23128467" }, { "database": "PubMed", "id": "23139272", "url": "https://pubmed.ncbi.nlm.nih.gov/23139272" }, { "database": "PubMed", "id": "23194110", "url": "https://pubmed.ncbi.nlm.nih.gov/23194110" }, { "database": "PubMed", "id": "23238993", "url": "https://pubmed.ncbi.nlm.nih.gov/23238993" }, { "database": "PubMed", "id": "23263852", "url": "https://pubmed.ncbi.nlm.nih.gov/23263852" }, { "database": "PubMed", "id": "23300887", "url": "https://pubmed.ncbi.nlm.nih.gov/23300887" }, { "database": "PubMed", "id": "23318437", "url": "https://pubmed.ncbi.nlm.nih.gov/23318437" }, { "database": "PubMed", "id": "23319600", "url": "https://pubmed.ncbi.nlm.nih.gov/23319600" }, { "database": "PubMed", "id": "23340843", "url": "https://pubmed.ncbi.nlm.nih.gov/23340843" }, { "database": "PubMed", "id": "23342042", "url": "https://pubmed.ncbi.nlm.nih.gov/23342042" }, { "database": "PubMed", "id": "23351152", "url": "https://pubmed.ncbi.nlm.nih.gov/23351152" }, { "database": "PubMed", "id": "23359208", "url": "https://pubmed.ncbi.nlm.nih.gov/23359208" }, { "database": "PubMed", "id": "23425510", "url": "https://pubmed.ncbi.nlm.nih.gov/23425510" }, { "database": "PubMed", "id": "23434831", "url": "https://pubmed.ncbi.nlm.nih.gov/23434831" }, { "database": "PubMed", "id": "23451179", "url": "https://pubmed.ncbi.nlm.nih.gov/23451179" }, { "database": "PubMed", "id": "23483203", "url": "https://pubmed.ncbi.nlm.nih.gov/23483203" }, { "database": "PubMed", "id": "23495037", "url": "https://pubmed.ncbi.nlm.nih.gov/23495037" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23555949", "url": "https://pubmed.ncbi.nlm.nih.gov/23555949" }, { "database": "PubMed", "id": "23557329", "url": "https://pubmed.ncbi.nlm.nih.gov/23557329" }, { "database": "PubMed", "id": "23566959", "url": "https://pubmed.ncbi.nlm.nih.gov/23566959" }, { "database": "PubMed", "id": "23589839", "url": "https://pubmed.ncbi.nlm.nih.gov/23589839" }, { "database": "PubMed", "id": "23599430", "url": "https://pubmed.ncbi.nlm.nih.gov/23599430" }, { "database": "PubMed", "id": "23610071", "url": "https://pubmed.ncbi.nlm.nih.gov/23610071" }, { "database": "PubMed", "id": "23612976", "url": "https://pubmed.ncbi.nlm.nih.gov/23612976" }, { "database": "PubMed", "id": "23618908", "url": "https://pubmed.ncbi.nlm.nih.gov/23618908" }, { "database": "PubMed", "id": "23640457", "url": "https://pubmed.ncbi.nlm.nih.gov/23640457" }, { "database": "PubMed", "id": "23646139", "url": "https://pubmed.ncbi.nlm.nih.gov/23646139" }, { "database": "PubMed", "id": "23652278", "url": "https://pubmed.ncbi.nlm.nih.gov/23652278" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23666755", "url": "https://pubmed.ncbi.nlm.nih.gov/23666755" }, { "database": "PubMed", "id": "23676219", "url": "https://pubmed.ncbi.nlm.nih.gov/23676219" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23737838", "url": "https://pubmed.ncbi.nlm.nih.gov/23737838" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23759592", "url": "https://pubmed.ncbi.nlm.nih.gov/23759592" }, { "database": "PubMed", "id": "23785417", "url": "https://pubmed.ncbi.nlm.nih.gov/23785417" }, { "database": "PubMed", "id": "23800953", "url": "https://pubmed.ncbi.nlm.nih.gov/23800953" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23852422", "url": "https://pubmed.ncbi.nlm.nih.gov/23852422" }, { "database": "PubMed", "id": "23874235", "url": "https://pubmed.ncbi.nlm.nih.gov/23874235" }, { "database": "PubMed", "id": "23883471", "url": "https://pubmed.ncbi.nlm.nih.gov/23883471" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "23915323", "url": "https://pubmed.ncbi.nlm.nih.gov/23915323" }, { "database": "PubMed", "id": "23949216", "url": "https://pubmed.ncbi.nlm.nih.gov/23949216" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24024154", "url": "https://pubmed.ncbi.nlm.nih.gov/24024154" }, { "database": "PubMed", "id": "24037342", "url": "https://pubmed.ncbi.nlm.nih.gov/24037342" }, { "database": "PubMed", "id": "24040083", "url": "https://pubmed.ncbi.nlm.nih.gov/24040083" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24086708", "url": "https://pubmed.ncbi.nlm.nih.gov/24086708" }, { "database": "PubMed", "id": "24089038", "url": "https://pubmed.ncbi.nlm.nih.gov/24089038" }, { "database": "PubMed", "id": "24096875", "url": "https://pubmed.ncbi.nlm.nih.gov/24096875" }, { "database": "PubMed", "id": "24129246", "url": "https://pubmed.ncbi.nlm.nih.gov/24129246" }, { "database": "PubMed", "id": "24156017", "url": "https://pubmed.ncbi.nlm.nih.gov/24156017" }, { "database": "PubMed", "id": "24157877", "url": "https://pubmed.ncbi.nlm.nih.gov/24157877" }, { "database": "PubMed", "id": "24194914", "url": "https://pubmed.ncbi.nlm.nih.gov/24194914" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24205157", "url": "https://pubmed.ncbi.nlm.nih.gov/24205157" }, { "database": "PubMed", "id": "24223226", "url": "https://pubmed.ncbi.nlm.nih.gov/24223226" }, { "database": "PubMed", "id": "24244715", "url": "https://pubmed.ncbi.nlm.nih.gov/24244715" }, { "database": "PubMed", "id": "24248600", "url": "https://pubmed.ncbi.nlm.nih.gov/24248600" }, { "database": "PubMed", "id": "24264057", "url": "https://pubmed.ncbi.nlm.nih.gov/24264057" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24313628", "url": "https://pubmed.ncbi.nlm.nih.gov/24313628" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24379680", "url": "https://pubmed.ncbi.nlm.nih.gov/24379680" }, { "database": "PubMed", "id": "24380814", "url": "https://pubmed.ncbi.nlm.nih.gov/24380814" }, { "database": "PubMed", "id": "24391984", "url": "https://pubmed.ncbi.nlm.nih.gov/24391984" }, { "database": "PubMed", "id": "24403123", "url": "https://pubmed.ncbi.nlm.nih.gov/24403123" }, { "database": "PubMed", "id": "24413150", "url": "https://pubmed.ncbi.nlm.nih.gov/24413150" }, { "database": "PubMed", "id": "24445528", "url": "https://pubmed.ncbi.nlm.nih.gov/24445528" }, { "database": "PubMed", "id": "24447148", "url": "https://pubmed.ncbi.nlm.nih.gov/24447148" }, { "database": "PubMed", "id": "24456610", "url": "https://pubmed.ncbi.nlm.nih.gov/24456610" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24480460", "url": "https://pubmed.ncbi.nlm.nih.gov/24480460" }, { "database": "PubMed", "id": "24553354", "url": "https://pubmed.ncbi.nlm.nih.gov/24553354" }, { "database": "PubMed", "id": "24555657", "url": "https://pubmed.ncbi.nlm.nih.gov/24555657" }, { "database": "PubMed", "id": "24556689", "url": "https://pubmed.ncbi.nlm.nih.gov/24556689" }, { "database": "PubMed", "id": "24587255", "url": "https://pubmed.ncbi.nlm.nih.gov/24587255" }, { "database": "PubMed", "id": "24603648", "url": "https://pubmed.ncbi.nlm.nih.gov/24603648" }, { "database": "PubMed", "id": "24608431", "url": "https://pubmed.ncbi.nlm.nih.gov/24608431" }, { "database": "PubMed", "id": "24613410", "url": "https://pubmed.ncbi.nlm.nih.gov/24613410" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24657168", "url": "https://pubmed.ncbi.nlm.nih.gov/24657168" }, { "database": "PubMed", "id": "24682933", "url": "https://pubmed.ncbi.nlm.nih.gov/24682933" }, { "database": "PubMed", "id": "24691657", "url": "https://pubmed.ncbi.nlm.nih.gov/24691657" }, { "database": "PubMed", "id": "24717393", "url": "https://pubmed.ncbi.nlm.nih.gov/24717393" }, { "database": "PubMed", "id": "24722580", "url": "https://pubmed.ncbi.nlm.nih.gov/24722580" }, { "database": "PubMed", "id": "24759730", "url": "https://pubmed.ncbi.nlm.nih.gov/24759730" }, { "database": "PubMed", "id": "24796485", "url": "https://pubmed.ncbi.nlm.nih.gov/24796485" }, { "database": "PubMed", "id": "24797517", "url": "https://pubmed.ncbi.nlm.nih.gov/24797517" }, { "database": "PubMed", "id": "24801380", "url": "https://pubmed.ncbi.nlm.nih.gov/24801380" }, { "database": "PubMed", "id": "24810057", "url": "https://pubmed.ncbi.nlm.nih.gov/24810057" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24867336", "url": "https://pubmed.ncbi.nlm.nih.gov/24867336" }, { "database": "PubMed", "id": "24885082", "url": "https://pubmed.ncbi.nlm.nih.gov/24885082" }, { "database": "PubMed", "id": "24886358", "url": "https://pubmed.ncbi.nlm.nih.gov/24886358" }, { "database": "PubMed", "id": "24905183", "url": "https://pubmed.ncbi.nlm.nih.gov/24905183" }, { "database": "PubMed", "id": "24926985", "url": "https://pubmed.ncbi.nlm.nih.gov/24926985" }, { "database": "PubMed", "id": "24928858", "url": "https://pubmed.ncbi.nlm.nih.gov/24928858" }, { "database": "PubMed", "id": "24932684", "url": "https://pubmed.ncbi.nlm.nih.gov/24932684" }, { "database": "PubMed", "id": "24934860", "url": "https://pubmed.ncbi.nlm.nih.gov/24934860" }, { "database": "PubMed", "id": "24956278", "url": "https://pubmed.ncbi.nlm.nih.gov/24956278" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "24971451", "url": "https://pubmed.ncbi.nlm.nih.gov/24971451" }, { "database": "PubMed", "id": "25051404", "url": "https://pubmed.ncbi.nlm.nih.gov/25051404" }, { "database": "PubMed", "id": "25078064", "url": "https://pubmed.ncbi.nlm.nih.gov/25078064" }, { "database": "PubMed", "id": "25112877", "url": "https://pubmed.ncbi.nlm.nih.gov/25112877" }, { "database": "PubMed", "id": "25143403", "url": "https://pubmed.ncbi.nlm.nih.gov/25143403" }, { "database": "PubMed", "id": "25198662", "url": "https://pubmed.ncbi.nlm.nih.gov/25198662" }, { "database": "PubMed", "id": "25221641", "url": "https://pubmed.ncbi.nlm.nih.gov/25221641" }, { "database": "PubMed", "id": "25227113", "url": "https://pubmed.ncbi.nlm.nih.gov/25227113" }, { "database": "PubMed", "id": "25275589", "url": "https://pubmed.ncbi.nlm.nih.gov/25275589" }, { "database": "PubMed", "id": "25277183", "url": "https://pubmed.ncbi.nlm.nih.gov/25277183" }, { "database": "PubMed", "id": "25277184", "url": "https://pubmed.ncbi.nlm.nih.gov/25277184" }, { "database": "PubMed", "id": "25294809", "url": "https://pubmed.ncbi.nlm.nih.gov/25294809" }, { "database": "PubMed", "id": "25311384", "url": "https://pubmed.ncbi.nlm.nih.gov/25311384" }, { "database": "PubMed", "id": "25319447", "url": "https://pubmed.ncbi.nlm.nih.gov/25319447" }, { "database": "PubMed", "id": "25331851", "url": "https://pubmed.ncbi.nlm.nih.gov/25331851" }, { "database": "PubMed", "id": "25341038", "url": "https://pubmed.ncbi.nlm.nih.gov/25341038" }, { "database": "PubMed", "id": "25372714", "url": "https://pubmed.ncbi.nlm.nih.gov/25372714" }, { "database": "PubMed", "id": "25412311", "url": "https://pubmed.ncbi.nlm.nih.gov/25412311" }, { "database": "PubMed", "id": "25486198", "url": "https://pubmed.ncbi.nlm.nih.gov/25486198" }, { "database": "PubMed", "id": "25489053", "url": "https://pubmed.ncbi.nlm.nih.gov/25489053" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25524025", "url": "https://pubmed.ncbi.nlm.nih.gov/25524025" }, { "database": "PubMed", "id": "25603347", "url": "https://pubmed.ncbi.nlm.nih.gov/25603347" }, { "database": "PubMed", "id": "25605022", "url": "https://pubmed.ncbi.nlm.nih.gov/25605022" }, { "database": "PubMed", "id": "25617667", "url": "https://pubmed.ncbi.nlm.nih.gov/25617667" }, { "database": "PubMed", "id": "25637534", "url": "https://pubmed.ncbi.nlm.nih.gov/25637534" }, { "database": "PubMed", "id": "25639717", "url": "https://pubmed.ncbi.nlm.nih.gov/25639717" }, { "database": "PubMed", "id": "25650067", "url": "https://pubmed.ncbi.nlm.nih.gov/25650067" }, { "database": "PubMed", "id": "25658463", "url": "https://pubmed.ncbi.nlm.nih.gov/25658463" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25674209", "url": "https://pubmed.ncbi.nlm.nih.gov/25674209" }, { "database": "PubMed", "id": "25742468", "url": "https://pubmed.ncbi.nlm.nih.gov/25742468" }, { "database": "PubMed", "id": "25761368", "url": "https://pubmed.ncbi.nlm.nih.gov/25761368" }, { "database": "PubMed", "id": "25769181", "url": "https://pubmed.ncbi.nlm.nih.gov/25769181" }, { "database": "PubMed", "id": "25807079", "url": "https://pubmed.ncbi.nlm.nih.gov/25807079" }, { "database": "PubMed", "id": "25840449", "url": "https://pubmed.ncbi.nlm.nih.gov/25840449" }, { "database": "PubMed", "id": "25852310", "url": "https://pubmed.ncbi.nlm.nih.gov/25852310" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "25867071", "url": "https://pubmed.ncbi.nlm.nih.gov/25867071" }, { "database": "PubMed", "id": "25883152", "url": "https://pubmed.ncbi.nlm.nih.gov/25883152" }, { "database": "PubMed", "id": "25888625", "url": "https://pubmed.ncbi.nlm.nih.gov/25888625" }, { "database": "PubMed", "id": "25916852", "url": "https://pubmed.ncbi.nlm.nih.gov/25916852" }, { "database": "PubMed", "id": "25929783", "url": "https://pubmed.ncbi.nlm.nih.gov/25929783" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "25980443", "url": "https://pubmed.ncbi.nlm.nih.gov/25980443" }, { "database": "PubMed", "id": "25993660", "url": "https://pubmed.ncbi.nlm.nih.gov/25993660" }, { "database": "PubMed", "id": "26006237", "url": "https://pubmed.ncbi.nlm.nih.gov/26006237" }, { "database": "PubMed", "id": "26024660", "url": "https://pubmed.ncbi.nlm.nih.gov/26024660" }, { "database": "PubMed", "id": "26041883", "url": "https://pubmed.ncbi.nlm.nih.gov/26041883" }, { "database": "PubMed", "id": "26042776", "url": "https://pubmed.ncbi.nlm.nih.gov/26042776" }, { "database": "PubMed", "id": "26059686", "url": "https://pubmed.ncbi.nlm.nih.gov/26059686" }, { "database": "PubMed", "id": "26062651", "url": "https://pubmed.ncbi.nlm.nih.gov/26062651" }, { "database": "PubMed", "id": "26070322", "url": "https://pubmed.ncbi.nlm.nih.gov/26070322" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26095524", "url": "https://pubmed.ncbi.nlm.nih.gov/26095524" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26113041", "url": "https://pubmed.ncbi.nlm.nih.gov/26113041" }, { "database": "PubMed", "id": "26138448", "url": "https://pubmed.ncbi.nlm.nih.gov/26138448" }, { "database": "PubMed", "id": "26144554", "url": "https://pubmed.ncbi.nlm.nih.gov/26144554" }, { "database": "PubMed", "id": "26181367", "url": "https://pubmed.ncbi.nlm.nih.gov/26181367" }, { "database": "PubMed", "id": "26193055", "url": "https://pubmed.ncbi.nlm.nih.gov/26193055" }, { "database": "PubMed", "id": "26230405", "url": "https://pubmed.ncbi.nlm.nih.gov/26230405" }, { "database": "PubMed", "id": "26231043", "url": "https://pubmed.ncbi.nlm.nih.gov/26231043" }, { "database": "PubMed", "id": "26244501", "url": "https://pubmed.ncbi.nlm.nih.gov/26244501" }, { "database": "PubMed", "id": "26261212", "url": "https://pubmed.ncbi.nlm.nih.gov/26261212" }, { "database": "PubMed", "id": "26297485", "url": "https://pubmed.ncbi.nlm.nih.gov/26297485" }, { "database": "PubMed", "id": "26327815", "url": "https://pubmed.ncbi.nlm.nih.gov/26327815" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26387611", "url": "https://pubmed.ncbi.nlm.nih.gov/26387611" }, { "database": "PubMed", "id": "26391003", "url": "https://pubmed.ncbi.nlm.nih.gov/26391003" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26408200", "url": "https://pubmed.ncbi.nlm.nih.gov/26408200" }, { "database": "PubMed", "id": "26415230", "url": "https://pubmed.ncbi.nlm.nih.gov/26415230" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26456774", "url": "https://pubmed.ncbi.nlm.nih.gov/26456774" }, { "database": "PubMed", "id": "26459859", "url": "https://pubmed.ncbi.nlm.nih.gov/26459859" }, { "database": "PubMed", "id": "26471002", "url": "https://pubmed.ncbi.nlm.nih.gov/26471002" }, { "database": "PubMed", "id": "26485768", "url": "https://pubmed.ncbi.nlm.nih.gov/26485768" }, { "database": "PubMed", "id": "26510776", "url": "https://pubmed.ncbi.nlm.nih.gov/26510776" }, { "database": "PubMed", "id": "26522181", "url": "https://pubmed.ncbi.nlm.nih.gov/26522181" }, { "database": "PubMed", "id": "26540344", "url": "https://pubmed.ncbi.nlm.nih.gov/26540344" }, { "database": "PubMed", "id": "26571493", "url": "https://pubmed.ncbi.nlm.nih.gov/26571493" }, { "database": "PubMed", "id": "26598601", "url": "https://pubmed.ncbi.nlm.nih.gov/26598601" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26687066", "url": "https://pubmed.ncbi.nlm.nih.gov/26687066" }, { "database": "PubMed", "id": "26699757", "url": "https://pubmed.ncbi.nlm.nih.gov/26699757" }, { "database": "PubMed", "id": "26714930", "url": "https://pubmed.ncbi.nlm.nih.gov/26714930" }, { "database": "PubMed", "id": "26716417", "url": "https://pubmed.ncbi.nlm.nih.gov/26716417" }, { "database": "PubMed", "id": "26734838", "url": "https://pubmed.ncbi.nlm.nih.gov/26734838" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26832796", "url": "https://pubmed.ncbi.nlm.nih.gov/26832796" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "26876197", "url": "https://pubmed.ncbi.nlm.nih.gov/26876197" }, { "database": "PubMed", "id": "26883108", "url": "https://pubmed.ncbi.nlm.nih.gov/26883108" }, { "database": "PubMed", "id": "26909609", "url": "https://pubmed.ncbi.nlm.nih.gov/26909609" }, { "database": "PubMed", "id": "26928575", "url": "https://pubmed.ncbi.nlm.nih.gov/26928575" }, { "database": "PubMed", "id": "26967060", "url": "https://pubmed.ncbi.nlm.nih.gov/26967060" }, { "database": "PubMed", "id": "26974310", "url": "https://pubmed.ncbi.nlm.nih.gov/26974310" }, { "database": "PubMed", "id": "26982737", "url": "https://pubmed.ncbi.nlm.nih.gov/26982737" }, { "database": "PubMed", "id": "26984736", "url": "https://pubmed.ncbi.nlm.nih.gov/26984736" }, { "database": "PubMed", "id": "26988910", "url": "https://pubmed.ncbi.nlm.nih.gov/26988910" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "27031960", "url": "https://pubmed.ncbi.nlm.nih.gov/27031960" }, { "database": "PubMed", "id": "27054339", "url": "https://pubmed.ncbi.nlm.nih.gov/27054339" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27119009", "url": "https://pubmed.ncbi.nlm.nih.gov/27119009" }, { "database": "PubMed", "id": "27127932", "url": "https://pubmed.ncbi.nlm.nih.gov/27127932" }, { "database": "PubMed", "id": "27176768", "url": "https://pubmed.ncbi.nlm.nih.gov/27176768" }, { "database": "PubMed", "id": "27183917", "url": "https://pubmed.ncbi.nlm.nih.gov/27183917" }, { "database": "PubMed", "id": "27195669", "url": "https://pubmed.ncbi.nlm.nih.gov/27195669" }, { "database": "PubMed", "id": "27221050", "url": "https://pubmed.ncbi.nlm.nih.gov/27221050" }, { "database": "PubMed", "id": "27223263", "url": "https://pubmed.ncbi.nlm.nih.gov/27223263" }, { "database": "PubMed", "id": "27270209", "url": "https://pubmed.ncbi.nlm.nih.gov/27270209" }, { "database": "PubMed", "id": "27270636", "url": "https://pubmed.ncbi.nlm.nih.gov/27270636" }, { "database": "PubMed", "id": "27283986", "url": "https://pubmed.ncbi.nlm.nih.gov/27283986" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27314341", "url": "https://pubmed.ncbi.nlm.nih.gov/27314341" }, { "database": "PubMed", "id": "27323823", "url": "https://pubmed.ncbi.nlm.nih.gov/27323823" }, { "database": "PubMed", "id": "27344169", "url": "https://pubmed.ncbi.nlm.nih.gov/27344169" }, { "database": "PubMed", "id": "27346849", "url": "https://pubmed.ncbi.nlm.nih.gov/27346849" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27399772", "url": "https://pubmed.ncbi.nlm.nih.gov/27399772" }, { "database": "PubMed", "id": "27402273", "url": "https://pubmed.ncbi.nlm.nih.gov/27402273" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27511909", "url": "https://pubmed.ncbi.nlm.nih.gov/27511909" }, { "database": "PubMed", "id": "27517620", "url": "https://pubmed.ncbi.nlm.nih.gov/27517620" }, { "database": "PubMed", "id": "27542238", "url": "https://pubmed.ncbi.nlm.nih.gov/27542238" }, { "database": "PubMed", "id": "27545311", "url": "https://pubmed.ncbi.nlm.nih.gov/27545311" }, { "database": "PubMed", "id": "27551445", "url": "https://pubmed.ncbi.nlm.nih.gov/27551445" }, { "database": "PubMed", "id": "27556362", "url": "https://pubmed.ncbi.nlm.nih.gov/27556362" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27611229", "url": "https://pubmed.ncbi.nlm.nih.gov/27611229" }, { "database": "PubMed", "id": "27626308", "url": "https://pubmed.ncbi.nlm.nih.gov/27626308" }, { "database": "PubMed", "id": "27644130", "url": "https://pubmed.ncbi.nlm.nih.gov/27644130" }, { "database": "PubMed", "id": "27656146", "url": "https://pubmed.ncbi.nlm.nih.gov/27656146" }, { "database": "PubMed", "id": "27659536", "url": "https://pubmed.ncbi.nlm.nih.gov/27659536" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "27721412", "url": "https://pubmed.ncbi.nlm.nih.gov/27721412" }, { "database": "PubMed", "id": "27742673", "url": "https://pubmed.ncbi.nlm.nih.gov/27742673" }, { "database": "PubMed", "id": "27763560", "url": "https://pubmed.ncbi.nlm.nih.gov/27763560" }, { "database": "PubMed", "id": "27769050", "url": "https://pubmed.ncbi.nlm.nih.gov/27769050" }, { "database": "PubMed", "id": "27810895", "url": "https://pubmed.ncbi.nlm.nih.gov/27810895" }, { "database": "PubMed", "id": "27863490", "url": "https://pubmed.ncbi.nlm.nih.gov/27863490" }, { "database": "PubMed", "id": "27902328", "url": "https://pubmed.ncbi.nlm.nih.gov/27902328" }, { "database": "PubMed", "id": "27906186", "url": "https://pubmed.ncbi.nlm.nih.gov/27906186" }, { "database": "PubMed", "id": "27991505", "url": "https://pubmed.ncbi.nlm.nih.gov/27991505" }, { "database": "PubMed", "id": "28031409", "url": "https://pubmed.ncbi.nlm.nih.gov/28031409" }, { "database": "PubMed", "id": "28038466", "url": "https://pubmed.ncbi.nlm.nih.gov/28038466" }, { "database": "PubMed", "id": "28102346", "url": "https://pubmed.ncbi.nlm.nih.gov/28102346" }, { "database": "PubMed", "id": "28118604", "url": "https://pubmed.ncbi.nlm.nih.gov/28118604" }, { "database": "PubMed", "id": "28131798", "url": "https://pubmed.ncbi.nlm.nih.gov/28131798" }, { "database": "PubMed", "id": "28177473", "url": "https://pubmed.ncbi.nlm.nih.gov/28177473" }, { "database": "PubMed", "id": "28182004", "url": "https://pubmed.ncbi.nlm.nih.gov/28182004" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28187444", "url": "https://pubmed.ncbi.nlm.nih.gov/28187444" }, { "database": "PubMed", "id": "28208611", "url": "https://pubmed.ncbi.nlm.nih.gov/28208611" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28259974", "url": "https://pubmed.ncbi.nlm.nih.gov/28259974" }, { "database": "PubMed", "id": "28284059", "url": "https://pubmed.ncbi.nlm.nih.gov/28284059" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28369097", "url": "https://pubmed.ncbi.nlm.nih.gov/28369097" }, { "database": "PubMed", "id": "28381880", "url": "https://pubmed.ncbi.nlm.nih.gov/28381880" }, { "database": "PubMed", "id": "28455491", "url": "https://pubmed.ncbi.nlm.nih.gov/28455491" }, { "database": "PubMed", "id": "28466226", "url": "https://pubmed.ncbi.nlm.nih.gov/28466226" }, { "database": "PubMed", "id": "28468838", "url": "https://pubmed.ncbi.nlm.nih.gov/28468838" }, { "database": "PubMed", "id": "28475405", "url": "https://pubmed.ncbi.nlm.nih.gov/28475405" }, { "database": "PubMed", "id": "28535155", "url": "https://pubmed.ncbi.nlm.nih.gov/28535155" }, { "database": "PubMed", "id": "28605833", "url": "https://pubmed.ncbi.nlm.nih.gov/28605833" }, { "database": "PubMed", "id": "28656213", "url": "https://pubmed.ncbi.nlm.nih.gov/28656213" }, { "database": "PubMed", "id": "28667090", "url": "https://pubmed.ncbi.nlm.nih.gov/28667090" }, { "database": "PubMed", "id": "28714848", "url": "https://pubmed.ncbi.nlm.nih.gov/28714848" }, { "database": "PubMed", "id": "28715492", "url": "https://pubmed.ncbi.nlm.nih.gov/28715492" }, { "database": "PubMed", "id": "28726723", "url": "https://pubmed.ncbi.nlm.nih.gov/28726723" }, { "database": "PubMed", "id": "28759712", "url": "https://pubmed.ncbi.nlm.nih.gov/28759712" }, { "database": "PubMed", "id": "28790359", "url": "https://pubmed.ncbi.nlm.nih.gov/28790359" }, { "database": "PubMed", "id": "28794470", "url": "https://pubmed.ncbi.nlm.nih.gov/28794470" }, { "database": "PubMed", "id": "28797070", "url": "https://pubmed.ncbi.nlm.nih.gov/28797070" }, { "database": "PubMed", "id": "28801242", "url": "https://pubmed.ncbi.nlm.nih.gov/28801242" }, { "database": "PubMed", "id": "28837154", "url": "https://pubmed.ncbi.nlm.nih.gov/28837154" }, { "database": "PubMed", "id": "28842590", "url": "https://pubmed.ncbi.nlm.nih.gov/28842590" }, { "database": "PubMed", "id": "28843398", "url": "https://pubmed.ncbi.nlm.nih.gov/28843398" }, { "database": "PubMed", "id": "28888100", "url": "https://pubmed.ncbi.nlm.nih.gov/28888100" }, { "database": "PubMed", "id": "28904350", "url": "https://pubmed.ncbi.nlm.nih.gov/28904350" }, { "database": "PubMed", "id": "28915553", "url": "https://pubmed.ncbi.nlm.nih.gov/28915553" }, { "database": "PubMed", "id": "28915564", "url": "https://pubmed.ncbi.nlm.nih.gov/28915564" }, { "database": "PubMed", "id": "28926586", "url": "https://pubmed.ncbi.nlm.nih.gov/28926586" }, { "database": "PubMed", "id": "28930974", "url": "https://pubmed.ncbi.nlm.nih.gov/28930974" }, { "database": "PubMed", "id": "28968425", "url": "https://pubmed.ncbi.nlm.nih.gov/28968425" }, { "database": "PubMed", "id": "28971953", "url": "https://pubmed.ncbi.nlm.nih.gov/28971953" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "28973015", "url": "https://pubmed.ncbi.nlm.nih.gov/28973015" }, { "database": "PubMed", "id": "28979163", "url": "https://pubmed.ncbi.nlm.nih.gov/28979163" }, { "database": "PubMed", "id": "28981110", "url": "https://pubmed.ncbi.nlm.nih.gov/28981110" }, { "database": "PubMed", "id": "28985345", "url": "https://pubmed.ncbi.nlm.nih.gov/28985345" }, { "database": "PubMed", "id": "28993697", "url": "https://pubmed.ncbi.nlm.nih.gov/28993697" }, { "database": "PubMed", "id": "29030986", "url": "https://pubmed.ncbi.nlm.nih.gov/29030986" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29069457", "url": "https://pubmed.ncbi.nlm.nih.gov/29069457" }, { "database": "PubMed", "id": "29081404", "url": "https://pubmed.ncbi.nlm.nih.gov/29081404" }, { "database": "PubMed", "id": "29096294", "url": "https://pubmed.ncbi.nlm.nih.gov/29096294" }, { "database": "PubMed", "id": "29127423", "url": "https://pubmed.ncbi.nlm.nih.gov/29127423" }, { "database": "PubMed", "id": "29133857", "url": "https://pubmed.ncbi.nlm.nih.gov/29133857" }, { "database": "PubMed", "id": "29156743", "url": "https://pubmed.ncbi.nlm.nih.gov/29156743" }, { "database": "PubMed", "id": "29170254", "url": "https://pubmed.ncbi.nlm.nih.gov/29170254" }, { "database": "PubMed", "id": "29170437", "url": "https://pubmed.ncbi.nlm.nih.gov/29170437" }, { "database": "PubMed", "id": "29212215", "url": "https://pubmed.ncbi.nlm.nih.gov/29212215" }, { "database": "PubMed", "id": "29213352", "url": "https://pubmed.ncbi.nlm.nih.gov/29213352" }, { "database": "PubMed", "id": "29221109", "url": "https://pubmed.ncbi.nlm.nih.gov/29221109" }, { "database": "PubMed", "id": "29233996", "url": "https://pubmed.ncbi.nlm.nih.gov/29233996" }, { "database": "PubMed", "id": "29235570", "url": "https://pubmed.ncbi.nlm.nih.gov/29235570" }, { "database": "PubMed", "id": "29242151", "url": "https://pubmed.ncbi.nlm.nih.gov/29242151" }, { "database": "PubMed", "id": "29262653", "url": "https://pubmed.ncbi.nlm.nih.gov/29262653" }, { "database": "PubMed", "id": "29282022", "url": "https://pubmed.ncbi.nlm.nih.gov/29282022" }, { "database": "PubMed", "id": "29298131", "url": "https://pubmed.ncbi.nlm.nih.gov/29298131" }, { "database": "PubMed", "id": "29311824", "url": "https://pubmed.ncbi.nlm.nih.gov/29311824" }, { "database": "PubMed", "id": "29317830", "url": "https://pubmed.ncbi.nlm.nih.gov/29317830" }, { "database": "PubMed", "id": "29368980", "url": "https://pubmed.ncbi.nlm.nih.gov/29368980" }, { "database": "PubMed", "id": "29383186", "url": "https://pubmed.ncbi.nlm.nih.gov/29383186" }, { "database": "PubMed", "id": "29391428", "url": "https://pubmed.ncbi.nlm.nih.gov/29391428" }, { "database": "PubMed", "id": "29444163", "url": "https://pubmed.ncbi.nlm.nih.gov/29444163" }, { "database": "PubMed", "id": "29445107", "url": "https://pubmed.ncbi.nlm.nih.gov/29445107" }, { "database": "PubMed", "id": "29467390", "url": "https://pubmed.ncbi.nlm.nih.gov/29467390" }, { "database": "PubMed", "id": "29555944", "url": "https://pubmed.ncbi.nlm.nih.gov/29555944" }, { "database": "PubMed", "id": "29568955", "url": "https://pubmed.ncbi.nlm.nih.gov/29568955" }, { "database": "PubMed", "id": "29622681", "url": "https://pubmed.ncbi.nlm.nih.gov/29622681" }, { "database": "PubMed", "id": "29675670", "url": "https://pubmed.ncbi.nlm.nih.gov/29675670" }, { "database": "PubMed", "id": "29705090", "url": "https://pubmed.ncbi.nlm.nih.gov/29705090" }, { "database": "PubMed", "id": "29774100", "url": "https://pubmed.ncbi.nlm.nih.gov/29774100" }, { "database": "PubMed", "id": "29849909", "url": "https://pubmed.ncbi.nlm.nih.gov/29849909" }, { "database": "PubMed", "id": "29879550", "url": "https://pubmed.ncbi.nlm.nih.gov/29879550" }, { "database": "PubMed", "id": "29890668", "url": "https://pubmed.ncbi.nlm.nih.gov/29890668" }, { "database": "PubMed", "id": "29899847", "url": "https://pubmed.ncbi.nlm.nih.gov/29899847" }, { "database": "PubMed", "id": "29937996", "url": "https://pubmed.ncbi.nlm.nih.gov/29937996" }, { "database": "PubMed", "id": "29963241", "url": "https://pubmed.ncbi.nlm.nih.gov/29963241" }, { "database": "PubMed", "id": "30003648", "url": "https://pubmed.ncbi.nlm.nih.gov/30003648" }, { "database": "PubMed", "id": "30018737", "url": "https://pubmed.ncbi.nlm.nih.gov/30018737" }, { "database": "PubMed", "id": "30045945", "url": "https://pubmed.ncbi.nlm.nih.gov/30045945" }, { "database": "PubMed", "id": "30049386", "url": "https://pubmed.ncbi.nlm.nih.gov/30049386" }, { "database": "PubMed", "id": "30057418", "url": "https://pubmed.ncbi.nlm.nih.gov/30057418" }, { "database": "PubMed", "id": "30067985", "url": "https://pubmed.ncbi.nlm.nih.gov/30067985" }, { "database": "PubMed", "id": "30093397", "url": "https://pubmed.ncbi.nlm.nih.gov/30093397" }, { "database": "PubMed", "id": "30108207", "url": "https://pubmed.ncbi.nlm.nih.gov/30108207" }, { "database": "PubMed", "id": "30142917", "url": "https://pubmed.ncbi.nlm.nih.gov/30142917" }, { "database": "PubMed", "id": "30166519", "url": "https://pubmed.ncbi.nlm.nih.gov/30166519" }, { "database": "PubMed", "id": "30177839", "url": "https://pubmed.ncbi.nlm.nih.gov/30177839" }, { "database": "PubMed", "id": "30193098", "url": "https://pubmed.ncbi.nlm.nih.gov/30193098" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30252118", "url": "https://pubmed.ncbi.nlm.nih.gov/30252118" }, { "database": "PubMed", "id": "30254375", "url": "https://pubmed.ncbi.nlm.nih.gov/30254375" }, { "database": "PubMed", "id": "30261716", "url": "https://pubmed.ncbi.nlm.nih.gov/30261716" }, { "database": "PubMed", "id": "30272263", "url": "https://pubmed.ncbi.nlm.nih.gov/30272263" }, { "database": "PubMed", "id": "30337688", "url": "https://pubmed.ncbi.nlm.nih.gov/30337688" }, { "database": "PubMed", "id": "30375398", "url": "https://pubmed.ncbi.nlm.nih.gov/30375398" }, { "database": "PubMed", "id": "30380295", "url": "https://pubmed.ncbi.nlm.nih.gov/30380295" }, { "database": "PubMed", "id": "30388705", "url": "https://pubmed.ncbi.nlm.nih.gov/30388705" }, { "database": "PubMed", "id": "30400903", "url": "https://pubmed.ncbi.nlm.nih.gov/30400903" }, { "database": "PubMed", "id": "30424508", "url": "https://pubmed.ncbi.nlm.nih.gov/30424508" }, { "database": "PubMed", "id": "30476192", "url": "https://pubmed.ncbi.nlm.nih.gov/30476192" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30513611", "url": "https://pubmed.ncbi.nlm.nih.gov/30513611" }, { "database": "PubMed", "id": "30520728", "url": "https://pubmed.ncbi.nlm.nih.gov/30520728" }, { "database": "PubMed", "id": "30532707", "url": "https://pubmed.ncbi.nlm.nih.gov/30532707" }, { "database": "PubMed", "id": "30538965", "url": "https://pubmed.ncbi.nlm.nih.gov/30538965" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30585287", "url": "https://pubmed.ncbi.nlm.nih.gov/30585287" }, { "database": "PubMed", "id": "30587121", "url": "https://pubmed.ncbi.nlm.nih.gov/30587121" }, { "database": "PubMed", "id": "30665195", "url": "https://pubmed.ncbi.nlm.nih.gov/30665195" }, { "database": "PubMed", "id": "30666155", "url": "https://pubmed.ncbi.nlm.nih.gov/30666155" }, { "database": "PubMed", "id": "30717309", "url": "https://pubmed.ncbi.nlm.nih.gov/30717309" }, { "database": "PubMed", "id": "30728460", "url": "https://pubmed.ncbi.nlm.nih.gov/30728460" }, { "database": "PubMed", "id": "30733851", "url": "https://pubmed.ncbi.nlm.nih.gov/30733851" }, { "database": "PubMed", "id": "30808373", "url": "https://pubmed.ncbi.nlm.nih.gov/30808373" }, { "database": "PubMed", "id": "30813936", "url": "https://pubmed.ncbi.nlm.nih.gov/30813936" }, { "database": "PubMed", "id": "30854784", "url": "https://pubmed.ncbi.nlm.nih.gov/30854784" }, { "database": "PubMed", "id": "30868056", "url": "https://pubmed.ncbi.nlm.nih.gov/30868056" }, { "database": "PubMed", "id": "30881947", "url": "https://pubmed.ncbi.nlm.nih.gov/30881947" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "30932278", "url": "https://pubmed.ncbi.nlm.nih.gov/30932278" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30966857", "url": "https://pubmed.ncbi.nlm.nih.gov/30966857" }, { "database": "PubMed", "id": "30975543", "url": "https://pubmed.ncbi.nlm.nih.gov/30975543" }, { "database": "PubMed", "id": "30982228", "url": "https://pubmed.ncbi.nlm.nih.gov/30982228" }, { "database": "PubMed", "id": "31039479", "url": "https://pubmed.ncbi.nlm.nih.gov/31039479" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31111215", "url": "https://pubmed.ncbi.nlm.nih.gov/31111215" }, { "database": "PubMed", "id": "31120902", "url": "https://pubmed.ncbi.nlm.nih.gov/31120902" }, { "database": "PubMed", "id": "31138113", "url": "https://pubmed.ncbi.nlm.nih.gov/31138113" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31217894", "url": "https://pubmed.ncbi.nlm.nih.gov/31217894" }, { "database": "PubMed", "id": "31231694", "url": "https://pubmed.ncbi.nlm.nih.gov/31231694" }, { "database": "PubMed", "id": "31336690", "url": "https://pubmed.ncbi.nlm.nih.gov/31336690" }, { "database": "PubMed", "id": "31360122", "url": "https://pubmed.ncbi.nlm.nih.gov/31360122" }, { "database": "PubMed", "id": "31366902", "url": "https://pubmed.ncbi.nlm.nih.gov/31366902" }, { "database": "PubMed", "id": "31379409", "url": "https://pubmed.ncbi.nlm.nih.gov/31379409" }, { "database": "PubMed", "id": "31388677", "url": "https://pubmed.ncbi.nlm.nih.gov/31388677" }, { "database": "PubMed", "id": "31421458", "url": "https://pubmed.ncbi.nlm.nih.gov/31421458" }, { "database": "PubMed", "id": "31462218", "url": "https://pubmed.ncbi.nlm.nih.gov/31462218" }, { "database": "PubMed", "id": "31551768", "url": "https://pubmed.ncbi.nlm.nih.gov/31551768" }, { "database": "PubMed", "id": "31594538", "url": "https://pubmed.ncbi.nlm.nih.gov/31594538" }, { "database": "PubMed", "id": "31596196", "url": "https://pubmed.ncbi.nlm.nih.gov/31596196" }, { "database": "PubMed", "id": "31615975", "url": "https://pubmed.ncbi.nlm.nih.gov/31615975" }, { "database": "PubMed", "id": "31699974", "url": "https://pubmed.ncbi.nlm.nih.gov/31699974" }, { "database": "PubMed", "id": "31804459", "url": "https://pubmed.ncbi.nlm.nih.gov/31804459" }, { "database": "PubMed", "id": "31821701", "url": "https://pubmed.ncbi.nlm.nih.gov/31821701" }, { "database": "PubMed", "id": "31844686", "url": "https://pubmed.ncbi.nlm.nih.gov/31844686" }, { "database": "PubMed", "id": "31847237", "url": "https://pubmed.ncbi.nlm.nih.gov/31847237" }, { "database": "PubMed", "id": "31861721", "url": "https://pubmed.ncbi.nlm.nih.gov/31861721" }, { "database": "PubMed", "id": "31979361", "url": "https://pubmed.ncbi.nlm.nih.gov/31979361" }, { "database": "PubMed", "id": "32001678", "url": "https://pubmed.ncbi.nlm.nih.gov/32001678" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32054925", "url": "https://pubmed.ncbi.nlm.nih.gov/32054925" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32168910", "url": "https://pubmed.ncbi.nlm.nih.gov/32168910" }, { "database": "PubMed", "id": "32213959", "url": "https://pubmed.ncbi.nlm.nih.gov/32213959" }, { "database": "PubMed", "id": "32260204", "url": "https://pubmed.ncbi.nlm.nih.gov/32260204" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32427887", "url": "https://pubmed.ncbi.nlm.nih.gov/32427887" }, { "database": "PubMed", "id": "32432260", "url": "https://pubmed.ncbi.nlm.nih.gov/32432260" }, { "database": "PubMed", "id": "32492656", "url": "https://pubmed.ncbi.nlm.nih.gov/32492656" }, { "database": "PubMed", "id": "32560563", "url": "https://pubmed.ncbi.nlm.nih.gov/32560563" }, { "database": "PubMed", "id": "32605139", "url": "https://pubmed.ncbi.nlm.nih.gov/32605139" }, { "database": "PubMed", "id": "32617134", "url": "https://pubmed.ncbi.nlm.nih.gov/32617134" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32724100", "url": "https://pubmed.ncbi.nlm.nih.gov/32724100" }, { "database": "PubMed", "id": "32733438", "url": "https://pubmed.ncbi.nlm.nih.gov/32733438" }, { "database": "PubMed", "id": "32735894", "url": "https://pubmed.ncbi.nlm.nih.gov/32735894" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863918", "url": "https://pubmed.ncbi.nlm.nih.gov/32863918" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "32929340", "url": "https://pubmed.ncbi.nlm.nih.gov/32929340" }, { "database": "PubMed", "id": "32945487", "url": "https://pubmed.ncbi.nlm.nih.gov/32945487" }, { "database": "PubMed", "id": "32978372", "url": "https://pubmed.ncbi.nlm.nih.gov/32978372" }, { "database": "PubMed", "id": "33014050", "url": "https://pubmed.ncbi.nlm.nih.gov/33014050" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33061640", "url": "https://pubmed.ncbi.nlm.nih.gov/33061640" }, { "database": "PubMed", "id": "33074128", "url": "https://pubmed.ncbi.nlm.nih.gov/33074128" }, { "database": "PubMed", "id": "33085644", "url": "https://pubmed.ncbi.nlm.nih.gov/33085644" }, { "database": "PubMed", "id": "33097607", "url": "https://pubmed.ncbi.nlm.nih.gov/33097607" }, { "database": "PubMed", "id": "33110364", "url": "https://pubmed.ncbi.nlm.nih.gov/33110364" }, { "database": "PubMed", "id": "33146634", "url": "https://pubmed.ncbi.nlm.nih.gov/33146634" }, { "database": "PubMed", "id": "33166398", "url": "https://pubmed.ncbi.nlm.nih.gov/33166398" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33245719", "url": "https://pubmed.ncbi.nlm.nih.gov/33245719" }, { "database": "PubMed", "id": "33251333", "url": "https://pubmed.ncbi.nlm.nih.gov/33251333" }, { "database": "PubMed", "id": "33297931", "url": "https://pubmed.ncbi.nlm.nih.gov/33297931" }, { "database": "PubMed", "id": "33303632", "url": "https://pubmed.ncbi.nlm.nih.gov/33303632" }, { "database": "PubMed", "id": "33391525", "url": "https://pubmed.ncbi.nlm.nih.gov/33391525" }, { "database": "PubMed", "id": "33396303", "url": "https://pubmed.ncbi.nlm.nih.gov/33396303" }, { "database": "PubMed", "id": "33411764", "url": "https://pubmed.ncbi.nlm.nih.gov/33411764" }, { "database": "PubMed", "id": "33431809", "url": "https://pubmed.ncbi.nlm.nih.gov/33431809" }, { "database": "PubMed", "id": "33503543", "url": "https://pubmed.ncbi.nlm.nih.gov/33503543" }, { "database": "PubMed", "id": "33536467", "url": "https://pubmed.ncbi.nlm.nih.gov/33536467" }, { "database": "PubMed", "id": "33585229", "url": "https://pubmed.ncbi.nlm.nih.gov/33585229" }, { "database": "PubMed", "id": "33669867", "url": "https://pubmed.ncbi.nlm.nih.gov/33669867" }, { "database": "PubMed", "id": "33745968", "url": "https://pubmed.ncbi.nlm.nih.gov/33745968" }, { "database": "PubMed", "id": "33761896", "url": "https://pubmed.ncbi.nlm.nih.gov/33761896" }, { "database": "PubMed", "id": "33804124", "url": "https://pubmed.ncbi.nlm.nih.gov/33804124" }, { "database": "PubMed", "id": "33808426", "url": "https://pubmed.ncbi.nlm.nih.gov/33808426" }, { "database": "PubMed", "id": "33850227", "url": "https://pubmed.ncbi.nlm.nih.gov/33850227" }, { "database": "PubMed", "id": "33898425", "url": "https://pubmed.ncbi.nlm.nih.gov/33898425" }, { "database": "PubMed", "id": "33899121", "url": "https://pubmed.ncbi.nlm.nih.gov/33899121" }, { "database": "PubMed", "id": "33982778", "url": "https://pubmed.ncbi.nlm.nih.gov/33982778" }, { "database": "PubMed", "id": "33982878", "url": "https://pubmed.ncbi.nlm.nih.gov/33982878" }, { "database": "PubMed", "id": "34103468", "url": "https://pubmed.ncbi.nlm.nih.gov/34103468" }, { "database": "PubMed", "id": "34930892", "url": "https://pubmed.ncbi.nlm.nih.gov/34930892" }, { "database": "PubMed", "id": "35143532", "url": "https://pubmed.ncbi.nlm.nih.gov/35143532" }, { "database": "PubMed", "id": "35312310", "url": "https://pubmed.ncbi.nlm.nih.gov/35312310" }, { "database": "PubMed", "id": "35752942", "url": "https://pubmed.ncbi.nlm.nih.gov/35752942" }, { "database": "PubMed", "id": "35792512", "url": "https://pubmed.ncbi.nlm.nih.gov/35792512" }, { "database": "PubMed", "id": "35829882", "url": "https://pubmed.ncbi.nlm.nih.gov/35829882" }, { "database": "PubMed", "id": "35834822", "url": "https://pubmed.ncbi.nlm.nih.gov/35834822" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "36094323", "url": "https://pubmed.ncbi.nlm.nih.gov/36094323" }, { "database": "PubMed", "id": "36293376", "url": "https://pubmed.ncbi.nlm.nih.gov/36293376" }, { "database": "PubMed", "id": "36300938", "url": "https://pubmed.ncbi.nlm.nih.gov/36300938" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8502477", "url": "https://pubmed.ncbi.nlm.nih.gov/8502477" }, { "database": "PubMed", "id": "9407038", "url": "https://pubmed.ncbi.nlm.nih.gov/9407038" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9733514", "url": "https://pubmed.ncbi.nlm.nih.gov/9733514" }, { "database": "PubMed", "id": "9733515", "url": "https://pubmed.ncbi.nlm.nih.gov/9733515" }, { "database": "PubMed", "id": "9830059", "url": "https://pubmed.ncbi.nlm.nih.gov/9830059" }, { "database": "PubMed", "id": "9843217", "url": "https://pubmed.ncbi.nlm.nih.gov/9843217" }, { "database": "PubMed", "id": "11554766", "url": "https://pubmed.ncbi.nlm.nih.gov/11554766" } ], "site_lbl": "Ser15", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5, PRPK, AMPK, NUAK1 and ATM", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "10864201", "url": "https://pubmed.ncbi.nlm.nih.gov/10864201" }, { "database": "PubMed", "id": "15580310", "url": "https://pubmed.ncbi.nlm.nih.gov/15580310" }, { "database": "IntAct", "id": "P04637", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04637*" }, { "database": "PubMed", "id": "19883646", "url": "https://pubmed.ncbi.nlm.nih.gov/19883646" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "15866171", "url": "https://pubmed.ncbi.nlm.nih.gov/15866171" }, { "database": "PubMed", "id": "17591690", "url": "https://pubmed.ncbi.nlm.nih.gov/17591690" }, { "database": "PubMed", "id": "19828454", "url": "https://pubmed.ncbi.nlm.nih.gov/19828454" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PubMed", "id": "9925639", "url": "https://pubmed.ncbi.nlm.nih.gov/9925639" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "10202145", "url": "https://pubmed.ncbi.nlm.nih.gov/10202145" }, { "database": "PubMed", "id": "10606744", "url": "https://pubmed.ncbi.nlm.nih.gov/10606744" }, { "database": "PubMed", "id": "14712210", "url": "https://pubmed.ncbi.nlm.nih.gov/14712210" }, { "database": "PubMed", "id": "15642743", "url": "https://pubmed.ncbi.nlm.nih.gov/15642743" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "10082548", "url": "https://pubmed.ncbi.nlm.nih.gov/10082548" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10435622", "url": "https://pubmed.ncbi.nlm.nih.gov/10435622" }, { "database": "PubMed", "id": "10485486", "url": "https://pubmed.ncbi.nlm.nih.gov/10485486" }, { "database": "PubMed", "id": "10500142", "url": "https://pubmed.ncbi.nlm.nih.gov/10500142" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10544021", "url": "https://pubmed.ncbi.nlm.nih.gov/10544021" }, { "database": "PubMed", "id": "10570149", "url": "https://pubmed.ncbi.nlm.nih.gov/10570149" }, { "database": "PubMed", "id": "10601022", "url": "https://pubmed.ncbi.nlm.nih.gov/10601022" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10713094", "url": "https://pubmed.ncbi.nlm.nih.gov/10713094" }, { "database": "PubMed", "id": "10723129", "url": "https://pubmed.ncbi.nlm.nih.gov/10723129" }, { "database": "PubMed", "id": "10734067", "url": "https://pubmed.ncbi.nlm.nih.gov/10734067" }, { "database": "PubMed", "id": "10734308", "url": "https://pubmed.ncbi.nlm.nih.gov/10734308" }, { "database": "PubMed", "id": "10749144", "url": "https://pubmed.ncbi.nlm.nih.gov/10749144" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10860736", "url": "https://pubmed.ncbi.nlm.nih.gov/10860736" }, { "database": "PubMed", "id": "10930428", "url": "https://pubmed.ncbi.nlm.nih.gov/10930428" }, { "database": "PubMed", "id": "11042698", "url": "https://pubmed.ncbi.nlm.nih.gov/11042698" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11096068", "url": "https://pubmed.ncbi.nlm.nih.gov/11096068" }, { "database": "PubMed", "id": "11099484", "url": "https://pubmed.ncbi.nlm.nih.gov/11099484" }, { "database": "PubMed", "id": "11103796", "url": "https://pubmed.ncbi.nlm.nih.gov/11103796" }, { "database": "PubMed", "id": "11121242", "url": "https://pubmed.ncbi.nlm.nih.gov/11121242" }, { "database": "PubMed", "id": "11149936", "url": "https://pubmed.ncbi.nlm.nih.gov/11149936" }, { "database": "PubMed", "id": "11244509", "url": "https://pubmed.ncbi.nlm.nih.gov/11244509" }, { "database": "PubMed", "id": "11245472", "url": "https://pubmed.ncbi.nlm.nih.gov/11245472" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11313957", "url": "https://pubmed.ncbi.nlm.nih.gov/11313957" }, { "database": "PubMed", "id": "11314044", "url": "https://pubmed.ncbi.nlm.nih.gov/11314044" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11326311", "url": "https://pubmed.ncbi.nlm.nih.gov/11326311" }, { "database": "PubMed", "id": "11397945", "url": "https://pubmed.ncbi.nlm.nih.gov/11397945" }, { "database": "PubMed", "id": "11447225", "url": "https://pubmed.ncbi.nlm.nih.gov/11447225" }, { "database": "PubMed", "id": "11470744", "url": "https://pubmed.ncbi.nlm.nih.gov/11470744" }, { "database": "PubMed", "id": "11483158", "url": "https://pubmed.ncbi.nlm.nih.gov/11483158" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11495913", "url": "https://pubmed.ncbi.nlm.nih.gov/11495913" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11568365", "url": "https://pubmed.ncbi.nlm.nih.gov/11568365" }, { "database": "PubMed", "id": "11583595", "url": "https://pubmed.ncbi.nlm.nih.gov/11583595" }, { "database": "PubMed", "id": "11602639", "url": "https://pubmed.ncbi.nlm.nih.gov/11602639" }, { "database": "PubMed", "id": "11706017", "url": "https://pubmed.ncbi.nlm.nih.gov/11706017" }, { "database": "PubMed", "id": "11709713", "url": "https://pubmed.ncbi.nlm.nih.gov/11709713" }, { "database": "PubMed", "id": "11751391", "url": "https://pubmed.ncbi.nlm.nih.gov/11751391" }, { "database": "PubMed", "id": "11850826", "url": "https://pubmed.ncbi.nlm.nih.gov/11850826" }, { "database": "PubMed", "id": "11857452", "url": "https://pubmed.ncbi.nlm.nih.gov/11857452" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11865061", "url": "https://pubmed.ncbi.nlm.nih.gov/11865061" }, { "database": "PubMed", "id": "11875057", "url": "https://pubmed.ncbi.nlm.nih.gov/11875057" }, { "database": "PubMed", "id": "11877452", "url": "https://pubmed.ncbi.nlm.nih.gov/11877452" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "11927575", "url": "https://pubmed.ncbi.nlm.nih.gov/11927575" }, { "database": "PubMed", "id": "11965244", "url": "https://pubmed.ncbi.nlm.nih.gov/11965244" }, { "database": "PubMed", "id": "11973611", "url": "https://pubmed.ncbi.nlm.nih.gov/11973611" }, { "database": "PubMed", "id": "12066222", "url": "https://pubmed.ncbi.nlm.nih.gov/12066222" }, { "database": "PubMed", "id": "12071847", "url": "https://pubmed.ncbi.nlm.nih.gov/12071847" }, { "database": "PubMed", "id": "12082025", "url": "https://pubmed.ncbi.nlm.nih.gov/12082025" }, { "database": "PubMed", "id": "12082529", "url": "https://pubmed.ncbi.nlm.nih.gov/12082529" }, { "database": "PubMed", "id": "12091386", "url": "https://pubmed.ncbi.nlm.nih.gov/12091386" }, { "database": "PubMed", "id": "12131363", "url": "https://pubmed.ncbi.nlm.nih.gov/12131363" }, { "database": "PubMed", "id": "12145207", "url": "https://pubmed.ncbi.nlm.nih.gov/12145207" }, { "database": "PubMed", "id": "12151394", "url": "https://pubmed.ncbi.nlm.nih.gov/12151394" }, { "database": "PubMed", "id": "12238331", "url": "https://pubmed.ncbi.nlm.nih.gov/12238331" }, { "database": "PubMed", "id": "12381304", "url": "https://pubmed.ncbi.nlm.nih.gov/12381304" }, { "database": "PubMed", "id": "12393500", "url": "https://pubmed.ncbi.nlm.nih.gov/12393500" }, { "database": "PubMed", "id": "12419181", "url": "https://pubmed.ncbi.nlm.nih.gov/12419181" }, { "database": "PubMed", "id": "12427754", "url": "https://pubmed.ncbi.nlm.nih.gov/12427754" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12478472", "url": "https://pubmed.ncbi.nlm.nih.gov/12478472" }, { "database": "PubMed", "id": "12518062", "url": "https://pubmed.ncbi.nlm.nih.gov/12518062" }, { "database": "PubMed", "id": "12519780", "url": "https://pubmed.ncbi.nlm.nih.gov/12519780" }, { "database": "PubMed", "id": "12531896", "url": "https://pubmed.ncbi.nlm.nih.gov/12531896" }, { "database": "PubMed", "id": "12534344", "url": "https://pubmed.ncbi.nlm.nih.gov/12534344" }, { "database": "PubMed", "id": "12584171", "url": "https://pubmed.ncbi.nlm.nih.gov/12584171" }, { "database": "PubMed", "id": "12606123", "url": "https://pubmed.ncbi.nlm.nih.gov/12606123" }, { "database": "PubMed", "id": "12612087", "url": "https://pubmed.ncbi.nlm.nih.gov/12612087" }, { "database": "PubMed", "id": "12644594", "url": "https://pubmed.ncbi.nlm.nih.gov/12644594" }, { "database": "PubMed", "id": "12659830", "url": "https://pubmed.ncbi.nlm.nih.gov/12659830" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12698201", "url": "https://pubmed.ncbi.nlm.nih.gov/12698201" }, { "database": "PubMed", "id": "12702572", "url": "https://pubmed.ncbi.nlm.nih.gov/12702572" }, { "database": "PubMed", "id": "12719724", "url": "https://pubmed.ncbi.nlm.nih.gov/12719724" }, { "database": "PubMed", "id": "12756247", "url": "https://pubmed.ncbi.nlm.nih.gov/12756247" }, { "database": "PubMed", "id": "12767922", "url": "https://pubmed.ncbi.nlm.nih.gov/12767922" }, { "database": "PubMed", "id": "12811820", "url": "https://pubmed.ncbi.nlm.nih.gov/12811820" }, { "database": "PubMed", "id": "12853888", "url": "https://pubmed.ncbi.nlm.nih.gov/12853888" }, { "database": "PubMed", "id": "12857758", "url": "https://pubmed.ncbi.nlm.nih.gov/12857758" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12902982", "url": "https://pubmed.ncbi.nlm.nih.gov/12902982" }, { "database": "PubMed", "id": "12912974", "url": "https://pubmed.ncbi.nlm.nih.gov/12912974" }, { "database": "PubMed", "id": "12919932", "url": "https://pubmed.ncbi.nlm.nih.gov/12919932" }, { "database": "PubMed", "id": "12939400", "url": "https://pubmed.ncbi.nlm.nih.gov/12939400" }, { "database": "PubMed", "id": "12951835", "url": "https://pubmed.ncbi.nlm.nih.gov/12951835" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "12968928", "url": "https://pubmed.ncbi.nlm.nih.gov/12968928" }, { "database": "PubMed", "id": "13678348", "url": "https://pubmed.ncbi.nlm.nih.gov/13678348" }, { "database": "PubMed", "id": "1406679", "url": "https://pubmed.ncbi.nlm.nih.gov/1406679" }, { "database": "PubMed", "id": "14511359", "url": "https://pubmed.ncbi.nlm.nih.gov/14511359" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14527925", "url": "https://pubmed.ncbi.nlm.nih.gov/14527925" }, { "database": "PubMed", "id": "14559802", "url": "https://pubmed.ncbi.nlm.nih.gov/14559802" }, { "database": "PubMed", "id": "14612532", "url": "https://pubmed.ncbi.nlm.nih.gov/14612532" }, { "database": "PubMed", "id": "14617104", "url": "https://pubmed.ncbi.nlm.nih.gov/14617104" }, { "database": "PubMed", "id": "14623946", "url": "https://pubmed.ncbi.nlm.nih.gov/14623946" }, { "database": "PubMed", "id": "14637186", "url": "https://pubmed.ncbi.nlm.nih.gov/14637186" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14755247", "url": "https://pubmed.ncbi.nlm.nih.gov/14755247" }, { "database": "PubMed", "id": "14757188", "url": "https://pubmed.ncbi.nlm.nih.gov/14757188" }, { "database": "PubMed", "id": "14871840", "url": "https://pubmed.ncbi.nlm.nih.gov/14871840" }, { "database": "PubMed", "id": "14965474", "url": "https://pubmed.ncbi.nlm.nih.gov/14965474" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "14968111", "url": "https://pubmed.ncbi.nlm.nih.gov/14968111" }, { "database": "PubMed", "id": "14993250", "url": "https://pubmed.ncbi.nlm.nih.gov/14993250" }, { "database": "PubMed", "id": "15001399", "url": "https://pubmed.ncbi.nlm.nih.gov/15001399" }, { "database": "PubMed", "id": "15026814", "url": "https://pubmed.ncbi.nlm.nih.gov/15026814" }, { "database": "PubMed", "id": "15077171", "url": "https://pubmed.ncbi.nlm.nih.gov/15077171" }, { "database": "PubMed", "id": "15081425", "url": "https://pubmed.ncbi.nlm.nih.gov/15081425" }, { "database": "PubMed", "id": "15095398", "url": "https://pubmed.ncbi.nlm.nih.gov/15095398" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15159397", "url": "https://pubmed.ncbi.nlm.nih.gov/15159397" }, { "database": "PubMed", "id": "15159417", "url": "https://pubmed.ncbi.nlm.nih.gov/15159417" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15178317", "url": "https://pubmed.ncbi.nlm.nih.gov/15178317" }, { "database": "PubMed", "id": "15178764", "url": "https://pubmed.ncbi.nlm.nih.gov/15178764" }, { "database": "PubMed", "id": "15181149", "url": "https://pubmed.ncbi.nlm.nih.gov/15181149" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15199542", "url": "https://pubmed.ncbi.nlm.nih.gov/15199542" }, { "database": "PubMed", "id": "15226436", "url": "https://pubmed.ncbi.nlm.nih.gov/15226436" }, { "database": "PubMed", "id": "15252149", "url": "https://pubmed.ncbi.nlm.nih.gov/15252149" }, { "database": "PubMed", "id": "15254178", "url": "https://pubmed.ncbi.nlm.nih.gov/15254178" }, { "database": "PubMed", "id": "15289875", "url": "https://pubmed.ncbi.nlm.nih.gov/15289875" }, { "database": "PubMed", "id": "15310764", "url": "https://pubmed.ncbi.nlm.nih.gov/15310764" }, { "database": "PubMed", "id": "15322239", "url": "https://pubmed.ncbi.nlm.nih.gov/15322239" }, { "database": "PubMed", "id": "15355354", "url": "https://pubmed.ncbi.nlm.nih.gov/15355354" }, { "database": "PubMed", "id": "15381086", "url": "https://pubmed.ncbi.nlm.nih.gov/15381086" }, { "database": "PubMed", "id": "15456759", "url": "https://pubmed.ncbi.nlm.nih.gov/15456759" }, { "database": "PubMed", "id": "15464845", "url": "https://pubmed.ncbi.nlm.nih.gov/15464845" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15474986", "url": "https://pubmed.ncbi.nlm.nih.gov/15474986" }, { "database": "PubMed", "id": "15489892", "url": "https://pubmed.ncbi.nlm.nih.gov/15489892" }, { "database": "PubMed", "id": "15492510", "url": "https://pubmed.ncbi.nlm.nih.gov/15492510" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15533933", "url": "https://pubmed.ncbi.nlm.nih.gov/15533933" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15542774", "url": "https://pubmed.ncbi.nlm.nih.gov/15542774" }, { "database": "PubMed", "id": "15557124", "url": "https://pubmed.ncbi.nlm.nih.gov/15557124" }, { "database": "PubMed", "id": "15613785", "url": "https://pubmed.ncbi.nlm.nih.gov/15613785" }, { "database": "PubMed", "id": "15650224", "url": "https://pubmed.ncbi.nlm.nih.gov/15650224" }, { "database": "PubMed", "id": "15657356", "url": "https://pubmed.ncbi.nlm.nih.gov/15657356" }, { "database": "PubMed", "id": "15710360", "url": "https://pubmed.ncbi.nlm.nih.gov/15710360" }, { "database": "PubMed", "id": "15713892", "url": "https://pubmed.ncbi.nlm.nih.gov/15713892" }, { "database": "PubMed", "id": "15720815", "url": "https://pubmed.ncbi.nlm.nih.gov/15720815" }, { "database": "PubMed", "id": "15735102", "url": "https://pubmed.ncbi.nlm.nih.gov/15735102" }, { "database": "PubMed", "id": "15752772", "url": "https://pubmed.ncbi.nlm.nih.gov/15752772" }, { "database": "PubMed", "id": "15782130", "url": "https://pubmed.ncbi.nlm.nih.gov/15782130" }, { "database": "PubMed", "id": "15794754", "url": "https://pubmed.ncbi.nlm.nih.gov/15794754" }, { "database": "PubMed", "id": "15795939", "url": "https://pubmed.ncbi.nlm.nih.gov/15795939" }, { "database": "PubMed", "id": "15837074", "url": "https://pubmed.ncbi.nlm.nih.gov/15837074" }, { "database": "PubMed", "id": "15845651", "url": "https://pubmed.ncbi.nlm.nih.gov/15845651" }, { "database": "PubMed", "id": "15867353", "url": "https://pubmed.ncbi.nlm.nih.gov/15867353" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "15908423", "url": "https://pubmed.ncbi.nlm.nih.gov/15908423" }, { "database": "PubMed", "id": "16024610", "url": "https://pubmed.ncbi.nlm.nih.gov/16024610" }, { "database": "PubMed", "id": "16024799", "url": "https://pubmed.ncbi.nlm.nih.gov/16024799" }, { "database": "PubMed", "id": "16043514", "url": "https://pubmed.ncbi.nlm.nih.gov/16043514" }, { "database": "PubMed", "id": "16082226", "url": "https://pubmed.ncbi.nlm.nih.gov/16082226" }, { "database": "PubMed", "id": "16096427", "url": "https://pubmed.ncbi.nlm.nih.gov/16096427" }, { "database": "PubMed", "id": "16103197", "url": "https://pubmed.ncbi.nlm.nih.gov/16103197" }, { "database": "PubMed", "id": "16140041", "url": "https://pubmed.ncbi.nlm.nih.gov/16140041" }, { "database": "PubMed", "id": "16177561", "url": "https://pubmed.ncbi.nlm.nih.gov/16177561" }, { "database": "PubMed", "id": "16179498", "url": "https://pubmed.ncbi.nlm.nih.gov/16179498" }, { "database": "PubMed", "id": "16180010", "url": "https://pubmed.ncbi.nlm.nih.gov/16180010" }, { "database": "PubMed", "id": "16227412", "url": "https://pubmed.ncbi.nlm.nih.gov/16227412" }, { "database": "PubMed", "id": "16229013", "url": "https://pubmed.ncbi.nlm.nih.gov/16229013" }, { "database": "PubMed", "id": "16302093", "url": "https://pubmed.ncbi.nlm.nih.gov/16302093" }, { "database": "PubMed", "id": "16313886", "url": "https://pubmed.ncbi.nlm.nih.gov/16313886" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16322229", "url": "https://pubmed.ncbi.nlm.nih.gov/16322229" }, { "database": "PubMed", "id": "16397295", "url": "https://pubmed.ncbi.nlm.nih.gov/16397295" }, { "database": "PubMed", "id": "16414131", "url": "https://pubmed.ncbi.nlm.nih.gov/16414131" }, { "database": "PubMed", "id": "16433685", "url": "https://pubmed.ncbi.nlm.nih.gov/16433685" }, { "database": "PubMed", "id": "16436515", "url": "https://pubmed.ncbi.nlm.nih.gov/16436515" }, { "database": "PubMed", "id": "16474133", "url": "https://pubmed.ncbi.nlm.nih.gov/16474133" }, { "database": "PubMed", "id": "16489034", "url": "https://pubmed.ncbi.nlm.nih.gov/16489034" }, { "database": "PubMed", "id": "16501611", "url": "https://pubmed.ncbi.nlm.nih.gov/16501611" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16538517", "url": "https://pubmed.ncbi.nlm.nih.gov/16538517" }, { "database": "PubMed", "id": "16584535", "url": "https://pubmed.ncbi.nlm.nih.gov/16584535" }, { "database": "PubMed", "id": "16600182", "url": "https://pubmed.ncbi.nlm.nih.gov/16600182" }, { "database": "PubMed", "id": "16611888", "url": "https://pubmed.ncbi.nlm.nih.gov/16611888" }, { "database": "PubMed", "id": "16618811", "url": "https://pubmed.ncbi.nlm.nih.gov/16618811" }, { "database": "PubMed", "id": "16630142", "url": "https://pubmed.ncbi.nlm.nih.gov/16630142" }, { "database": "PubMed", "id": "16632641", "url": "https://pubmed.ncbi.nlm.nih.gov/16632641" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16705155", "url": "https://pubmed.ncbi.nlm.nih.gov/16705155" }, { "database": "PubMed", "id": "16714289", "url": "https://pubmed.ncbi.nlm.nih.gov/16714289" }, { "database": "PubMed", "id": "16715525", "url": "https://pubmed.ncbi.nlm.nih.gov/16715525" }, { "database": "PubMed", "id": "16731759", "url": "https://pubmed.ncbi.nlm.nih.gov/16731759" }, { "database": "PubMed", "id": "16751801", "url": "https://pubmed.ncbi.nlm.nih.gov/16751801" }, { "database": "PubMed", "id": "16753148", "url": "https://pubmed.ncbi.nlm.nih.gov/16753148" }, { "database": "PubMed", "id": "16777994", "url": "https://pubmed.ncbi.nlm.nih.gov/16777994" }, { "database": "PubMed", "id": "16778146", "url": "https://pubmed.ncbi.nlm.nih.gov/16778146" }, { "database": "PubMed", "id": "16801388", "url": "https://pubmed.ncbi.nlm.nih.gov/16801388" }, { "database": "PubMed", "id": "16814113", "url": "https://pubmed.ncbi.nlm.nih.gov/16814113" }, { "database": "PubMed", "id": "16815295", "url": "https://pubmed.ncbi.nlm.nih.gov/16815295" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16827804", "url": "https://pubmed.ncbi.nlm.nih.gov/16827804" }, { "database": "PubMed", "id": "16891474", "url": "https://pubmed.ncbi.nlm.nih.gov/16891474" }, { "database": "PubMed", "id": "16912307", "url": "https://pubmed.ncbi.nlm.nih.gov/16912307" }, { "database": "PubMed", "id": "16928824", "url": "https://pubmed.ncbi.nlm.nih.gov/16928824" }, { "database": "PubMed", "id": "16966622", "url": "https://pubmed.ncbi.nlm.nih.gov/16966622" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "16971507", "url": "https://pubmed.ncbi.nlm.nih.gov/16971507" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "17113036", "url": "https://pubmed.ncbi.nlm.nih.gov/17113036" }, { "database": "PubMed", "id": "17126818", "url": "https://pubmed.ncbi.nlm.nih.gov/17126818" }, { "database": "PubMed", "id": "17172431", "url": "https://pubmed.ncbi.nlm.nih.gov/17172431" }, { "database": "PubMed", "id": "17174366", "url": "https://pubmed.ncbi.nlm.nih.gov/17174366" }, { "database": "PubMed", "id": "17230520", "url": "https://pubmed.ncbi.nlm.nih.gov/17230520" }, { "database": "PubMed", "id": "17241873", "url": "https://pubmed.ncbi.nlm.nih.gov/17241873" }, { "database": "PubMed", "id": "17257432", "url": "https://pubmed.ncbi.nlm.nih.gov/17257432" }, { "database": "PubMed", "id": "17292432", "url": "https://pubmed.ncbi.nlm.nih.gov/17292432" }, { "database": "PubMed", "id": "17297446", "url": "https://pubmed.ncbi.nlm.nih.gov/17297446" }, { "database": "PubMed", "id": "17301063", "url": "https://pubmed.ncbi.nlm.nih.gov/17301063" }, { "database": "PubMed", "id": "17332930", "url": "https://pubmed.ncbi.nlm.nih.gov/17332930" }, { "database": "PubMed", "id": "17334779", "url": "https://pubmed.ncbi.nlm.nih.gov/17334779" }, { "database": "PubMed", "id": "17456577", "url": "https://pubmed.ncbi.nlm.nih.gov/17456577" }, { "database": "PubMed", "id": "17509529", "url": "https://pubmed.ncbi.nlm.nih.gov/17509529" }, { "database": "PubMed", "id": "17510082", "url": "https://pubmed.ncbi.nlm.nih.gov/17510082" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17512204", "url": "https://pubmed.ncbi.nlm.nih.gov/17512204" }, { "database": "PubMed", "id": "17517898", "url": "https://pubmed.ncbi.nlm.nih.gov/17517898" }, { "database": "PubMed", "id": "17524349", "url": "https://pubmed.ncbi.nlm.nih.gov/17524349" }, { "database": "PubMed", "id": "17535811", "url": "https://pubmed.ncbi.nlm.nih.gov/17535811" }, { "database": "PubMed", "id": "17575952", "url": "https://pubmed.ncbi.nlm.nih.gov/17575952" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17596534", "url": "https://pubmed.ncbi.nlm.nih.gov/17596534" }, { "database": "PubMed", "id": "17610031", "url": "https://pubmed.ncbi.nlm.nih.gov/17610031" }, { "database": "PubMed", "id": "17612589", "url": "https://pubmed.ncbi.nlm.nih.gov/17612589" }, { "database": "PubMed", "id": "17616578", "url": "https://pubmed.ncbi.nlm.nih.gov/17616578" }, { "database": "PubMed", "id": "17668048", "url": "https://pubmed.ncbi.nlm.nih.gov/17668048" }, { "database": "PubMed", "id": "17707793", "url": "https://pubmed.ncbi.nlm.nih.gov/17707793" }, { "database": "PubMed", "id": "17712528", "url": "https://pubmed.ncbi.nlm.nih.gov/17712528" }, { "database": "PubMed", "id": "17727682", "url": "https://pubmed.ncbi.nlm.nih.gov/17727682" }, { "database": "PubMed", "id": "17803907", "url": "https://pubmed.ncbi.nlm.nih.gov/17803907" }, { "database": "PubMed", "id": "17854787", "url": "https://pubmed.ncbi.nlm.nih.gov/17854787" }, { "database": "PubMed", "id": "17855337", "url": "https://pubmed.ncbi.nlm.nih.gov/17855337" }, { "database": "PubMed", "id": "17894897", "url": "https://pubmed.ncbi.nlm.nih.gov/17894897" }, { "database": "PubMed", "id": "17903248", "url": "https://pubmed.ncbi.nlm.nih.gov/17903248" }, { "database": "PubMed", "id": "17918180", "url": "https://pubmed.ncbi.nlm.nih.gov/17918180" }, { "database": "PubMed", "id": "17919456", "url": "https://pubmed.ncbi.nlm.nih.gov/17919456" }, { "database": "PubMed", "id": "17932621", "url": "https://pubmed.ncbi.nlm.nih.gov/17932621" }, { "database": "PubMed", "id": "17932951", "url": "https://pubmed.ncbi.nlm.nih.gov/17932951" }, { "database": "PubMed", "id": "17940507", "url": "https://pubmed.ncbi.nlm.nih.gov/17940507" }, { "database": "PubMed", "id": "17967874", "url": "https://pubmed.ncbi.nlm.nih.gov/17967874" }, { "database": "PubMed", "id": "17971768", "url": "https://pubmed.ncbi.nlm.nih.gov/17971768" }, { "database": "PubMed", "id": "17977830", "url": "https://pubmed.ncbi.nlm.nih.gov/17977830" }, { "database": "PubMed", "id": "18032786", "url": "https://pubmed.ncbi.nlm.nih.gov/18032786" }, { "database": "PubMed", "id": "18048073", "url": "https://pubmed.ncbi.nlm.nih.gov/18048073" }, { "database": "PubMed", "id": "18082226", "url": "https://pubmed.ncbi.nlm.nih.gov/18082226" }, { "database": "PubMed", "id": "18085531", "url": "https://pubmed.ncbi.nlm.nih.gov/18085531" }, { "database": "PubMed", "id": "18187512", "url": "https://pubmed.ncbi.nlm.nih.gov/18187512" }, { "database": "PubMed", "id": "18191923", "url": "https://pubmed.ncbi.nlm.nih.gov/18191923" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18272544", "url": "https://pubmed.ncbi.nlm.nih.gov/18272544" }, { "database": "PubMed", "id": "18289623", "url": "https://pubmed.ncbi.nlm.nih.gov/18289623" }, { "database": "PubMed", "id": "18294283", "url": "https://pubmed.ncbi.nlm.nih.gov/18294283" }, { "database": "PubMed", "id": "18311036", "url": "https://pubmed.ncbi.nlm.nih.gov/18311036" }, { "database": "PubMed", "id": "18339864", "url": "https://pubmed.ncbi.nlm.nih.gov/18339864" }, { "database": "PubMed", "id": "18344606", "url": "https://pubmed.ncbi.nlm.nih.gov/18344606" }, { "database": "PubMed", "id": "18348731", "url": "https://pubmed.ncbi.nlm.nih.gov/18348731" }, { "database": "PubMed", "id": "18366759", "url": "https://pubmed.ncbi.nlm.nih.gov/18366759" }, { "database": "PubMed", "id": "18381438", "url": "https://pubmed.ncbi.nlm.nih.gov/18381438" }, { "database": "PubMed", "id": "18406507", "url": "https://pubmed.ncbi.nlm.nih.gov/18406507" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18446786", "url": "https://pubmed.ncbi.nlm.nih.gov/18446786" }, { "database": "PubMed", "id": "18455128", "url": "https://pubmed.ncbi.nlm.nih.gov/18455128" }, { "database": "PubMed", "id": "18479896", "url": "https://pubmed.ncbi.nlm.nih.gov/18479896" }, { "database": "PubMed", "id": "18497347", "url": "https://pubmed.ncbi.nlm.nih.gov/18497347" }, { "database": "PubMed", "id": "18504176", "url": "https://pubmed.ncbi.nlm.nih.gov/18504176" }, { "database": "PubMed", "id": "18511169", "url": "https://pubmed.ncbi.nlm.nih.gov/18511169" }, { "database": "PubMed", "id": "18519674", "url": "https://pubmed.ncbi.nlm.nih.gov/18519674" }, { "database": "PubMed", "id": "18523653", "url": "https://pubmed.ncbi.nlm.nih.gov/18523653" }, { "database": "PubMed", "id": "18540044", "url": "https://pubmed.ncbi.nlm.nih.gov/18540044" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18585854", "url": "https://pubmed.ncbi.nlm.nih.gov/18585854" }, { "database": "PubMed", "id": "18589416", "url": "https://pubmed.ncbi.nlm.nih.gov/18589416" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18604166", "url": "https://pubmed.ncbi.nlm.nih.gov/18604166" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18642443", "url": "https://pubmed.ncbi.nlm.nih.gov/18642443" }, { "database": "PubMed", "id": "18660513", "url": "https://pubmed.ncbi.nlm.nih.gov/18660513" }, { "database": "PubMed", "id": "18661100", "url": "https://pubmed.ncbi.nlm.nih.gov/18661100" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18760266", "url": "https://pubmed.ncbi.nlm.nih.gov/18760266" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "18785202", "url": "https://pubmed.ncbi.nlm.nih.gov/18785202" }, { "database": "PubMed", "id": "18791269", "url": "https://pubmed.ncbi.nlm.nih.gov/18791269" }, { "database": "PubMed", "id": "18802408", "url": "https://pubmed.ncbi.nlm.nih.gov/18802408" }, { "database": "PubMed", "id": "18847491", "url": "https://pubmed.ncbi.nlm.nih.gov/18847491" }, { "database": "PubMed", "id": "18852884", "url": "https://pubmed.ncbi.nlm.nih.gov/18852884" }, { "database": "PubMed", "id": "18947885", "url": "https://pubmed.ncbi.nlm.nih.gov/18947885" }, { "database": "PubMed", "id": "19064630", "url": "https://pubmed.ncbi.nlm.nih.gov/19064630" }, { "database": "PubMed", "id": "19067706", "url": "https://pubmed.ncbi.nlm.nih.gov/19067706" }, { "database": "PubMed", "id": "19095450", "url": "https://pubmed.ncbi.nlm.nih.gov/19095450" }, { "database": "PubMed", "id": "19112505", "url": "https://pubmed.ncbi.nlm.nih.gov/19112505" }, { "database": "PubMed", "id": "19139065", "url": "https://pubmed.ncbi.nlm.nih.gov/19139065" }, { "database": "PubMed", "id": "19148495", "url": "https://pubmed.ncbi.nlm.nih.gov/19148495" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19166313", "url": "https://pubmed.ncbi.nlm.nih.gov/19166313" }, { "database": "PubMed", "id": "19221002", "url": "https://pubmed.ncbi.nlm.nih.gov/19221002" }, { "database": "PubMed", "id": "19225536", "url": "https://pubmed.ncbi.nlm.nih.gov/19225536" }, { "database": "PubMed", "id": "19295133", "url": "https://pubmed.ncbi.nlm.nih.gov/19295133" }, { "database": "PubMed", "id": "19303885", "url": "https://pubmed.ncbi.nlm.nih.gov/19303885" }, { "database": "PubMed", "id": "19357962", "url": "https://pubmed.ncbi.nlm.nih.gov/19357962" }, { "database": "PubMed", "id": "19363523", "url": "https://pubmed.ncbi.nlm.nih.gov/19363523" }, { "database": "PubMed", "id": "19373864", "url": "https://pubmed.ncbi.nlm.nih.gov/19373864" }, { "database": "PubMed", "id": "19397953", "url": "https://pubmed.ncbi.nlm.nih.gov/19397953" }, { "database": "PubMed", "id": "19398950", "url": "https://pubmed.ncbi.nlm.nih.gov/19398950" }, { "database": "PubMed", "id": "19426797", "url": "https://pubmed.ncbi.nlm.nih.gov/19426797" }, { "database": "PubMed", "id": "19454177", "url": "https://pubmed.ncbi.nlm.nih.gov/19454177" }, { "database": "PubMed", "id": "19459175", "url": "https://pubmed.ncbi.nlm.nih.gov/19459175" }, { "database": "PubMed", "id": "19525231", "url": "https://pubmed.ncbi.nlm.nih.gov/19525231" }, { "database": "PubMed", "id": "19536869", "url": "https://pubmed.ncbi.nlm.nih.gov/19536869" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19649319", "url": "https://pubmed.ncbi.nlm.nih.gov/19649319" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19660097", "url": "https://pubmed.ncbi.nlm.nih.gov/19660097" }, { "database": "PubMed", "id": "19674456", "url": "https://pubmed.ncbi.nlm.nih.gov/19674456" }, { "database": "PubMed", "id": "19705844", "url": "https://pubmed.ncbi.nlm.nih.gov/19705844" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19821510", "url": "https://pubmed.ncbi.nlm.nih.gov/19821510" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19934315", "url": "https://pubmed.ncbi.nlm.nih.gov/19934315" }, { "database": "PubMed", "id": "19952118", "url": "https://pubmed.ncbi.nlm.nih.gov/19952118" }, { "database": "PubMed", "id": "19960411", "url": "https://pubmed.ncbi.nlm.nih.gov/19960411" }, { "database": "PubMed", "id": "20005456", "url": "https://pubmed.ncbi.nlm.nih.gov/20005456" }, { "database": "PubMed", "id": "20005840", "url": "https://pubmed.ncbi.nlm.nih.gov/20005840" }, { "database": "PubMed", "id": "20016737", "url": "https://pubmed.ncbi.nlm.nih.gov/20016737" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20060030", "url": "https://pubmed.ncbi.nlm.nih.gov/20060030" }, { "database": "PubMed", "id": "20085646", "url": "https://pubmed.ncbi.nlm.nih.gov/20085646" }, { "database": "PubMed", "id": "20092938", "url": "https://pubmed.ncbi.nlm.nih.gov/20092938" }, { "database": "PubMed", "id": "20097305", "url": "https://pubmed.ncbi.nlm.nih.gov/20097305" }, { "database": "PubMed", "id": "20123963", "url": "https://pubmed.ncbi.nlm.nih.gov/20123963" }, { "database": "PubMed", "id": "20187950", "url": "https://pubmed.ncbi.nlm.nih.gov/20187950" }, { "database": "PubMed", "id": "20219657", "url": "https://pubmed.ncbi.nlm.nih.gov/20219657" }, { "database": "PubMed", "id": "20226587", "url": "https://pubmed.ncbi.nlm.nih.gov/20226587" }, { "database": "PubMed", "id": "20308316", "url": "https://pubmed.ncbi.nlm.nih.gov/20308316" }, { "database": "PubMed", "id": "20353948", "url": "https://pubmed.ncbi.nlm.nih.gov/20353948" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20413215", "url": "https://pubmed.ncbi.nlm.nih.gov/20413215" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20432447", "url": "https://pubmed.ncbi.nlm.nih.gov/20432447" }, { "database": "PubMed", "id": "20456495", "url": "https://pubmed.ncbi.nlm.nih.gov/20456495" }, { "database": "PubMed", "id": "20484174", "url": "https://pubmed.ncbi.nlm.nih.gov/20484174" }, { "database": "PubMed", "id": "20499882", "url": "https://pubmed.ncbi.nlm.nih.gov/20499882" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20543986", "url": "https://pubmed.ncbi.nlm.nih.gov/20543986" }, { "database": "PubMed", "id": "20549306", "url": "https://pubmed.ncbi.nlm.nih.gov/20549306" }, { "database": "PubMed", "id": "20566882", "url": "https://pubmed.ncbi.nlm.nih.gov/20566882" }, { "database": "PubMed", "id": "20622265", "url": "https://pubmed.ncbi.nlm.nih.gov/20622265" }, { "database": "PubMed", "id": "20663147", "url": "https://pubmed.ncbi.nlm.nih.gov/20663147" }, { "database": "PubMed", "id": "20693977", "url": "https://pubmed.ncbi.nlm.nih.gov/20693977" }, { "database": "PubMed", "id": "20708607", "url": "https://pubmed.ncbi.nlm.nih.gov/20708607" }, { "database": "PubMed", "id": "20717878", "url": "https://pubmed.ncbi.nlm.nih.gov/20717878" }, { "database": "PubMed", "id": "20809980", "url": "https://pubmed.ncbi.nlm.nih.gov/20809980" }, { "database": "PubMed", "id": "20840867", "url": "https://pubmed.ncbi.nlm.nih.gov/20840867" }, { "database": "PubMed", "id": "20886098", "url": "https://pubmed.ncbi.nlm.nih.gov/20886098" }, { "database": "PubMed", "id": "20931131", "url": "https://pubmed.ncbi.nlm.nih.gov/20931131" }, { "database": "PubMed", "id": "20948430", "url": "https://pubmed.ncbi.nlm.nih.gov/20948430" }, { "database": "PubMed", "id": "20974518", "url": "https://pubmed.ncbi.nlm.nih.gov/20974518" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "21045015", "url": "https://pubmed.ncbi.nlm.nih.gov/21045015" }, { "database": "PubMed", "id": "21078665", "url": "https://pubmed.ncbi.nlm.nih.gov/21078665" }, { "database": "PubMed", "id": "21114963", "url": "https://pubmed.ncbi.nlm.nih.gov/21114963" }, { "database": "PubMed", "id": "21118815", "url": "https://pubmed.ncbi.nlm.nih.gov/21118815" }, { "database": "PubMed", "id": "21163364", "url": "https://pubmed.ncbi.nlm.nih.gov/21163364" }, { "database": "PubMed", "id": "21167122", "url": "https://pubmed.ncbi.nlm.nih.gov/21167122" }, { "database": "PubMed", "id": "21225623", "url": "https://pubmed.ncbi.nlm.nih.gov/21225623" }, { "database": "PubMed", "id": "21261644", "url": "https://pubmed.ncbi.nlm.nih.gov/21261644" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21361779", "url": "https://pubmed.ncbi.nlm.nih.gov/21361779" }, { "database": "PubMed", "id": "21368894", "url": "https://pubmed.ncbi.nlm.nih.gov/21368894" }, { "database": "PubMed", "id": "21376392", "url": "https://pubmed.ncbi.nlm.nih.gov/21376392" }, { "database": "PubMed", "id": "21383020", "url": "https://pubmed.ncbi.nlm.nih.gov/21383020" }, { "database": "PubMed", "id": "21383696", "url": "https://pubmed.ncbi.nlm.nih.gov/21383696" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21394211", "url": "https://pubmed.ncbi.nlm.nih.gov/21394211" }, { "database": "PubMed", "id": "21432907", "url": "https://pubmed.ncbi.nlm.nih.gov/21432907" }, { "database": "PubMed", "id": "21451571", "url": "https://pubmed.ncbi.nlm.nih.gov/21451571" }, { "database": "PubMed", "id": "21465263", "url": "https://pubmed.ncbi.nlm.nih.gov/21465263" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21532991", "url": "https://pubmed.ncbi.nlm.nih.gov/21532991" }, { "database": "PubMed", "id": "21549095", "url": "https://pubmed.ncbi.nlm.nih.gov/21549095" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21576488", "url": "https://pubmed.ncbi.nlm.nih.gov/21576488" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21653549", "url": "https://pubmed.ncbi.nlm.nih.gov/21653549" }, { "database": "PubMed", "id": "21663643", "url": "https://pubmed.ncbi.nlm.nih.gov/21663643" }, { "database": "PubMed", "id": "21687937", "url": "https://pubmed.ncbi.nlm.nih.gov/21687937" }, { "database": "PubMed", "id": "21725357", "url": "https://pubmed.ncbi.nlm.nih.gov/21725357" }, { "database": "PubMed", "id": "21783897", "url": "https://pubmed.ncbi.nlm.nih.gov/21783897" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21809388", "url": "https://pubmed.ncbi.nlm.nih.gov/21809388" }, { "database": "PubMed", "id": "21840268", "url": "https://pubmed.ncbi.nlm.nih.gov/21840268" }, { "database": "PubMed", "id": "21857991", "url": "https://pubmed.ncbi.nlm.nih.gov/21857991" }, { "database": "PubMed", "id": "21866568", "url": "https://pubmed.ncbi.nlm.nih.gov/21866568" }, { "database": "PubMed", "id": "21887275", "url": "https://pubmed.ncbi.nlm.nih.gov/21887275" }, { "database": "PubMed", "id": "21909130", "url": "https://pubmed.ncbi.nlm.nih.gov/21909130" }, { "database": "PubMed", "id": "21918620", "url": "https://pubmed.ncbi.nlm.nih.gov/21918620" }, { "database": "PubMed", "id": "21945951", "url": "https://pubmed.ncbi.nlm.nih.gov/21945951" }, { "database": "PubMed", "id": "21960246", "url": "https://pubmed.ncbi.nlm.nih.gov/21960246" }, { "database": "PubMed", "id": "21965754", "url": "https://pubmed.ncbi.nlm.nih.gov/21965754" }, { "database": "PubMed", "id": "21983885", "url": "https://pubmed.ncbi.nlm.nih.gov/21983885" }, { "database": "PubMed", "id": "21997969", "url": "https://pubmed.ncbi.nlm.nih.gov/21997969" }, { "database": "PubMed", "id": "22002314", "url": "https://pubmed.ncbi.nlm.nih.gov/22002314" }, { "database": "PubMed", "id": "22030623", "url": "https://pubmed.ncbi.nlm.nih.gov/22030623" }, { "database": "PubMed", "id": "22114676", "url": "https://pubmed.ncbi.nlm.nih.gov/22114676" }, { "database": "PubMed", "id": "22142405", "url": "https://pubmed.ncbi.nlm.nih.gov/22142405" }, { "database": "PubMed", "id": "22174788", "url": "https://pubmed.ncbi.nlm.nih.gov/22174788" }, { "database": "PubMed", "id": "22190353", "url": "https://pubmed.ncbi.nlm.nih.gov/22190353" }, { "database": "PubMed", "id": "22198295", "url": "https://pubmed.ncbi.nlm.nih.gov/22198295" }, { "database": "PubMed", "id": "22266868", "url": "https://pubmed.ncbi.nlm.nih.gov/22266868" }, { "database": "PubMed", "id": "22288499", "url": "https://pubmed.ncbi.nlm.nih.gov/22288499" }, { "database": "PubMed", "id": "22290291", "url": "https://pubmed.ncbi.nlm.nih.gov/22290291" }, { "database": "PubMed", "id": "22312557", "url": "https://pubmed.ncbi.nlm.nih.gov/22312557" }, { "database": "PubMed", "id": "22331558", "url": "https://pubmed.ncbi.nlm.nih.gov/22331558" }, { "database": "PubMed", "id": "22414726", "url": "https://pubmed.ncbi.nlm.nih.gov/22414726" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22435726", "url": "https://pubmed.ncbi.nlm.nih.gov/22435726" }, { "database": "PubMed", "id": "22447336", "url": "https://pubmed.ncbi.nlm.nih.gov/22447336" }, { "database": "PubMed", "id": "22514710", "url": "https://pubmed.ncbi.nlm.nih.gov/22514710" }, { "database": "PubMed", "id": "22523681", "url": "https://pubmed.ncbi.nlm.nih.gov/22523681" }, { "database": "PubMed", "id": "22555805", "url": "https://pubmed.ncbi.nlm.nih.gov/22555805" }, { "database": "PubMed", "id": "22564437", "url": "https://pubmed.ncbi.nlm.nih.gov/22564437" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22622028", "url": "https://pubmed.ncbi.nlm.nih.gov/22622028" }, { "database": "PubMed", "id": "22627294", "url": "https://pubmed.ncbi.nlm.nih.gov/22627294" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22662266", "url": "https://pubmed.ncbi.nlm.nih.gov/22662266" }, { "database": "PubMed", "id": "22722496", "url": "https://pubmed.ncbi.nlm.nih.gov/22722496" }, { "database": "PubMed", "id": "22767080", "url": "https://pubmed.ncbi.nlm.nih.gov/22767080" }, { "database": "PubMed", "id": "22768036", "url": "https://pubmed.ncbi.nlm.nih.gov/22768036" }, { "database": "PubMed", "id": "22797063", "url": "https://pubmed.ncbi.nlm.nih.gov/22797063" }, { "database": "PubMed", "id": "22807682", "url": "https://pubmed.ncbi.nlm.nih.gov/22807682" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22848370", "url": "https://pubmed.ncbi.nlm.nih.gov/22848370" }, { "database": "PubMed", "id": "22859938", "url": "https://pubmed.ncbi.nlm.nih.gov/22859938" }, { "database": "PubMed", "id": "22888789", "url": "https://pubmed.ncbi.nlm.nih.gov/22888789" }, { "database": "PubMed", "id": "22911714", "url": "https://pubmed.ncbi.nlm.nih.gov/22911714" }, { "database": "PubMed", "id": "22947118", "url": "https://pubmed.ncbi.nlm.nih.gov/22947118" }, { "database": "PubMed", "id": "22954457", "url": "https://pubmed.ncbi.nlm.nih.gov/22954457" }, { "database": "PubMed", "id": "22962590", "url": "https://pubmed.ncbi.nlm.nih.gov/22962590" }, { "database": "PubMed", "id": "22983795", "url": "https://pubmed.ncbi.nlm.nih.gov/22983795" }, { "database": "PubMed", "id": "22996738", "url": "https://pubmed.ncbi.nlm.nih.gov/22996738" }, { "database": "PubMed", "id": "23027622", "url": "https://pubmed.ncbi.nlm.nih.gov/23027622" }, { "database": "PubMed", "id": "23028738", "url": "https://pubmed.ncbi.nlm.nih.gov/23028738" }, { "database": "PubMed", "id": "23034333", "url": "https://pubmed.ncbi.nlm.nih.gov/23034333" }, { "database": "PubMed", "id": "23050037", "url": "https://pubmed.ncbi.nlm.nih.gov/23050037" }, { "database": "PubMed", "id": "23091651", "url": "https://pubmed.ncbi.nlm.nih.gov/23091651" }, { "database": "PubMed", "id": "23108402", "url": "https://pubmed.ncbi.nlm.nih.gov/23108402" }, { "database": "PubMed", "id": "23124353", "url": "https://pubmed.ncbi.nlm.nih.gov/23124353" }, { "database": "PubMed", "id": "23128467", "url": "https://pubmed.ncbi.nlm.nih.gov/23128467" }, { "database": "PubMed", "id": "23139272", "url": "https://pubmed.ncbi.nlm.nih.gov/23139272" }, { "database": "PubMed", "id": "23194110", "url": "https://pubmed.ncbi.nlm.nih.gov/23194110" }, { "database": "PubMed", "id": "23238993", "url": "https://pubmed.ncbi.nlm.nih.gov/23238993" }, { "database": "PubMed", "id": "23263852", "url": "https://pubmed.ncbi.nlm.nih.gov/23263852" }, { "database": "PubMed", "id": "23300887", "url": "https://pubmed.ncbi.nlm.nih.gov/23300887" }, { "database": "PubMed", "id": "23318437", "url": "https://pubmed.ncbi.nlm.nih.gov/23318437" }, { "database": "PubMed", "id": "23319600", "url": "https://pubmed.ncbi.nlm.nih.gov/23319600" }, { "database": "PubMed", "id": "23340843", "url": "https://pubmed.ncbi.nlm.nih.gov/23340843" }, { "database": "PubMed", "id": "23342042", "url": "https://pubmed.ncbi.nlm.nih.gov/23342042" }, { "database": "PubMed", "id": "23351152", "url": "https://pubmed.ncbi.nlm.nih.gov/23351152" }, { "database": "PubMed", "id": "23359208", "url": "https://pubmed.ncbi.nlm.nih.gov/23359208" }, { "database": "PubMed", "id": "23425510", "url": "https://pubmed.ncbi.nlm.nih.gov/23425510" }, { "database": "PubMed", "id": "23434831", "url": "https://pubmed.ncbi.nlm.nih.gov/23434831" }, { "database": "PubMed", "id": "23451179", "url": "https://pubmed.ncbi.nlm.nih.gov/23451179" }, { "database": "PubMed", "id": "23483203", "url": "https://pubmed.ncbi.nlm.nih.gov/23483203" }, { "database": "PubMed", "id": "23495037", "url": "https://pubmed.ncbi.nlm.nih.gov/23495037" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23555949", "url": "https://pubmed.ncbi.nlm.nih.gov/23555949" }, { "database": "PubMed", "id": "23557329", "url": "https://pubmed.ncbi.nlm.nih.gov/23557329" }, { "database": "PubMed", "id": "23566959", "url": "https://pubmed.ncbi.nlm.nih.gov/23566959" }, { "database": "PubMed", "id": "23589839", "url": "https://pubmed.ncbi.nlm.nih.gov/23589839" }, { "database": "PubMed", "id": "23599430", "url": "https://pubmed.ncbi.nlm.nih.gov/23599430" }, { "database": "PubMed", "id": "23610071", "url": "https://pubmed.ncbi.nlm.nih.gov/23610071" }, { "database": "PubMed", "id": "23612976", "url": "https://pubmed.ncbi.nlm.nih.gov/23612976" }, { "database": "PubMed", "id": "23618908", "url": "https://pubmed.ncbi.nlm.nih.gov/23618908" }, { "database": "PubMed", "id": "23640457", "url": "https://pubmed.ncbi.nlm.nih.gov/23640457" }, { "database": "PubMed", "id": "23646139", "url": "https://pubmed.ncbi.nlm.nih.gov/23646139" }, { "database": "PubMed", "id": "23652278", "url": "https://pubmed.ncbi.nlm.nih.gov/23652278" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23666755", "url": "https://pubmed.ncbi.nlm.nih.gov/23666755" }, { "database": "PubMed", "id": "23676219", "url": "https://pubmed.ncbi.nlm.nih.gov/23676219" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23737838", "url": "https://pubmed.ncbi.nlm.nih.gov/23737838" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23759592", "url": "https://pubmed.ncbi.nlm.nih.gov/23759592" }, { "database": "PubMed", "id": "23785417", "url": "https://pubmed.ncbi.nlm.nih.gov/23785417" }, { "database": "PubMed", "id": "23800953", "url": "https://pubmed.ncbi.nlm.nih.gov/23800953" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23852422", "url": "https://pubmed.ncbi.nlm.nih.gov/23852422" }, { "database": "PubMed", "id": "23874235", "url": "https://pubmed.ncbi.nlm.nih.gov/23874235" }, { "database": "PubMed", "id": "23883471", "url": "https://pubmed.ncbi.nlm.nih.gov/23883471" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "23915323", "url": "https://pubmed.ncbi.nlm.nih.gov/23915323" }, { "database": "PubMed", "id": "23949216", "url": "https://pubmed.ncbi.nlm.nih.gov/23949216" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24024154", "url": "https://pubmed.ncbi.nlm.nih.gov/24024154" }, { "database": "PubMed", "id": "24037342", "url": "https://pubmed.ncbi.nlm.nih.gov/24037342" }, { "database": "PubMed", "id": "24040083", "url": "https://pubmed.ncbi.nlm.nih.gov/24040083" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24086708", "url": "https://pubmed.ncbi.nlm.nih.gov/24086708" }, { "database": "PubMed", "id": "24089038", "url": "https://pubmed.ncbi.nlm.nih.gov/24089038" }, { "database": "PubMed", "id": "24096875", "url": "https://pubmed.ncbi.nlm.nih.gov/24096875" }, { "database": "PubMed", "id": "24129246", "url": "https://pubmed.ncbi.nlm.nih.gov/24129246" }, { "database": "PubMed", "id": "24156017", "url": "https://pubmed.ncbi.nlm.nih.gov/24156017" }, { "database": "PubMed", "id": "24157877", "url": "https://pubmed.ncbi.nlm.nih.gov/24157877" }, { "database": "PubMed", "id": "24194914", "url": "https://pubmed.ncbi.nlm.nih.gov/24194914" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24205157", "url": "https://pubmed.ncbi.nlm.nih.gov/24205157" }, { "database": "PubMed", "id": "24223226", "url": "https://pubmed.ncbi.nlm.nih.gov/24223226" }, { "database": "PubMed", "id": "24244715", "url": "https://pubmed.ncbi.nlm.nih.gov/24244715" }, { "database": "PubMed", "id": "24248600", "url": "https://pubmed.ncbi.nlm.nih.gov/24248600" }, { "database": "PubMed", "id": "24264057", "url": "https://pubmed.ncbi.nlm.nih.gov/24264057" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24313628", "url": "https://pubmed.ncbi.nlm.nih.gov/24313628" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24379680", "url": "https://pubmed.ncbi.nlm.nih.gov/24379680" }, { "database": "PubMed", "id": "24380814", "url": "https://pubmed.ncbi.nlm.nih.gov/24380814" }, { "database": "PubMed", "id": "24391984", "url": "https://pubmed.ncbi.nlm.nih.gov/24391984" }, { "database": "PubMed", "id": "24403123", "url": "https://pubmed.ncbi.nlm.nih.gov/24403123" }, { "database": "PubMed", "id": "24413150", "url": "https://pubmed.ncbi.nlm.nih.gov/24413150" }, { "database": "PubMed", "id": "24445528", "url": "https://pubmed.ncbi.nlm.nih.gov/24445528" }, { "database": "PubMed", "id": "24447148", "url": "https://pubmed.ncbi.nlm.nih.gov/24447148" }, { "database": "PubMed", "id": "24456610", "url": "https://pubmed.ncbi.nlm.nih.gov/24456610" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24480460", "url": "https://pubmed.ncbi.nlm.nih.gov/24480460" }, { "database": "PubMed", "id": "24553354", "url": "https://pubmed.ncbi.nlm.nih.gov/24553354" }, { "database": "PubMed", "id": "24555657", "url": "https://pubmed.ncbi.nlm.nih.gov/24555657" }, { "database": "PubMed", "id": "24556689", "url": "https://pubmed.ncbi.nlm.nih.gov/24556689" }, { "database": "PubMed", "id": "24587255", "url": "https://pubmed.ncbi.nlm.nih.gov/24587255" }, { "database": "PubMed", "id": "24603648", "url": "https://pubmed.ncbi.nlm.nih.gov/24603648" }, { "database": "PubMed", "id": "24608431", "url": "https://pubmed.ncbi.nlm.nih.gov/24608431" }, { "database": "PubMed", "id": "24613410", "url": "https://pubmed.ncbi.nlm.nih.gov/24613410" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24657168", "url": "https://pubmed.ncbi.nlm.nih.gov/24657168" }, { "database": "PubMed", "id": "24682933", "url": "https://pubmed.ncbi.nlm.nih.gov/24682933" }, { "database": "PubMed", "id": "24691657", "url": "https://pubmed.ncbi.nlm.nih.gov/24691657" }, { "database": "PubMed", "id": "24717393", "url": "https://pubmed.ncbi.nlm.nih.gov/24717393" }, { "database": "PubMed", "id": "24722580", "url": "https://pubmed.ncbi.nlm.nih.gov/24722580" }, { "database": "PubMed", "id": "24759730", "url": "https://pubmed.ncbi.nlm.nih.gov/24759730" }, { "database": "PubMed", "id": "24796485", "url": "https://pubmed.ncbi.nlm.nih.gov/24796485" }, { "database": "PubMed", "id": "24797517", "url": "https://pubmed.ncbi.nlm.nih.gov/24797517" }, { "database": "PubMed", "id": "24801380", "url": "https://pubmed.ncbi.nlm.nih.gov/24801380" }, { "database": "PubMed", "id": "24810057", "url": "https://pubmed.ncbi.nlm.nih.gov/24810057" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24867336", "url": "https://pubmed.ncbi.nlm.nih.gov/24867336" }, { "database": "PubMed", "id": "24885082", "url": "https://pubmed.ncbi.nlm.nih.gov/24885082" }, { "database": "PubMed", "id": "24886358", "url": "https://pubmed.ncbi.nlm.nih.gov/24886358" }, { "database": "PubMed", "id": "24905183", "url": "https://pubmed.ncbi.nlm.nih.gov/24905183" }, { "database": "PubMed", "id": "24926985", "url": "https://pubmed.ncbi.nlm.nih.gov/24926985" }, { "database": "PubMed", "id": "24928858", "url": "https://pubmed.ncbi.nlm.nih.gov/24928858" }, { "database": "PubMed", "id": "24932684", "url": "https://pubmed.ncbi.nlm.nih.gov/24932684" }, { "database": "PubMed", "id": "24934860", "url": "https://pubmed.ncbi.nlm.nih.gov/24934860" }, { "database": "PubMed", "id": "24956278", "url": "https://pubmed.ncbi.nlm.nih.gov/24956278" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "24971451", "url": "https://pubmed.ncbi.nlm.nih.gov/24971451" }, { "database": "PubMed", "id": "25051404", "url": "https://pubmed.ncbi.nlm.nih.gov/25051404" }, { "database": "PubMed", "id": "25078064", "url": "https://pubmed.ncbi.nlm.nih.gov/25078064" }, { "database": "PubMed", "id": "25112877", "url": "https://pubmed.ncbi.nlm.nih.gov/25112877" }, { "database": "PubMed", "id": "25143403", "url": "https://pubmed.ncbi.nlm.nih.gov/25143403" }, { "database": "PubMed", "id": "25198662", "url": "https://pubmed.ncbi.nlm.nih.gov/25198662" }, { "database": "PubMed", "id": "25221641", "url": "https://pubmed.ncbi.nlm.nih.gov/25221641" }, { "database": "PubMed", "id": "25227113", "url": "https://pubmed.ncbi.nlm.nih.gov/25227113" }, { "database": "PubMed", "id": "25275589", "url": "https://pubmed.ncbi.nlm.nih.gov/25275589" }, { "database": "PubMed", "id": "25277183", "url": "https://pubmed.ncbi.nlm.nih.gov/25277183" }, { "database": "PubMed", "id": "25277184", "url": "https://pubmed.ncbi.nlm.nih.gov/25277184" }, { "database": "PubMed", "id": "25294809", "url": "https://pubmed.ncbi.nlm.nih.gov/25294809" }, { "database": "PubMed", "id": "25311384", "url": "https://pubmed.ncbi.nlm.nih.gov/25311384" }, { "database": "PubMed", "id": "25319447", "url": "https://pubmed.ncbi.nlm.nih.gov/25319447" }, { "database": "PubMed", "id": "25331851", "url": "https://pubmed.ncbi.nlm.nih.gov/25331851" }, { "database": "PubMed", "id": "25341038", "url": "https://pubmed.ncbi.nlm.nih.gov/25341038" }, { "database": "PubMed", "id": "25372714", "url": "https://pubmed.ncbi.nlm.nih.gov/25372714" }, { "database": "PubMed", "id": "25412311", "url": "https://pubmed.ncbi.nlm.nih.gov/25412311" }, { "database": "PubMed", "id": "25486198", "url": "https://pubmed.ncbi.nlm.nih.gov/25486198" }, { "database": "PubMed", "id": "25489053", "url": "https://pubmed.ncbi.nlm.nih.gov/25489053" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25524025", "url": "https://pubmed.ncbi.nlm.nih.gov/25524025" }, { "database": "PubMed", "id": "25603347", "url": "https://pubmed.ncbi.nlm.nih.gov/25603347" }, { "database": "PubMed", "id": "25605022", "url": "https://pubmed.ncbi.nlm.nih.gov/25605022" }, { "database": "PubMed", "id": "25617667", "url": "https://pubmed.ncbi.nlm.nih.gov/25617667" }, { "database": "PubMed", "id": "25637534", "url": "https://pubmed.ncbi.nlm.nih.gov/25637534" }, { "database": "PubMed", "id": "25639717", "url": "https://pubmed.ncbi.nlm.nih.gov/25639717" }, { "database": "PubMed", "id": "25650067", "url": "https://pubmed.ncbi.nlm.nih.gov/25650067" }, { "database": "PubMed", "id": "25658463", "url": "https://pubmed.ncbi.nlm.nih.gov/25658463" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25674209", "url": "https://pubmed.ncbi.nlm.nih.gov/25674209" }, { "database": "PubMed", "id": "25742468", "url": "https://pubmed.ncbi.nlm.nih.gov/25742468" }, { "database": "PubMed", "id": "25761368", "url": "https://pubmed.ncbi.nlm.nih.gov/25761368" }, { "database": "PubMed", "id": "25769181", "url": "https://pubmed.ncbi.nlm.nih.gov/25769181" }, { "database": "PubMed", "id": "25807079", "url": "https://pubmed.ncbi.nlm.nih.gov/25807079" }, { "database": "PubMed", "id": "25840449", "url": "https://pubmed.ncbi.nlm.nih.gov/25840449" }, { "database": "PubMed", "id": "25852310", "url": "https://pubmed.ncbi.nlm.nih.gov/25852310" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "25867071", "url": "https://pubmed.ncbi.nlm.nih.gov/25867071" }, { "database": "PubMed", "id": "25883152", "url": "https://pubmed.ncbi.nlm.nih.gov/25883152" }, { "database": "PubMed", "id": "25888625", "url": "https://pubmed.ncbi.nlm.nih.gov/25888625" }, { "database": "PubMed", "id": "25916852", "url": "https://pubmed.ncbi.nlm.nih.gov/25916852" }, { "database": "PubMed", "id": "25929783", "url": "https://pubmed.ncbi.nlm.nih.gov/25929783" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "25980443", "url": "https://pubmed.ncbi.nlm.nih.gov/25980443" }, { "database": "PubMed", "id": "25993660", "url": "https://pubmed.ncbi.nlm.nih.gov/25993660" }, { "database": "PubMed", "id": "26006237", "url": "https://pubmed.ncbi.nlm.nih.gov/26006237" }, { "database": "PubMed", "id": "26024660", "url": "https://pubmed.ncbi.nlm.nih.gov/26024660" }, { "database": "PubMed", "id": "26041883", "url": "https://pubmed.ncbi.nlm.nih.gov/26041883" }, { "database": "PubMed", "id": "26042776", "url": "https://pubmed.ncbi.nlm.nih.gov/26042776" }, { "database": "PubMed", "id": "26059686", "url": "https://pubmed.ncbi.nlm.nih.gov/26059686" }, { "database": "PubMed", "id": "26062651", "url": "https://pubmed.ncbi.nlm.nih.gov/26062651" }, { "database": "PubMed", "id": "26070322", "url": "https://pubmed.ncbi.nlm.nih.gov/26070322" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26095524", "url": "https://pubmed.ncbi.nlm.nih.gov/26095524" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26113041", "url": "https://pubmed.ncbi.nlm.nih.gov/26113041" }, { "database": "PubMed", "id": "26138448", "url": "https://pubmed.ncbi.nlm.nih.gov/26138448" }, { "database": "PubMed", "id": "26144554", "url": "https://pubmed.ncbi.nlm.nih.gov/26144554" }, { "database": "PubMed", "id": "26181367", "url": "https://pubmed.ncbi.nlm.nih.gov/26181367" }, { "database": "PubMed", "id": "26193055", "url": "https://pubmed.ncbi.nlm.nih.gov/26193055" }, { "database": "PubMed", "id": "26230405", "url": "https://pubmed.ncbi.nlm.nih.gov/26230405" }, { "database": "PubMed", "id": "26231043", "url": "https://pubmed.ncbi.nlm.nih.gov/26231043" }, { "database": "PubMed", "id": "26244501", "url": "https://pubmed.ncbi.nlm.nih.gov/26244501" }, { "database": "PubMed", "id": "26261212", "url": "https://pubmed.ncbi.nlm.nih.gov/26261212" }, { "database": "PubMed", "id": "26297485", "url": "https://pubmed.ncbi.nlm.nih.gov/26297485" }, { "database": "PubMed", "id": "26327815", "url": "https://pubmed.ncbi.nlm.nih.gov/26327815" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26387611", "url": "https://pubmed.ncbi.nlm.nih.gov/26387611" }, { "database": "PubMed", "id": "26391003", "url": "https://pubmed.ncbi.nlm.nih.gov/26391003" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26408200", "url": "https://pubmed.ncbi.nlm.nih.gov/26408200" }, { "database": "PubMed", "id": "26415230", "url": "https://pubmed.ncbi.nlm.nih.gov/26415230" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26456774", "url": "https://pubmed.ncbi.nlm.nih.gov/26456774" }, { "database": "PubMed", "id": "26459859", "url": "https://pubmed.ncbi.nlm.nih.gov/26459859" }, { "database": "PubMed", "id": "26471002", "url": "https://pubmed.ncbi.nlm.nih.gov/26471002" }, { "database": "PubMed", "id": "26485768", "url": "https://pubmed.ncbi.nlm.nih.gov/26485768" }, { "database": "PubMed", "id": "26510776", "url": "https://pubmed.ncbi.nlm.nih.gov/26510776" }, { "database": "PubMed", "id": "26522181", "url": "https://pubmed.ncbi.nlm.nih.gov/26522181" }, { "database": "PubMed", "id": "26540344", "url": "https://pubmed.ncbi.nlm.nih.gov/26540344" }, { "database": "PubMed", "id": "26571493", "url": "https://pubmed.ncbi.nlm.nih.gov/26571493" }, { "database": "PubMed", "id": "26598601", "url": "https://pubmed.ncbi.nlm.nih.gov/26598601" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26687066", "url": "https://pubmed.ncbi.nlm.nih.gov/26687066" }, { "database": "PubMed", "id": "26699757", "url": "https://pubmed.ncbi.nlm.nih.gov/26699757" }, { "database": "PubMed", "id": "26714930", "url": "https://pubmed.ncbi.nlm.nih.gov/26714930" }, { "database": "PubMed", "id": "26716417", "url": "https://pubmed.ncbi.nlm.nih.gov/26716417" }, { "database": "PubMed", "id": "26734838", "url": "https://pubmed.ncbi.nlm.nih.gov/26734838" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26832796", "url": "https://pubmed.ncbi.nlm.nih.gov/26832796" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "26876197", "url": "https://pubmed.ncbi.nlm.nih.gov/26876197" }, { "database": "PubMed", "id": "26883108", "url": "https://pubmed.ncbi.nlm.nih.gov/26883108" }, { "database": "PubMed", "id": "26909609", "url": "https://pubmed.ncbi.nlm.nih.gov/26909609" }, { "database": "PubMed", "id": "26928575", "url": "https://pubmed.ncbi.nlm.nih.gov/26928575" }, { "database": "PubMed", "id": "26967060", "url": "https://pubmed.ncbi.nlm.nih.gov/26967060" }, { "database": "PubMed", "id": "26974310", "url": "https://pubmed.ncbi.nlm.nih.gov/26974310" }, { "database": "PubMed", "id": "26982737", "url": "https://pubmed.ncbi.nlm.nih.gov/26982737" }, { "database": "PubMed", "id": "26984736", "url": "https://pubmed.ncbi.nlm.nih.gov/26984736" }, { "database": "PubMed", "id": "26988910", "url": "https://pubmed.ncbi.nlm.nih.gov/26988910" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "27031960", "url": "https://pubmed.ncbi.nlm.nih.gov/27031960" }, { "database": "PubMed", "id": "27054339", "url": "https://pubmed.ncbi.nlm.nih.gov/27054339" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27119009", "url": "https://pubmed.ncbi.nlm.nih.gov/27119009" }, { "database": "PubMed", "id": "27127932", "url": "https://pubmed.ncbi.nlm.nih.gov/27127932" }, { "database": "PubMed", "id": "27176768", "url": "https://pubmed.ncbi.nlm.nih.gov/27176768" }, { "database": "PubMed", "id": "27183917", "url": "https://pubmed.ncbi.nlm.nih.gov/27183917" }, { "database": "PubMed", "id": "27195669", "url": "https://pubmed.ncbi.nlm.nih.gov/27195669" }, { "database": "PubMed", "id": "27221050", "url": "https://pubmed.ncbi.nlm.nih.gov/27221050" }, { "database": "PubMed", "id": "27223263", "url": "https://pubmed.ncbi.nlm.nih.gov/27223263" }, { "database": "PubMed", "id": "27270209", "url": "https://pubmed.ncbi.nlm.nih.gov/27270209" }, { "database": "PubMed", "id": "27270636", "url": "https://pubmed.ncbi.nlm.nih.gov/27270636" }, { "database": "PubMed", "id": "27283986", "url": "https://pubmed.ncbi.nlm.nih.gov/27283986" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27314341", "url": "https://pubmed.ncbi.nlm.nih.gov/27314341" }, { "database": "PubMed", "id": "27323823", "url": "https://pubmed.ncbi.nlm.nih.gov/27323823" }, { "database": "PubMed", "id": "27344169", "url": "https://pubmed.ncbi.nlm.nih.gov/27344169" }, { "database": "PubMed", "id": "27346849", "url": "https://pubmed.ncbi.nlm.nih.gov/27346849" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27399772", "url": "https://pubmed.ncbi.nlm.nih.gov/27399772" }, { "database": "PubMed", "id": "27402273", "url": "https://pubmed.ncbi.nlm.nih.gov/27402273" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27511909", "url": "https://pubmed.ncbi.nlm.nih.gov/27511909" }, { "database": "PubMed", "id": "27517620", "url": "https://pubmed.ncbi.nlm.nih.gov/27517620" }, { "database": "PubMed", "id": "27542238", "url": "https://pubmed.ncbi.nlm.nih.gov/27542238" }, { "database": "PubMed", "id": "27545311", "url": "https://pubmed.ncbi.nlm.nih.gov/27545311" }, { "database": "PubMed", "id": "27551445", "url": "https://pubmed.ncbi.nlm.nih.gov/27551445" }, { "database": "PubMed", "id": "27556362", "url": "https://pubmed.ncbi.nlm.nih.gov/27556362" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27611229", "url": "https://pubmed.ncbi.nlm.nih.gov/27611229" }, { "database": "PubMed", "id": "27626308", "url": "https://pubmed.ncbi.nlm.nih.gov/27626308" }, { "database": "PubMed", "id": "27644130", "url": "https://pubmed.ncbi.nlm.nih.gov/27644130" }, { "database": "PubMed", "id": "27656146", "url": "https://pubmed.ncbi.nlm.nih.gov/27656146" }, { "database": "PubMed", "id": "27659536", "url": "https://pubmed.ncbi.nlm.nih.gov/27659536" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "27721412", "url": "https://pubmed.ncbi.nlm.nih.gov/27721412" }, { "database": "PubMed", "id": "27742673", "url": "https://pubmed.ncbi.nlm.nih.gov/27742673" }, { "database": "PubMed", "id": "27763560", "url": "https://pubmed.ncbi.nlm.nih.gov/27763560" }, { "database": "PubMed", "id": "27769050", "url": "https://pubmed.ncbi.nlm.nih.gov/27769050" }, { "database": "PubMed", "id": "27810895", "url": "https://pubmed.ncbi.nlm.nih.gov/27810895" }, { "database": "PubMed", "id": "27863490", "url": "https://pubmed.ncbi.nlm.nih.gov/27863490" }, { "database": "PubMed", "id": "27902328", "url": "https://pubmed.ncbi.nlm.nih.gov/27902328" }, { "database": "PubMed", "id": "27906186", "url": "https://pubmed.ncbi.nlm.nih.gov/27906186" }, { "database": "PubMed", "id": "27991505", "url": "https://pubmed.ncbi.nlm.nih.gov/27991505" }, { "database": "PubMed", "id": "28031409", "url": "https://pubmed.ncbi.nlm.nih.gov/28031409" }, { "database": "PubMed", "id": "28038466", "url": "https://pubmed.ncbi.nlm.nih.gov/28038466" }, { "database": "PubMed", "id": "28102346", "url": "https://pubmed.ncbi.nlm.nih.gov/28102346" }, { "database": "PubMed", "id": "28118604", "url": "https://pubmed.ncbi.nlm.nih.gov/28118604" }, { "database": "PubMed", "id": "28131798", "url": "https://pubmed.ncbi.nlm.nih.gov/28131798" }, { "database": "PubMed", "id": "28177473", "url": "https://pubmed.ncbi.nlm.nih.gov/28177473" }, { "database": "PubMed", "id": "28182004", "url": "https://pubmed.ncbi.nlm.nih.gov/28182004" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28187444", "url": "https://pubmed.ncbi.nlm.nih.gov/28187444" }, { "database": "PubMed", "id": "28208611", "url": "https://pubmed.ncbi.nlm.nih.gov/28208611" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28259974", "url": "https://pubmed.ncbi.nlm.nih.gov/28259974" }, { "database": "PubMed", "id": "28284059", "url": "https://pubmed.ncbi.nlm.nih.gov/28284059" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28369097", "url": "https://pubmed.ncbi.nlm.nih.gov/28369097" }, { "database": "PubMed", "id": "28381880", "url": "https://pubmed.ncbi.nlm.nih.gov/28381880" }, { "database": "PubMed", "id": "28455491", "url": "https://pubmed.ncbi.nlm.nih.gov/28455491" }, { "database": "PubMed", "id": "28466226", "url": "https://pubmed.ncbi.nlm.nih.gov/28466226" }, { "database": "PubMed", "id": "28468838", "url": "https://pubmed.ncbi.nlm.nih.gov/28468838" }, { "database": "PubMed", "id": "28475405", "url": "https://pubmed.ncbi.nlm.nih.gov/28475405" }, { "database": "PubMed", "id": "28535155", "url": "https://pubmed.ncbi.nlm.nih.gov/28535155" }, { "database": "PubMed", "id": "28605833", "url": "https://pubmed.ncbi.nlm.nih.gov/28605833" }, { "database": "PubMed", "id": "28656213", "url": "https://pubmed.ncbi.nlm.nih.gov/28656213" }, { "database": "PubMed", "id": "28667090", "url": "https://pubmed.ncbi.nlm.nih.gov/28667090" }, { "database": "PubMed", "id": "28714848", "url": "https://pubmed.ncbi.nlm.nih.gov/28714848" }, { "database": "PubMed", "id": "28715492", "url": "https://pubmed.ncbi.nlm.nih.gov/28715492" }, { "database": "PubMed", "id": "28726723", "url": "https://pubmed.ncbi.nlm.nih.gov/28726723" }, { "database": "PubMed", "id": "28759712", "url": "https://pubmed.ncbi.nlm.nih.gov/28759712" }, { "database": "PubMed", "id": "28790359", "url": "https://pubmed.ncbi.nlm.nih.gov/28790359" }, { "database": "PubMed", "id": "28794470", "url": "https://pubmed.ncbi.nlm.nih.gov/28794470" }, { "database": "PubMed", "id": "28797070", "url": "https://pubmed.ncbi.nlm.nih.gov/28797070" }, { "database": "PubMed", "id": "28801242", "url": "https://pubmed.ncbi.nlm.nih.gov/28801242" }, { "database": "PubMed", "id": "28837154", "url": "https://pubmed.ncbi.nlm.nih.gov/28837154" }, { "database": "PubMed", "id": "28842590", "url": "https://pubmed.ncbi.nlm.nih.gov/28842590" }, { "database": "PubMed", "id": "28843398", "url": "https://pubmed.ncbi.nlm.nih.gov/28843398" }, { "database": "PubMed", "id": "28888100", "url": "https://pubmed.ncbi.nlm.nih.gov/28888100" }, { "database": "PubMed", "id": "28904350", "url": "https://pubmed.ncbi.nlm.nih.gov/28904350" }, { "database": "PubMed", "id": "28915553", "url": "https://pubmed.ncbi.nlm.nih.gov/28915553" }, { "database": "PubMed", "id": "28915564", "url": "https://pubmed.ncbi.nlm.nih.gov/28915564" }, { "database": "PubMed", "id": "28926586", "url": "https://pubmed.ncbi.nlm.nih.gov/28926586" }, { "database": "PubMed", "id": "28930974", "url": "https://pubmed.ncbi.nlm.nih.gov/28930974" }, { "database": "PubMed", "id": "28968425", "url": "https://pubmed.ncbi.nlm.nih.gov/28968425" }, { "database": "PubMed", "id": "28971953", "url": "https://pubmed.ncbi.nlm.nih.gov/28971953" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "28973015", "url": "https://pubmed.ncbi.nlm.nih.gov/28973015" }, { "database": "PubMed", "id": "28979163", "url": "https://pubmed.ncbi.nlm.nih.gov/28979163" }, { "database": "PubMed", "id": "28981110", "url": "https://pubmed.ncbi.nlm.nih.gov/28981110" }, { "database": "PubMed", "id": "28985345", "url": "https://pubmed.ncbi.nlm.nih.gov/28985345" }, { "database": "PubMed", "id": "28993697", "url": "https://pubmed.ncbi.nlm.nih.gov/28993697" }, { "database": "PubMed", "id": "29030986", "url": "https://pubmed.ncbi.nlm.nih.gov/29030986" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29069457", "url": "https://pubmed.ncbi.nlm.nih.gov/29069457" }, { "database": "PubMed", "id": "29081404", "url": "https://pubmed.ncbi.nlm.nih.gov/29081404" }, { "database": "PubMed", "id": "29096294", "url": "https://pubmed.ncbi.nlm.nih.gov/29096294" }, { "database": "PubMed", "id": "29127423", "url": "https://pubmed.ncbi.nlm.nih.gov/29127423" }, { "database": "PubMed", "id": "29133857", "url": "https://pubmed.ncbi.nlm.nih.gov/29133857" }, { "database": "PubMed", "id": "29156743", "url": "https://pubmed.ncbi.nlm.nih.gov/29156743" }, { "database": "PubMed", "id": "29170254", "url": "https://pubmed.ncbi.nlm.nih.gov/29170254" }, { "database": "PubMed", "id": "29170437", "url": "https://pubmed.ncbi.nlm.nih.gov/29170437" }, { "database": "PubMed", "id": "29212215", "url": "https://pubmed.ncbi.nlm.nih.gov/29212215" }, { "database": "PubMed", "id": "29213352", "url": "https://pubmed.ncbi.nlm.nih.gov/29213352" }, { "database": "PubMed", "id": "29221109", "url": "https://pubmed.ncbi.nlm.nih.gov/29221109" }, { "database": "PubMed", "id": "29233996", "url": "https://pubmed.ncbi.nlm.nih.gov/29233996" }, { "database": "PubMed", "id": "29235570", "url": "https://pubmed.ncbi.nlm.nih.gov/29235570" }, { "database": "PubMed", "id": "29242151", "url": "https://pubmed.ncbi.nlm.nih.gov/29242151" }, { "database": "PubMed", "id": "29262653", "url": "https://pubmed.ncbi.nlm.nih.gov/29262653" }, { "database": "PubMed", "id": "29282022", "url": "https://pubmed.ncbi.nlm.nih.gov/29282022" }, { "database": "PubMed", "id": "29298131", "url": "https://pubmed.ncbi.nlm.nih.gov/29298131" }, { "database": "PubMed", "id": "29311824", "url": "https://pubmed.ncbi.nlm.nih.gov/29311824" }, { "database": "PubMed", "id": "29317830", "url": "https://pubmed.ncbi.nlm.nih.gov/29317830" }, { "database": "PubMed", "id": "29368980", "url": "https://pubmed.ncbi.nlm.nih.gov/29368980" }, { "database": "PubMed", "id": "29383186", "url": "https://pubmed.ncbi.nlm.nih.gov/29383186" }, { "database": "PubMed", "id": "29391428", "url": "https://pubmed.ncbi.nlm.nih.gov/29391428" }, { "database": "PubMed", "id": "29444163", "url": "https://pubmed.ncbi.nlm.nih.gov/29444163" }, { "database": "PubMed", "id": "29445107", "url": "https://pubmed.ncbi.nlm.nih.gov/29445107" }, { "database": "PubMed", "id": "29467390", "url": "https://pubmed.ncbi.nlm.nih.gov/29467390" }, { "database": "PubMed", "id": "29555944", "url": "https://pubmed.ncbi.nlm.nih.gov/29555944" }, { "database": "PubMed", "id": "29568955", "url": "https://pubmed.ncbi.nlm.nih.gov/29568955" }, { "database": "PubMed", "id": "29622681", "url": "https://pubmed.ncbi.nlm.nih.gov/29622681" }, { "database": "PubMed", "id": "29675670", "url": "https://pubmed.ncbi.nlm.nih.gov/29675670" }, { "database": "PubMed", "id": "29705090", "url": "https://pubmed.ncbi.nlm.nih.gov/29705090" }, { "database": "PubMed", "id": "29774100", "url": "https://pubmed.ncbi.nlm.nih.gov/29774100" }, { "database": "PubMed", "id": "29849909", "url": "https://pubmed.ncbi.nlm.nih.gov/29849909" }, { "database": "PubMed", "id": "29879550", "url": "https://pubmed.ncbi.nlm.nih.gov/29879550" }, { "database": "PubMed", "id": "29890668", "url": "https://pubmed.ncbi.nlm.nih.gov/29890668" }, { "database": "PubMed", "id": "29899847", "url": "https://pubmed.ncbi.nlm.nih.gov/29899847" }, { "database": "PubMed", "id": "29937996", "url": "https://pubmed.ncbi.nlm.nih.gov/29937996" }, { "database": "PubMed", "id": "29963241", "url": "https://pubmed.ncbi.nlm.nih.gov/29963241" }, { "database": "PubMed", "id": "30003648", "url": "https://pubmed.ncbi.nlm.nih.gov/30003648" }, { "database": "PubMed", "id": "30018737", "url": "https://pubmed.ncbi.nlm.nih.gov/30018737" }, { "database": "PubMed", "id": "30045945", "url": "https://pubmed.ncbi.nlm.nih.gov/30045945" }, { "database": "PubMed", "id": "30049386", "url": "https://pubmed.ncbi.nlm.nih.gov/30049386" }, { "database": "PubMed", "id": "30057418", "url": "https://pubmed.ncbi.nlm.nih.gov/30057418" }, { "database": "PubMed", "id": "30067985", "url": "https://pubmed.ncbi.nlm.nih.gov/30067985" }, { "database": "PubMed", "id": "30093397", "url": "https://pubmed.ncbi.nlm.nih.gov/30093397" }, { "database": "PubMed", "id": "30108207", "url": "https://pubmed.ncbi.nlm.nih.gov/30108207" }, { "database": "PubMed", "id": "30142917", "url": "https://pubmed.ncbi.nlm.nih.gov/30142917" }, { "database": "PubMed", "id": "30166519", "url": "https://pubmed.ncbi.nlm.nih.gov/30166519" }, { "database": "PubMed", "id": "30177839", "url": "https://pubmed.ncbi.nlm.nih.gov/30177839" }, { "database": "PubMed", "id": "30193098", "url": "https://pubmed.ncbi.nlm.nih.gov/30193098" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30252118", "url": "https://pubmed.ncbi.nlm.nih.gov/30252118" }, { "database": "PubMed", "id": "30254375", "url": "https://pubmed.ncbi.nlm.nih.gov/30254375" }, { "database": "PubMed", "id": "30261716", "url": "https://pubmed.ncbi.nlm.nih.gov/30261716" }, { "database": "PubMed", "id": "30272263", "url": "https://pubmed.ncbi.nlm.nih.gov/30272263" }, { "database": "PubMed", "id": "30337688", "url": "https://pubmed.ncbi.nlm.nih.gov/30337688" }, { "database": "PubMed", "id": "30375398", "url": "https://pubmed.ncbi.nlm.nih.gov/30375398" }, { "database": "PubMed", "id": "30380295", "url": "https://pubmed.ncbi.nlm.nih.gov/30380295" }, { "database": "PubMed", "id": "30388705", "url": "https://pubmed.ncbi.nlm.nih.gov/30388705" }, { "database": "PubMed", "id": "30400903", "url": "https://pubmed.ncbi.nlm.nih.gov/30400903" }, { "database": "PubMed", "id": "30424508", "url": "https://pubmed.ncbi.nlm.nih.gov/30424508" }, { "database": "PubMed", "id": "30476192", "url": "https://pubmed.ncbi.nlm.nih.gov/30476192" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30513611", "url": "https://pubmed.ncbi.nlm.nih.gov/30513611" }, { "database": "PubMed", "id": "30520728", "url": "https://pubmed.ncbi.nlm.nih.gov/30520728" }, { "database": "PubMed", "id": "30532707", "url": "https://pubmed.ncbi.nlm.nih.gov/30532707" }, { "database": "PubMed", "id": "30538965", "url": "https://pubmed.ncbi.nlm.nih.gov/30538965" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30585287", "url": "https://pubmed.ncbi.nlm.nih.gov/30585287" }, { "database": "PubMed", "id": "30587121", "url": "https://pubmed.ncbi.nlm.nih.gov/30587121" }, { "database": "PubMed", "id": "30665195", "url": "https://pubmed.ncbi.nlm.nih.gov/30665195" }, { "database": "PubMed", "id": "30666155", "url": "https://pubmed.ncbi.nlm.nih.gov/30666155" }, { "database": "PubMed", "id": "30717309", "url": "https://pubmed.ncbi.nlm.nih.gov/30717309" }, { "database": "PubMed", "id": "30728460", "url": "https://pubmed.ncbi.nlm.nih.gov/30728460" }, { "database": "PubMed", "id": "30733851", "url": "https://pubmed.ncbi.nlm.nih.gov/30733851" }, { "database": "PubMed", "id": "30808373", "url": "https://pubmed.ncbi.nlm.nih.gov/30808373" }, { "database": "PubMed", "id": "30813936", "url": "https://pubmed.ncbi.nlm.nih.gov/30813936" }, { "database": "PubMed", "id": "30854784", "url": "https://pubmed.ncbi.nlm.nih.gov/30854784" }, { "database": "PubMed", "id": "30868056", "url": "https://pubmed.ncbi.nlm.nih.gov/30868056" }, { "database": "PubMed", "id": "30881947", "url": "https://pubmed.ncbi.nlm.nih.gov/30881947" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "30932278", "url": "https://pubmed.ncbi.nlm.nih.gov/30932278" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30966857", "url": "https://pubmed.ncbi.nlm.nih.gov/30966857" }, { "database": "PubMed", "id": "30975543", "url": "https://pubmed.ncbi.nlm.nih.gov/30975543" }, { "database": "PubMed", "id": "30982228", "url": "https://pubmed.ncbi.nlm.nih.gov/30982228" }, { "database": "PubMed", "id": "31039479", "url": "https://pubmed.ncbi.nlm.nih.gov/31039479" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31111215", "url": "https://pubmed.ncbi.nlm.nih.gov/31111215" }, { "database": "PubMed", "id": "31120902", "url": "https://pubmed.ncbi.nlm.nih.gov/31120902" }, { "database": "PubMed", "id": "31138113", "url": "https://pubmed.ncbi.nlm.nih.gov/31138113" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31217894", "url": "https://pubmed.ncbi.nlm.nih.gov/31217894" }, { "database": "PubMed", "id": "31231694", "url": "https://pubmed.ncbi.nlm.nih.gov/31231694" }, { "database": "PubMed", "id": "31336690", "url": "https://pubmed.ncbi.nlm.nih.gov/31336690" }, { "database": "PubMed", "id": "31360122", "url": "https://pubmed.ncbi.nlm.nih.gov/31360122" }, { "database": "PubMed", "id": "31366902", "url": "https://pubmed.ncbi.nlm.nih.gov/31366902" }, { "database": "PubMed", "id": "31379409", "url": "https://pubmed.ncbi.nlm.nih.gov/31379409" }, { "database": "PubMed", "id": "31388677", "url": "https://pubmed.ncbi.nlm.nih.gov/31388677" }, { "database": "PubMed", "id": "31421458", "url": "https://pubmed.ncbi.nlm.nih.gov/31421458" }, { "database": "PubMed", "id": "31462218", "url": "https://pubmed.ncbi.nlm.nih.gov/31462218" }, { "database": "PubMed", "id": "31551768", "url": "https://pubmed.ncbi.nlm.nih.gov/31551768" }, { "database": "PubMed", "id": "31594538", "url": "https://pubmed.ncbi.nlm.nih.gov/31594538" }, { "database": "PubMed", "id": "31596196", "url": "https://pubmed.ncbi.nlm.nih.gov/31596196" }, { "database": "PubMed", "id": "31615975", "url": "https://pubmed.ncbi.nlm.nih.gov/31615975" }, { "database": "PubMed", "id": "31699974", "url": "https://pubmed.ncbi.nlm.nih.gov/31699974" }, { "database": "PubMed", "id": "31804459", "url": "https://pubmed.ncbi.nlm.nih.gov/31804459" }, { "database": "PubMed", "id": "31821701", "url": "https://pubmed.ncbi.nlm.nih.gov/31821701" }, { "database": "PubMed", "id": "31844686", "url": "https://pubmed.ncbi.nlm.nih.gov/31844686" }, { "database": "PubMed", "id": "31847237", "url": "https://pubmed.ncbi.nlm.nih.gov/31847237" }, { "database": "PubMed", "id": "31861721", "url": "https://pubmed.ncbi.nlm.nih.gov/31861721" }, { "database": "PubMed", "id": "31979361", "url": "https://pubmed.ncbi.nlm.nih.gov/31979361" }, { "database": "PubMed", "id": "32001678", "url": "https://pubmed.ncbi.nlm.nih.gov/32001678" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32054925", "url": "https://pubmed.ncbi.nlm.nih.gov/32054925" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32168910", "url": "https://pubmed.ncbi.nlm.nih.gov/32168910" }, { "database": "PubMed", "id": "32213959", "url": "https://pubmed.ncbi.nlm.nih.gov/32213959" }, { "database": "PubMed", "id": "32260204", "url": "https://pubmed.ncbi.nlm.nih.gov/32260204" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32427887", "url": "https://pubmed.ncbi.nlm.nih.gov/32427887" }, { "database": "PubMed", "id": "32432260", "url": "https://pubmed.ncbi.nlm.nih.gov/32432260" }, { "database": "PubMed", "id": "32492656", "url": "https://pubmed.ncbi.nlm.nih.gov/32492656" }, { "database": "PubMed", "id": "32560563", "url": "https://pubmed.ncbi.nlm.nih.gov/32560563" }, { "database": "PubMed", "id": "32605139", "url": "https://pubmed.ncbi.nlm.nih.gov/32605139" }, { "database": "PubMed", "id": "32617134", "url": "https://pubmed.ncbi.nlm.nih.gov/32617134" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32724100", "url": "https://pubmed.ncbi.nlm.nih.gov/32724100" }, { "database": "PubMed", "id": "32733438", "url": "https://pubmed.ncbi.nlm.nih.gov/32733438" }, { "database": "PubMed", "id": "32735894", "url": "https://pubmed.ncbi.nlm.nih.gov/32735894" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863918", "url": "https://pubmed.ncbi.nlm.nih.gov/32863918" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "32929340", "url": "https://pubmed.ncbi.nlm.nih.gov/32929340" }, { "database": "PubMed", "id": "32945487", "url": "https://pubmed.ncbi.nlm.nih.gov/32945487" }, { "database": "PubMed", "id": "32978372", "url": "https://pubmed.ncbi.nlm.nih.gov/32978372" }, { "database": "PubMed", "id": "33014050", "url": "https://pubmed.ncbi.nlm.nih.gov/33014050" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33061640", "url": "https://pubmed.ncbi.nlm.nih.gov/33061640" }, { "database": "PubMed", "id": "33074128", "url": "https://pubmed.ncbi.nlm.nih.gov/33074128" }, { "database": "PubMed", "id": "33085644", "url": "https://pubmed.ncbi.nlm.nih.gov/33085644" }, { "database": "PubMed", "id": "33097607", "url": "https://pubmed.ncbi.nlm.nih.gov/33097607" }, { "database": "PubMed", "id": "33110364", "url": "https://pubmed.ncbi.nlm.nih.gov/33110364" }, { "database": "PubMed", "id": "33146634", "url": "https://pubmed.ncbi.nlm.nih.gov/33146634" }, { "database": "PubMed", "id": "33166398", "url": "https://pubmed.ncbi.nlm.nih.gov/33166398" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33245719", "url": "https://pubmed.ncbi.nlm.nih.gov/33245719" }, { "database": "PubMed", "id": "33251333", "url": "https://pubmed.ncbi.nlm.nih.gov/33251333" }, { "database": "PubMed", "id": "33297931", "url": "https://pubmed.ncbi.nlm.nih.gov/33297931" }, { "database": "PubMed", "id": "33303632", "url": "https://pubmed.ncbi.nlm.nih.gov/33303632" }, { "database": "PubMed", "id": "33391525", "url": "https://pubmed.ncbi.nlm.nih.gov/33391525" }, { "database": "PubMed", "id": "33396303", "url": "https://pubmed.ncbi.nlm.nih.gov/33396303" }, { "database": "PubMed", "id": "33411764", "url": "https://pubmed.ncbi.nlm.nih.gov/33411764" }, { "database": "PubMed", "id": "33431809", "url": "https://pubmed.ncbi.nlm.nih.gov/33431809" }, { "database": "PubMed", "id": "33503543", "url": "https://pubmed.ncbi.nlm.nih.gov/33503543" }, { "database": "PubMed", "id": "33536467", "url": "https://pubmed.ncbi.nlm.nih.gov/33536467" }, { "database": "PubMed", "id": "33585229", "url": "https://pubmed.ncbi.nlm.nih.gov/33585229" }, { "database": "PubMed", "id": "33669867", "url": "https://pubmed.ncbi.nlm.nih.gov/33669867" }, { "database": "PubMed", "id": "33745968", "url": "https://pubmed.ncbi.nlm.nih.gov/33745968" }, { "database": "PubMed", "id": "33761896", "url": "https://pubmed.ncbi.nlm.nih.gov/33761896" }, { "database": "PubMed", "id": "33804124", "url": "https://pubmed.ncbi.nlm.nih.gov/33804124" }, { "database": "PubMed", "id": "33808426", "url": "https://pubmed.ncbi.nlm.nih.gov/33808426" }, { "database": "PubMed", "id": "33850227", "url": "https://pubmed.ncbi.nlm.nih.gov/33850227" }, { "database": "PubMed", "id": "33898425", "url": "https://pubmed.ncbi.nlm.nih.gov/33898425" }, { "database": "PubMed", "id": "33899121", "url": "https://pubmed.ncbi.nlm.nih.gov/33899121" }, { "database": "PubMed", "id": "33982778", "url": "https://pubmed.ncbi.nlm.nih.gov/33982778" }, { "database": "PubMed", "id": "33982878", "url": "https://pubmed.ncbi.nlm.nih.gov/33982878" }, { "database": "PubMed", "id": "34103468", "url": "https://pubmed.ncbi.nlm.nih.gov/34103468" }, { "database": "PubMed", "id": "34930892", "url": "https://pubmed.ncbi.nlm.nih.gov/34930892" }, { "database": "PubMed", "id": "35143532", "url": "https://pubmed.ncbi.nlm.nih.gov/35143532" }, { "database": "PubMed", "id": "35312310", "url": "https://pubmed.ncbi.nlm.nih.gov/35312310" }, { "database": "PubMed", "id": "35752942", "url": "https://pubmed.ncbi.nlm.nih.gov/35752942" }, { "database": "PubMed", "id": "35792512", "url": "https://pubmed.ncbi.nlm.nih.gov/35792512" }, { "database": "PubMed", "id": "35829882", "url": "https://pubmed.ncbi.nlm.nih.gov/35829882" }, { "database": "PubMed", "id": "35834822", "url": "https://pubmed.ncbi.nlm.nih.gov/35834822" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "36094323", "url": "https://pubmed.ncbi.nlm.nih.gov/36094323" }, { "database": "PubMed", "id": "36293376", "url": "https://pubmed.ncbi.nlm.nih.gov/36293376" }, { "database": "PubMed", "id": "36300938", "url": "https://pubmed.ncbi.nlm.nih.gov/36300938" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8502477", "url": "https://pubmed.ncbi.nlm.nih.gov/8502477" }, { "database": "PubMed", "id": "9407038", "url": "https://pubmed.ncbi.nlm.nih.gov/9407038" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9733514", "url": "https://pubmed.ncbi.nlm.nih.gov/9733514" }, { "database": "PubMed", "id": "9733515", "url": "https://pubmed.ncbi.nlm.nih.gov/9733515" }, { "database": "PubMed", "id": "9830059", "url": "https://pubmed.ncbi.nlm.nih.gov/9830059" }, { "database": "PubMed", "id": "9843217", "url": "https://pubmed.ncbi.nlm.nih.gov/9843217" }, { "database": "PubMed", "id": "11554766", "url": "https://pubmed.ncbi.nlm.nih.gov/11554766" } ], "site_lbl": "Ser15", "uniprot_canonical_ac": "P04637-1" } ], "record_id": "pubmed.24019961", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural alteration of viral homologue of receptor proto-oncogene fms at carboxyl terminus.", "journal": "Nature", "date": "1986", "authors": "Coussens L, Van Beveren C, Smith D, Chen E, Mitchell R L, Isacke C M, Verma I M, Ullrich A", "reference": { "type": "PubMed", "id": "2421165", "url": "https://pubmed.ncbi.nlm.nih.gov/2421165" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2421165", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Haploinsufficiency of CSF-1R and clinicopathologic characterization in patients with HDLS.", "journal": "Neurology", "date": "2014", "authors": "Konno T, Tada M, Tada M, Koyama A, Nozaki H, Harigaya Y, Nishimiya J, Matsunaga A, Yoshikura N, Ishihara K, Arakawa M, Isami A, Okazaki K, Yokoo H, Itoh K, Yoneda M, Kawamura M, Inuzuka T, Takahashi H, Nishizawa M, Onodera O, Kakita A, Ikeuchi T", "reference": { "type": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 546, "end_pos": 546, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" }, { "database": "PubMed", "id": "31827782", "url": "https://pubmed.ncbi.nlm.nih.gov/31827782" } ], "site_lbl": "Tyr546", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 723, "end_pos": 723, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "9191055", "url": "https://pubmed.ncbi.nlm.nih.gov/9191055" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "21266043", "url": "https://pubmed.ncbi.nlm.nih.gov/21266043" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" } ], "site_lbl": "Tyr723", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 809, "end_pos": 809, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "7681396", "url": "https://pubmed.ncbi.nlm.nih.gov/7681396" }, { "database": "PubMed", "id": "2168557", "url": "https://pubmed.ncbi.nlm.nih.gov/2168557" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "31827782", "url": "https://pubmed.ncbi.nlm.nih.gov/31827782" } ], "site_lbl": "Tyr809", "uniprot_canonical_ac": "P07333-1" } ], "record_id": "pubmed.24336230", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hereditary diffuse leukoencephalopathy with axonal spheroids: three patients with stroke-like presentation carrying new mutations in the CSF1R gene.", "journal": "Journal of neurology", "date": "2014", "authors": "Battisti C, Di Donato I, Bianchi S, Monti L, Formichi P, Rufa A, Taglia I, Cerase A, Dotti MT, Federico A", "reference": { "type": "PubMed", "id": "24532199", "url": "https://pubmed.ncbi.nlm.nih.gov/24532199" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24532199", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleotide sequence and structural organization of the human FMS proto-oncogene.", "journal": "Oncogene Res.", "date": "1989", "authors": "Hampe A, Shamoon B M, Gobet M, Sherr C J, Galibert F", "reference": { "type": "PubMed", "id": "2524025", "url": "https://pubmed.ncbi.nlm.nih.gov/2524025" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2524025", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential transcription of exon 1 of the human c-fms gene in placental trophoblasts and monocytes.", "journal": "Mol. Cell. Biol.", "date": "1989", "authors": "Visvader J, Verma I M", "reference": { "type": "PubMed", "id": "2524648", "url": "https://pubmed.ncbi.nlm.nih.gov/2524648" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2524648", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential prognostic impact of interleukin-34 mRNA expression and infiltrating immune cell composition in intrinsic breast cancer subtypes.", "journal": "Oncotarget", "date": "2018-05-01", "authors": "Zins Karin, Heller Gerwin, Mayerhofer Mathias, Schreiber Martin, Abraham Dietmar", "reference": { "type": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 708, "end_pos": 708, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" } ], "site_lbl": "Tyr708", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 723, "end_pos": 723, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "9191055", "url": "https://pubmed.ncbi.nlm.nih.gov/9191055" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "21266043", "url": "https://pubmed.ncbi.nlm.nih.gov/21266043" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" } ], "site_lbl": "Tyr723", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 397, "end_pos": 397, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q05397", "url": "https://www.uniprot.org/uniprotkb/Q05397" }, { "database": "iPTMnet", "id": "Q05397", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05397" }, { "database": "PubMed", "id": "11314030", "url": "https://pubmed.ncbi.nlm.nih.gov/11314030" }, { "database": "PubMed", "id": "12370821", "url": "https://pubmed.ncbi.nlm.nih.gov/12370821" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "7509446", "url": "https://pubmed.ncbi.nlm.nih.gov/7509446" }, { "database": "PubMed", "id": "7529876", "url": "https://pubmed.ncbi.nlm.nih.gov/7529876" }, { "database": "IntAct", "id": "Q05397", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q05397*" }, { "database": "PubMed", "id": "27178753", "url": "https://pubmed.ncbi.nlm.nih.gov/27178753" }, { "database": "PRO", "id": "Q05397", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q05397" }, { "database": "PubMed", "id": "10047444", "url": "https://pubmed.ncbi.nlm.nih.gov/10047444" }, { "database": "PubMed", "id": "10212207", "url": "https://pubmed.ncbi.nlm.nih.gov/10212207" }, { "database": "PubMed", "id": "10400703", "url": "https://pubmed.ncbi.nlm.nih.gov/10400703" }, { "database": "PubMed", "id": "10672902", "url": "https://pubmed.ncbi.nlm.nih.gov/10672902" }, { "database": "PubMed", "id": "10769034", "url": "https://pubmed.ncbi.nlm.nih.gov/10769034" }, { "database": "PubMed", "id": "10816598", "url": "https://pubmed.ncbi.nlm.nih.gov/10816598" }, { "database": "PubMed", "id": "10856226", "url": "https://pubmed.ncbi.nlm.nih.gov/10856226" }, { "database": "PubMed", "id": "10958798", "url": "https://pubmed.ncbi.nlm.nih.gov/10958798" }, { "database": "PubMed", "id": "10998418", "url": "https://pubmed.ncbi.nlm.nih.gov/10998418" }, { "database": "PubMed", "id": "11027591", "url": "https://pubmed.ncbi.nlm.nih.gov/11027591" }, { "database": "PubMed", "id": "11119718", "url": "https://pubmed.ncbi.nlm.nih.gov/11119718" }, { "database": "PubMed", "id": "11149924", "url": "https://pubmed.ncbi.nlm.nih.gov/11149924" }, { "database": "PubMed", "id": "11278488", "url": "https://pubmed.ncbi.nlm.nih.gov/11278488" }, { "database": "PubMed", "id": "11313859", "url": "https://pubmed.ncbi.nlm.nih.gov/11313859" }, { "database": "PubMed", "id": "11438458", "url": "https://pubmed.ncbi.nlm.nih.gov/11438458" }, { "database": "PubMed", "id": "11448998", "url": "https://pubmed.ncbi.nlm.nih.gov/11448998" }, { "database": "PubMed", "id": "11572981", "url": "https://pubmed.ncbi.nlm.nih.gov/11572981" }, { "database": "PubMed", "id": "11585739", "url": "https://pubmed.ncbi.nlm.nih.gov/11585739" }, { "database": "PubMed", "id": "11602246", "url": "https://pubmed.ncbi.nlm.nih.gov/11602246" }, { "database": "PubMed", "id": "11606050", "url": "https://pubmed.ncbi.nlm.nih.gov/11606050" }, { "database": "PubMed", "id": "11668182", "url": "https://pubmed.ncbi.nlm.nih.gov/11668182" }, { "database": "PubMed", "id": "11696015", "url": "https://pubmed.ncbi.nlm.nih.gov/11696015" }, { "database": "PubMed", "id": "11787067", "url": "https://pubmed.ncbi.nlm.nih.gov/11787067" }, { "database": "PubMed", "id": "11807823", "url": "https://pubmed.ncbi.nlm.nih.gov/11807823" }, { "database": "PubMed", "id": "11891289", "url": "https://pubmed.ncbi.nlm.nih.gov/11891289" }, { "database": "PubMed", "id": "11909938", "url": "https://pubmed.ncbi.nlm.nih.gov/11909938" }, { "database": "PubMed", "id": "12021278", "url": "https://pubmed.ncbi.nlm.nih.gov/12021278" }, { "database": "PubMed", "id": "12084011", "url": "https://pubmed.ncbi.nlm.nih.gov/12084011" }, { "database": "PubMed", "id": "12215217", "url": "https://pubmed.ncbi.nlm.nih.gov/12215217" }, { "database": "PubMed", "id": "12370243", "url": "https://pubmed.ncbi.nlm.nih.gov/12370243" }, { "database": "PubMed", "id": "12391143", "url": "https://pubmed.ncbi.nlm.nih.gov/12391143" }, { "database": "PubMed", "id": "12558988", "url": "https://pubmed.ncbi.nlm.nih.gov/12558988" }, { "database": "PubMed", "id": "12615911", "url": "https://pubmed.ncbi.nlm.nih.gov/12615911" }, { "database": "PubMed", "id": "12640026", "url": "https://pubmed.ncbi.nlm.nih.gov/12640026" }, { "database": "PubMed", "id": "12700132", "url": "https://pubmed.ncbi.nlm.nih.gov/12700132" }, { "database": "PubMed", "id": "12730223", "url": "https://pubmed.ncbi.nlm.nih.gov/12730223" }, { "database": "PubMed", "id": "12738990", "url": "https://pubmed.ncbi.nlm.nih.gov/12738990" }, { "database": "PubMed", "id": "12761229", "url": "https://pubmed.ncbi.nlm.nih.gov/12761229" }, { "database": "PubMed", "id": "12838315", "url": "https://pubmed.ncbi.nlm.nih.gov/12838315" }, { "database": "PubMed", "id": "12871985", "url": "https://pubmed.ncbi.nlm.nih.gov/12871985" }, { "database": "PubMed", "id": "12876277", "url": "https://pubmed.ncbi.nlm.nih.gov/12876277" }, { "database": "PubMed", "id": "12876384", "url": "https://pubmed.ncbi.nlm.nih.gov/12876384" }, { "database": "PubMed", "id": "12927054", "url": "https://pubmed.ncbi.nlm.nih.gov/12927054" }, { "database": "PubMed", "id": "12960434", "url": "https://pubmed.ncbi.nlm.nih.gov/12960434" }, { "database": "PubMed", "id": "14500712", "url": "https://pubmed.ncbi.nlm.nih.gov/14500712" }, { "database": "PubMed", "id": "14603053", "url": "https://pubmed.ncbi.nlm.nih.gov/14603053" }, { "database": "PubMed", "id": "14604860", "url": "https://pubmed.ncbi.nlm.nih.gov/14604860" }, { "database": "PubMed", "id": "14610060", "url": "https://pubmed.ncbi.nlm.nih.gov/14610060" }, { "database": "PubMed", "id": "14666664", "url": "https://pubmed.ncbi.nlm.nih.gov/14666664" }, { "database": "PubMed", "id": "14670178", "url": "https://pubmed.ncbi.nlm.nih.gov/14670178" }, { "database": "PubMed", "id": "14703945", "url": "https://pubmed.ncbi.nlm.nih.gov/14703945" }, { "database": "PubMed", "id": "14712221", "url": "https://pubmed.ncbi.nlm.nih.gov/14712221" }, { "database": "PubMed", "id": "14761895", "url": "https://pubmed.ncbi.nlm.nih.gov/14761895" }, { "database": "PubMed", "id": "14978737", "url": "https://pubmed.ncbi.nlm.nih.gov/14978737" }, { "database": "PubMed", "id": "15126359", "url": "https://pubmed.ncbi.nlm.nih.gov/15126359" }, { "database": "PubMed", "id": "15138291", "url": "https://pubmed.ncbi.nlm.nih.gov/15138291" }, { "database": "PubMed", "id": "15210734", "url": "https://pubmed.ncbi.nlm.nih.gov/15210734" }, { "database": "PubMed", "id": "15242759", "url": "https://pubmed.ncbi.nlm.nih.gov/15242759" }, { "database": "PubMed", "id": "15246682", "url": "https://pubmed.ncbi.nlm.nih.gov/15246682" }, { "database": "PubMed", "id": "15263022", "url": "https://pubmed.ncbi.nlm.nih.gov/15263022" }, { "database": "PubMed", "id": "15331608", "url": "https://pubmed.ncbi.nlm.nih.gov/15331608" }, { "database": "PubMed", "id": "15598735", "url": "https://pubmed.ncbi.nlm.nih.gov/15598735" }, { "database": "PubMed", "id": "15611137", "url": "https://pubmed.ncbi.nlm.nih.gov/15611137" }, { "database": "PubMed", "id": "15625302", "url": "https://pubmed.ncbi.nlm.nih.gov/15625302" }, { "database": "PubMed", "id": "15694384", "url": "https://pubmed.ncbi.nlm.nih.gov/15694384" }, { "database": "PubMed", "id": "15707572", "url": "https://pubmed.ncbi.nlm.nih.gov/15707572" }, { "database": "PubMed", "id": "15707596", "url": "https://pubmed.ncbi.nlm.nih.gov/15707596" }, { "database": "PubMed", "id": "15785954", "url": "https://pubmed.ncbi.nlm.nih.gov/15785954" }, { "database": "PubMed", "id": "15817454", "url": "https://pubmed.ncbi.nlm.nih.gov/15817454" }, { "database": "PubMed", "id": "15890789", "url": "https://pubmed.ncbi.nlm.nih.gov/15890789" }, { "database": "PubMed", "id": "15963258", "url": "https://pubmed.ncbi.nlm.nih.gov/15963258" }, { "database": "PubMed", "id": "16039608", "url": "https://pubmed.ncbi.nlm.nih.gov/16039608" }, { "database": "PubMed", "id": "16153436", "url": "https://pubmed.ncbi.nlm.nih.gov/16153436" }, { "database": "PubMed", "id": "16159962", "url": "https://pubmed.ncbi.nlm.nih.gov/16159962" }, { "database": "PubMed", "id": "16195476", "url": "https://pubmed.ncbi.nlm.nih.gov/16195476" }, { "database": "PubMed", "id": "16253116", "url": "https://pubmed.ncbi.nlm.nih.gov/16253116" }, { "database": "PubMed", "id": "16267008", "url": "https://pubmed.ncbi.nlm.nih.gov/16267008" }, { "database": "PubMed", "id": "16275754", "url": "https://pubmed.ncbi.nlm.nih.gov/16275754" }, { "database": "PubMed", "id": "16415178", "url": "https://pubmed.ncbi.nlm.nih.gov/16415178" }, { "database": "PubMed", "id": "16461767", "url": "https://pubmed.ncbi.nlm.nih.gov/16461767" }, { "database": "PubMed", "id": "16473349", "url": "https://pubmed.ncbi.nlm.nih.gov/16473349" }, { "database": "PubMed", "id": "16523241", "url": "https://pubmed.ncbi.nlm.nih.gov/16523241" }, { "database": "PubMed", "id": "16574795", "url": "https://pubmed.ncbi.nlm.nih.gov/16574795" }, { "database": "PubMed", "id": "16728403", "url": "https://pubmed.ncbi.nlm.nih.gov/16728403" }, { "database": "PubMed", "id": "16847103", "url": "https://pubmed.ncbi.nlm.nih.gov/16847103" }, { "database": "PubMed", "id": "16912186", "url": "https://pubmed.ncbi.nlm.nih.gov/16912186" }, { "database": "PubMed", "id": "16917494", "url": "https://pubmed.ncbi.nlm.nih.gov/16917494" }, { "database": "PubMed", "id": "16920701", "url": "https://pubmed.ncbi.nlm.nih.gov/16920701" }, { "database": "PubMed", "id": "16998832", "url": "https://pubmed.ncbi.nlm.nih.gov/16998832" }, { "database": "PubMed", "id": "17081517", "url": "https://pubmed.ncbi.nlm.nih.gov/17081517" }, { "database": "PubMed", "id": "17088251", "url": "https://pubmed.ncbi.nlm.nih.gov/17088251" }, { "database": "PubMed", "id": "17096371", "url": "https://pubmed.ncbi.nlm.nih.gov/17096371" }, { "database": "PubMed", "id": "17117420", "url": "https://pubmed.ncbi.nlm.nih.gov/17117420" }, { "database": "PubMed", "id": "17215324", "url": "https://pubmed.ncbi.nlm.nih.gov/17215324" }, { "database": "PubMed", "id": "17219439", "url": "https://pubmed.ncbi.nlm.nih.gov/17219439" }, { "database": "PubMed", "id": "17234774", "url": "https://pubmed.ncbi.nlm.nih.gov/17234774" }, { "database": "PubMed", "id": "17234784", "url": "https://pubmed.ncbi.nlm.nih.gov/17234784" }, { "database": "PubMed", "id": "17240116", "url": "https://pubmed.ncbi.nlm.nih.gov/17240116" }, { "database": "PubMed", "id": "17395594", "url": "https://pubmed.ncbi.nlm.nih.gov/17395594" }, { "database": "PubMed", "id": "17431114", "url": "https://pubmed.ncbi.nlm.nih.gov/17431114" }, { "database": "PubMed", "id": "17497960", "url": "https://pubmed.ncbi.nlm.nih.gov/17497960" }, { "database": "PubMed", "id": "17524523", "url": "https://pubmed.ncbi.nlm.nih.gov/17524523" }, { "database": "PubMed", "id": "17721515", "url": "https://pubmed.ncbi.nlm.nih.gov/17721515" }, { "database": "PubMed", "id": "17898132", "url": "https://pubmed.ncbi.nlm.nih.gov/17898132" }, { "database": "PubMed", "id": "18006843", "url": "https://pubmed.ncbi.nlm.nih.gov/18006843" }, { "database": "PubMed", "id": "18032789", "url": "https://pubmed.ncbi.nlm.nih.gov/18032789" }, { "database": "PubMed", "id": "18171471", "url": "https://pubmed.ncbi.nlm.nih.gov/18171471" }, { "database": "PubMed", "id": "18198129", "url": "https://pubmed.ncbi.nlm.nih.gov/18198129" }, { "database": "PubMed", "id": "18314876", "url": "https://pubmed.ncbi.nlm.nih.gov/18314876" }, { "database": "PubMed", "id": "18343694", "url": "https://pubmed.ncbi.nlm.nih.gov/18343694" }, { "database": "PubMed", "id": "18349846", "url": "https://pubmed.ncbi.nlm.nih.gov/18349846" }, { "database": "PubMed", "id": "18382658", "url": "https://pubmed.ncbi.nlm.nih.gov/18382658" }, { "database": "PubMed", "id": "18562041", "url": "https://pubmed.ncbi.nlm.nih.gov/18562041" }, { "database": "PubMed", "id": "18676832", "url": "https://pubmed.ncbi.nlm.nih.gov/18676832" }, { "database": "PubMed", "id": "18757826", "url": "https://pubmed.ncbi.nlm.nih.gov/18757826" }, { "database": "PubMed", "id": "18774960", "url": "https://pubmed.ncbi.nlm.nih.gov/18774960" }, { "database": "PubMed", "id": "18805444", "url": "https://pubmed.ncbi.nlm.nih.gov/18805444" }, { "database": "PubMed", "id": "18922173", "url": "https://pubmed.ncbi.nlm.nih.gov/18922173" }, { "database": "PubMed", "id": "18923058", "url": "https://pubmed.ncbi.nlm.nih.gov/18923058" }, { "database": "PubMed", "id": "18930841", "url": "https://pubmed.ncbi.nlm.nih.gov/18930841" }, { "database": "PubMed", "id": "18989950", "url": "https://pubmed.ncbi.nlm.nih.gov/18989950" }, { "database": "PubMed", "id": "19029090", "url": "https://pubmed.ncbi.nlm.nih.gov/19029090" }, { "database": "PubMed", "id": "19190626", "url": "https://pubmed.ncbi.nlm.nih.gov/19190626" }, { "database": "PubMed", "id": "19212436", "url": "https://pubmed.ncbi.nlm.nih.gov/19212436" }, { "database": "PubMed", "id": "19260479", "url": "https://pubmed.ncbi.nlm.nih.gov/19260479" }, { "database": "PubMed", "id": "19294408", "url": "https://pubmed.ncbi.nlm.nih.gov/19294408" }, { "database": "PubMed", "id": "19297531", "url": "https://pubmed.ncbi.nlm.nih.gov/19297531" }, { "database": "PubMed", "id": "19553453", "url": "https://pubmed.ncbi.nlm.nih.gov/19553453" }, { "database": "PubMed", "id": "19568240", "url": "https://pubmed.ncbi.nlm.nih.gov/19568240" }, { "database": "PubMed", "id": "19657053", "url": "https://pubmed.ncbi.nlm.nih.gov/19657053" }, { "database": "PubMed", "id": "19671193", "url": "https://pubmed.ncbi.nlm.nih.gov/19671193" }, { "database": "PubMed", "id": "19695571", "url": "https://pubmed.ncbi.nlm.nih.gov/19695571" }, { "database": "PubMed", "id": "19740433", "url": "https://pubmed.ncbi.nlm.nih.gov/19740433" }, { "database": "PubMed", "id": "19787193", "url": "https://pubmed.ncbi.nlm.nih.gov/19787193" }, { "database": "PubMed", "id": "19826415", "url": "https://pubmed.ncbi.nlm.nih.gov/19826415" }, { "database": "PubMed", "id": "19834610", "url": "https://pubmed.ncbi.nlm.nih.gov/19834610" }, { "database": "PubMed", "id": "19883375", "url": "https://pubmed.ncbi.nlm.nih.gov/19883375" }, { "database": "PubMed", "id": "19923420", "url": "https://pubmed.ncbi.nlm.nih.gov/19923420" }, { "database": "PubMed", "id": "19931412", "url": "https://pubmed.ncbi.nlm.nih.gov/19931412" }, { "database": "PubMed", "id": "20014455", "url": "https://pubmed.ncbi.nlm.nih.gov/20014455" }, { "database": "PubMed", "id": "20018849", "url": "https://pubmed.ncbi.nlm.nih.gov/20018849" }, { "database": "PubMed", "id": "20021699", "url": "https://pubmed.ncbi.nlm.nih.gov/20021699" }, { "database": "PubMed", "id": "20082722", "url": "https://pubmed.ncbi.nlm.nih.gov/20082722" }, { "database": "PubMed", "id": "20122724", "url": "https://pubmed.ncbi.nlm.nih.gov/20122724" }, { "database": "PubMed", "id": "20160475", "url": "https://pubmed.ncbi.nlm.nih.gov/20160475" }, { "database": "PubMed", "id": "20180147", "url": "https://pubmed.ncbi.nlm.nih.gov/20180147" }, { "database": "PubMed", "id": "20224789", "url": "https://pubmed.ncbi.nlm.nih.gov/20224789" }, { "database": "PubMed", "id": "20308429", "url": "https://pubmed.ncbi.nlm.nih.gov/20308429" }, { "database": "PubMed", "id": "20354780", "url": "https://pubmed.ncbi.nlm.nih.gov/20354780" }, { "database": "PubMed", "id": "20357007", "url": "https://pubmed.ncbi.nlm.nih.gov/20357007" }, { "database": "PubMed", "id": "20378826", "url": "https://pubmed.ncbi.nlm.nih.gov/20378826" }, { "database": "PubMed", "id": "20527022", "url": "https://pubmed.ncbi.nlm.nih.gov/20527022" }, { "database": "PubMed", "id": "20621036", "url": "https://pubmed.ncbi.nlm.nih.gov/20621036" }, { "database": "PubMed", "id": "20657775", "url": "https://pubmed.ncbi.nlm.nih.gov/20657775" }, { "database": "PubMed", "id": "20713357", "url": "https://pubmed.ncbi.nlm.nih.gov/20713357" }, { "database": "PubMed", "id": "20724588", "url": "https://pubmed.ncbi.nlm.nih.gov/20724588" }, { "database": "PubMed", "id": "20802517", "url": "https://pubmed.ncbi.nlm.nih.gov/20802517" }, { "database": "PubMed", "id": "20847951", "url": "https://pubmed.ncbi.nlm.nih.gov/20847951" }, { "database": "PubMed", "id": "20927395", "url": "https://pubmed.ncbi.nlm.nih.gov/20927395" }, { "database": "PubMed", "id": "20955590", "url": "https://pubmed.ncbi.nlm.nih.gov/20955590" }, { "database": "PubMed", "id": "21073482", "url": "https://pubmed.ncbi.nlm.nih.gov/21073482" }, { "database": "PubMed", "id": "21084641", "url": "https://pubmed.ncbi.nlm.nih.gov/21084641" }, { "database": "PubMed", "id": "21119598", "url": "https://pubmed.ncbi.nlm.nih.gov/21119598" }, { "database": "PubMed", "id": "21209368", "url": "https://pubmed.ncbi.nlm.nih.gov/21209368" }, { "database": "PubMed", "id": "21344482", "url": "https://pubmed.ncbi.nlm.nih.gov/21344482" }, { "database": "PubMed", "id": "21359179", "url": "https://pubmed.ncbi.nlm.nih.gov/21359179" }, { "database": "PubMed", "id": "21401419", "url": "https://pubmed.ncbi.nlm.nih.gov/21401419" }, { "database": "PubMed", "id": "21408150", "url": "https://pubmed.ncbi.nlm.nih.gov/21408150" }, { "database": "PubMed", "id": "21418517", "url": "https://pubmed.ncbi.nlm.nih.gov/21418517" }, { "database": "PubMed", "id": "21426305", "url": "https://pubmed.ncbi.nlm.nih.gov/21426305" }, { "database": "PubMed", "id": "21556755", "url": "https://pubmed.ncbi.nlm.nih.gov/21556755" }, { "database": "PubMed", "id": "21660950", "url": "https://pubmed.ncbi.nlm.nih.gov/21660950" }, { "database": "PubMed", "id": "21716326", "url": "https://pubmed.ncbi.nlm.nih.gov/21716326" }, { "database": "PubMed", "id": "21720547", "url": "https://pubmed.ncbi.nlm.nih.gov/21720547" }, { "database": "PubMed", "id": "21887232", "url": "https://pubmed.ncbi.nlm.nih.gov/21887232" }, { "database": "PubMed", "id": "21898412", "url": "https://pubmed.ncbi.nlm.nih.gov/21898412" }, { "database": "PubMed", "id": "21903606", "url": "https://pubmed.ncbi.nlm.nih.gov/21903606" }, { "database": "PubMed", "id": "21967109", "url": "https://pubmed.ncbi.nlm.nih.gov/21967109" }, { "database": "PubMed", "id": "22042621", "url": "https://pubmed.ncbi.nlm.nih.gov/22042621" }, { "database": "PubMed", "id": "22069492", "url": "https://pubmed.ncbi.nlm.nih.gov/22069492" }, { "database": "PubMed", "id": "22070920", "url": "https://pubmed.ncbi.nlm.nih.gov/22070920" }, { "database": "PubMed", "id": "22078467", "url": "https://pubmed.ncbi.nlm.nih.gov/22078467" }, { "database": "PubMed", "id": "22136719", "url": "https://pubmed.ncbi.nlm.nih.gov/22136719" }, { "database": "PubMed", "id": "22149259", "url": "https://pubmed.ncbi.nlm.nih.gov/22149259" }, { "database": "PubMed", "id": "22174684", "url": "https://pubmed.ncbi.nlm.nih.gov/22174684" }, { "database": "PubMed", "id": "22194972", "url": "https://pubmed.ncbi.nlm.nih.gov/22194972" }, { "database": "PubMed", "id": "22216254", "url": "https://pubmed.ncbi.nlm.nih.gov/22216254" }, { "database": "PubMed", "id": "22267972", "url": "https://pubmed.ncbi.nlm.nih.gov/22267972" }, { "database": "PubMed", "id": "22270917", "url": "https://pubmed.ncbi.nlm.nih.gov/22270917" }, { "database": "PubMed", "id": "22319618", "url": "https://pubmed.ncbi.nlm.nih.gov/22319618" }, { "database": "PubMed", "id": "22544741", "url": "https://pubmed.ncbi.nlm.nih.gov/22544741" }, { "database": "PubMed", "id": "22550026", "url": "https://pubmed.ncbi.nlm.nih.gov/22550026" }, { "database": "PubMed", "id": "22641287", "url": "https://pubmed.ncbi.nlm.nih.gov/22641287" }, { "database": "PubMed", "id": "22710722", "url": "https://pubmed.ncbi.nlm.nih.gov/22710722" }, { "database": "PubMed", "id": "22734001", "url": "https://pubmed.ncbi.nlm.nih.gov/22734001" }, { "database": "PubMed", "id": "22766511", "url": "https://pubmed.ncbi.nlm.nih.gov/22766511" }, { "database": "PubMed", "id": "22810307", "url": "https://pubmed.ncbi.nlm.nih.gov/22810307" }, { "database": "PubMed", "id": "22824793", "url": "https://pubmed.ncbi.nlm.nih.gov/22824793" }, { "database": "PubMed", "id": "22876288", "url": "https://pubmed.ncbi.nlm.nih.gov/22876288" }, { "database": "PubMed", "id": "22938480", "url": "https://pubmed.ncbi.nlm.nih.gov/22938480" }, { "database": "PubMed", "id": "22952866", "url": "https://pubmed.ncbi.nlm.nih.gov/22952866" }, { "database": "PubMed", "id": "22982417", "url": "https://pubmed.ncbi.nlm.nih.gov/22982417" }, { "database": "PubMed", "id": "23102268", "url": "https://pubmed.ncbi.nlm.nih.gov/23102268" }, { "database": "PubMed", "id": "23109808", "url": "https://pubmed.ncbi.nlm.nih.gov/23109808" }, { "database": "PubMed", "id": "23128389", "url": "https://pubmed.ncbi.nlm.nih.gov/23128389" }, { "database": "PubMed", "id": "23209645", "url": "https://pubmed.ncbi.nlm.nih.gov/23209645" }, { "database": "PubMed", "id": "23264741", "url": "https://pubmed.ncbi.nlm.nih.gov/23264741" }, { "database": "PubMed", "id": "23272972", "url": "https://pubmed.ncbi.nlm.nih.gov/23272972" }, { "database": "PubMed", "id": "23339185", "url": "https://pubmed.ncbi.nlm.nih.gov/23339185" }, { "database": "PubMed", "id": "23357870", "url": "https://pubmed.ncbi.nlm.nih.gov/23357870" }, { "database": "PubMed", "id": "23485561", "url": "https://pubmed.ncbi.nlm.nih.gov/23485561" }, { "database": "PubMed", "id": "23515360", "url": "https://pubmed.ncbi.nlm.nih.gov/23515360" }, { "database": "PubMed", "id": "23525457", "url": "https://pubmed.ncbi.nlm.nih.gov/23525457" }, { "database": "PubMed", "id": "23681745", "url": "https://pubmed.ncbi.nlm.nih.gov/23681745" }, { "database": "PubMed", "id": "23755096", "url": "https://pubmed.ncbi.nlm.nih.gov/23755096" }, { "database": "PubMed", "id": "23755149", "url": "https://pubmed.ncbi.nlm.nih.gov/23755149" }, { "database": "PubMed", "id": "23792569", "url": "https://pubmed.ncbi.nlm.nih.gov/23792569" }, { "database": "PubMed", "id": "23812425", "url": "https://pubmed.ncbi.nlm.nih.gov/23812425" }, { "database": "PubMed", "id": "23836527", "url": "https://pubmed.ncbi.nlm.nih.gov/23836527" }, { "database": "PubMed", "id": "23858760", "url": "https://pubmed.ncbi.nlm.nih.gov/23858760" }, { "database": "PubMed", "id": "23874694", "url": "https://pubmed.ncbi.nlm.nih.gov/23874694" }, { "database": "PubMed", "id": "23970932", "url": "https://pubmed.ncbi.nlm.nih.gov/23970932" }, { "database": "PubMed", "id": "23984323", "url": "https://pubmed.ncbi.nlm.nih.gov/23984323" }, { "database": "PubMed", "id": "24010829", "url": "https://pubmed.ncbi.nlm.nih.gov/24010829" }, { "database": "PubMed", "id": "24025096", "url": "https://pubmed.ncbi.nlm.nih.gov/24025096" }, { "database": "PubMed", "id": "24039840", "url": "https://pubmed.ncbi.nlm.nih.gov/24039840" }, { "database": "PubMed", "id": "24039841", "url": "https://pubmed.ncbi.nlm.nih.gov/24039841" }, { "database": "PubMed", "id": "24040310", "url": "https://pubmed.ncbi.nlm.nih.gov/24040310" }, { "database": "PubMed", "id": "24058594", "url": "https://pubmed.ncbi.nlm.nih.gov/24058594" }, { "database": "PubMed", "id": "24062525", "url": "https://pubmed.ncbi.nlm.nih.gov/24062525" }, { "database": "PubMed", "id": "24083092", "url": "https://pubmed.ncbi.nlm.nih.gov/24083092" }, { "database": "PubMed", "id": "24091658", "url": "https://pubmed.ncbi.nlm.nih.gov/24091658" }, { "database": "PubMed", "id": "24121667", "url": "https://pubmed.ncbi.nlm.nih.gov/24121667" }, { "database": "PubMed", "id": "24123071", "url": "https://pubmed.ncbi.nlm.nih.gov/24123071" }, { "database": "PubMed", "id": "24194567", "url": "https://pubmed.ncbi.nlm.nih.gov/24194567" }, { "database": "PubMed", "id": "24201748", "url": "https://pubmed.ncbi.nlm.nih.gov/24201748" }, { "database": "PubMed", "id": "24260201", "url": "https://pubmed.ncbi.nlm.nih.gov/24260201" }, { "database": "PubMed", "id": "24290759", "url": "https://pubmed.ncbi.nlm.nih.gov/24290759" }, { "database": "PubMed", "id": "24294595", "url": "https://pubmed.ncbi.nlm.nih.gov/24294595" }, { "database": "PubMed", "id": "24360952", "url": "https://pubmed.ncbi.nlm.nih.gov/24360952" }, { "database": "PubMed", "id": "24370784", "url": "https://pubmed.ncbi.nlm.nih.gov/24370784" }, { "database": "PubMed", "id": "24381802", "url": "https://pubmed.ncbi.nlm.nih.gov/24381802" }, { "database": "PubMed", "id": "24409152", "url": "https://pubmed.ncbi.nlm.nih.gov/24409152" }, { "database": "PubMed", "id": "24533083", "url": "https://pubmed.ncbi.nlm.nih.gov/24533083" }, { "database": "PubMed", "id": "24586773", "url": "https://pubmed.ncbi.nlm.nih.gov/24586773" }, { "database": "PubMed", "id": "24632806", "url": "https://pubmed.ncbi.nlm.nih.gov/24632806" }, { "database": "PubMed", "id": "24642576", "url": "https://pubmed.ncbi.nlm.nih.gov/24642576" }, { "database": "PubMed", "id": "24655477", "url": "https://pubmed.ncbi.nlm.nih.gov/24655477" }, { "database": "PubMed", "id": "24681892", "url": "https://pubmed.ncbi.nlm.nih.gov/24681892" }, { "database": "PubMed", "id": "24706070", "url": "https://pubmed.ncbi.nlm.nih.gov/24706070" }, { "database": "PubMed", "id": "24736807", "url": "https://pubmed.ncbi.nlm.nih.gov/24736807" }, { "database": "PubMed", "id": "24772088", "url": "https://pubmed.ncbi.nlm.nih.gov/24772088" }, { "database": "PubMed", "id": "24786638", "url": "https://pubmed.ncbi.nlm.nih.gov/24786638" }, { "database": "PubMed", "id": "24858039", "url": "https://pubmed.ncbi.nlm.nih.gov/24858039" }, { "database": "PubMed", "id": "24863845", "url": "https://pubmed.ncbi.nlm.nih.gov/24863845" }, { "database": "PubMed", "id": "24885534", "url": "https://pubmed.ncbi.nlm.nih.gov/24885534" }, { "database": "PubMed", "id": "24885567", "url": "https://pubmed.ncbi.nlm.nih.gov/24885567" }, { "database": "PubMed", "id": "24894151", "url": "https://pubmed.ncbi.nlm.nih.gov/24894151" }, { "database": "PubMed", "id": "24911159", "url": "https://pubmed.ncbi.nlm.nih.gov/24911159" }, { "database": "PubMed", "id": "24999733", "url": "https://pubmed.ncbi.nlm.nih.gov/24999733" }, { "database": "PubMed", "id": "25056351", "url": "https://pubmed.ncbi.nlm.nih.gov/25056351" }, { "database": "PubMed", "id": "25113248", "url": "https://pubmed.ncbi.nlm.nih.gov/25113248" }, { "database": "PubMed", "id": "25187949", "url": "https://pubmed.ncbi.nlm.nih.gov/25187949" }, { "database": "PubMed", "id": "25193862", "url": "https://pubmed.ncbi.nlm.nih.gov/25193862" }, { "database": "PubMed", "id": "25226367", "url": "https://pubmed.ncbi.nlm.nih.gov/25226367" }, { "database": "PubMed", "id": "25277206", "url": "https://pubmed.ncbi.nlm.nih.gov/25277206" }, { "database": "PubMed", "id": "25300309", "url": "https://pubmed.ncbi.nlm.nih.gov/25300309" }, { "database": "PubMed", "id": "25313365", "url": "https://pubmed.ncbi.nlm.nih.gov/25313365" }, { "database": "PubMed", "id": "25351103", "url": "https://pubmed.ncbi.nlm.nih.gov/25351103" }, { "database": "PubMed", "id": "25428919", "url": "https://pubmed.ncbi.nlm.nih.gov/25428919" }, { "database": "PubMed", "id": "25486573", "url": "https://pubmed.ncbi.nlm.nih.gov/25486573" }, { "database": "PubMed", "id": "25539072", "url": "https://pubmed.ncbi.nlm.nih.gov/25539072" }, { "database": "PubMed", "id": "25611393", "url": "https://pubmed.ncbi.nlm.nih.gov/25611393" }, { "database": "PubMed", "id": "25617898", "url": "https://pubmed.ncbi.nlm.nih.gov/25617898" }, { "database": "PubMed", "id": "25631868", "url": "https://pubmed.ncbi.nlm.nih.gov/25631868" }, { "database": "PubMed", "id": "25705585", "url": "https://pubmed.ncbi.nlm.nih.gov/25705585" }, { "database": "PubMed", "id": "25708150", "url": "https://pubmed.ncbi.nlm.nih.gov/25708150" }, { "database": "PubMed", "id": "25749031", "url": "https://pubmed.ncbi.nlm.nih.gov/25749031" }, { "database": "PubMed", "id": "25753414", "url": "https://pubmed.ncbi.nlm.nih.gov/25753414" }, { "database": "PubMed", "id": "25778692", "url": "https://pubmed.ncbi.nlm.nih.gov/25778692" }, { "database": "PubMed", "id": "25868388", "url": "https://pubmed.ncbi.nlm.nih.gov/25868388" }, { "database": "PubMed", "id": "25880415", "url": "https://pubmed.ncbi.nlm.nih.gov/25880415" }, { "database": "PubMed", "id": "25889845", "url": "https://pubmed.ncbi.nlm.nih.gov/25889845" }, { "database": "PubMed", "id": "25890707", "url": "https://pubmed.ncbi.nlm.nih.gov/25890707" }, { "database": "PubMed", "id": "25947155", "url": "https://pubmed.ncbi.nlm.nih.gov/25947155" }, { "database": "PubMed", "id": "25949790", "url": "https://pubmed.ncbi.nlm.nih.gov/25949790" }, { "database": "PubMed", "id": "25958313", "url": "https://pubmed.ncbi.nlm.nih.gov/25958313" }, { "database": "PubMed", "id": "25978354", "url": "https://pubmed.ncbi.nlm.nih.gov/25978354" }, { "database": "PubMed", "id": "25980494", "url": "https://pubmed.ncbi.nlm.nih.gov/25980494" }, { "database": "PubMed", "id": "26004127", "url": "https://pubmed.ncbi.nlm.nih.gov/26004127" }, { "database": "PubMed", "id": "26079101", "url": "https://pubmed.ncbi.nlm.nih.gov/26079101" }, { "database": "PubMed", "id": "26110647", "url": "https://pubmed.ncbi.nlm.nih.gov/26110647" }, { "database": "PubMed", "id": "26119934", "url": "https://pubmed.ncbi.nlm.nih.gov/26119934" }, { "database": "PubMed", "id": "26172215", "url": "https://pubmed.ncbi.nlm.nih.gov/26172215" }, { "database": "PubMed", "id": "26216901", "url": "https://pubmed.ncbi.nlm.nih.gov/26216901" }, { "database": "PubMed", "id": "26230358", "url": "https://pubmed.ncbi.nlm.nih.gov/26230358" }, { "database": "PubMed", "id": "26245992", "url": "https://pubmed.ncbi.nlm.nih.gov/26245992" }, { "database": "PubMed", "id": "26294392", "url": "https://pubmed.ncbi.nlm.nih.gov/26294392" }, { "database": "PubMed", "id": "26300973", "url": "https://pubmed.ncbi.nlm.nih.gov/26300973" }, { "database": "PubMed", "id": "26365310", "url": "https://pubmed.ncbi.nlm.nih.gov/26365310" }, { "database": "PubMed", "id": "26375443", "url": "https://pubmed.ncbi.nlm.nih.gov/26375443" }, { "database": "PubMed", "id": "26377974", "url": "https://pubmed.ncbi.nlm.nih.gov/26377974" }, { "database": "PubMed", "id": "26393679", "url": "https://pubmed.ncbi.nlm.nih.gov/26393679" }, { "database": "PubMed", "id": "26406376", "url": "https://pubmed.ncbi.nlm.nih.gov/26406376" }, { "database": "PubMed", "id": "26456697", "url": "https://pubmed.ncbi.nlm.nih.gov/26456697" }, { "database": "PubMed", "id": "26501082", "url": "https://pubmed.ncbi.nlm.nih.gov/26501082" }, { "database": "PubMed", "id": "26542021", "url": "https://pubmed.ncbi.nlm.nih.gov/26542021" }, { "database": "PubMed", "id": "26546726", "url": "https://pubmed.ncbi.nlm.nih.gov/26546726" }, { "database": "PubMed", "id": "26549523", "url": "https://pubmed.ncbi.nlm.nih.gov/26549523" }, { "database": "PubMed", "id": "26556867", "url": "https://pubmed.ncbi.nlm.nih.gov/26556867" }, { "database": "PubMed", "id": "26649283", "url": "https://pubmed.ncbi.nlm.nih.gov/26649283" }, { "database": "PubMed", "id": "26689988", "url": "https://pubmed.ncbi.nlm.nih.gov/26689988" }, { "database": "PubMed", "id": "26700725", "url": "https://pubmed.ncbi.nlm.nih.gov/26700725" }, { "database": "PubMed", "id": "26703626", "url": "https://pubmed.ncbi.nlm.nih.gov/26703626" }, { "database": "PubMed", "id": "26751774", "url": "https://pubmed.ncbi.nlm.nih.gov/26751774" }, { "database": "PubMed", "id": "26752742", "url": "https://pubmed.ncbi.nlm.nih.gov/26752742" }, { "database": "PubMed", "id": "26788094", "url": "https://pubmed.ncbi.nlm.nih.gov/26788094" }, { "database": "PubMed", "id": "26821125", "url": "https://pubmed.ncbi.nlm.nih.gov/26821125" }, { "database": "PubMed", "id": "26833789", "url": "https://pubmed.ncbi.nlm.nih.gov/26833789" }, { "database": "PubMed", "id": "26842895", "url": "https://pubmed.ncbi.nlm.nih.gov/26842895" }, { "database": "PubMed", "id": "26848618", "url": "https://pubmed.ncbi.nlm.nih.gov/26848618" }, { "database": "PubMed", "id": "26866924", "url": "https://pubmed.ncbi.nlm.nih.gov/26866924" }, { "database": "PubMed", "id": "26893679", "url": "https://pubmed.ncbi.nlm.nih.gov/26893679" }, { "database": "PubMed", "id": "26931461", "url": "https://pubmed.ncbi.nlm.nih.gov/26931461" }, { "database": "PubMed", "id": "26961176", "url": "https://pubmed.ncbi.nlm.nih.gov/26961176" }, { "database": "PubMed", "id": "26975850", "url": "https://pubmed.ncbi.nlm.nih.gov/26975850" }, { "database": "PubMed", "id": "26984508", "url": "https://pubmed.ncbi.nlm.nih.gov/26984508" }, { "database": "PubMed", "id": "26984511", "url": "https://pubmed.ncbi.nlm.nih.gov/26984511" }, { "database": "PubMed", "id": "26988603", "url": "https://pubmed.ncbi.nlm.nih.gov/26988603" }, { "database": "PubMed", "id": "26993780", "url": "https://pubmed.ncbi.nlm.nih.gov/26993780" }, { "database": "PubMed", "id": "27041993", "url": "https://pubmed.ncbi.nlm.nih.gov/27041993" }, { "database": "PubMed", "id": "27145276", "url": "https://pubmed.ncbi.nlm.nih.gov/27145276" }, { "database": "PubMed", "id": "27191259", "url": "https://pubmed.ncbi.nlm.nih.gov/27191259" }, { "database": "PubMed", "id": "27220365", "url": "https://pubmed.ncbi.nlm.nih.gov/27220365" }, { "database": "PubMed", "id": "27237320", "url": "https://pubmed.ncbi.nlm.nih.gov/27237320" }, { "database": "PubMed", "id": "27246739", "url": "https://pubmed.ncbi.nlm.nih.gov/27246739" }, { "database": "PubMed", "id": "27248472", "url": "https://pubmed.ncbi.nlm.nih.gov/27248472" }, { "database": "PubMed", "id": "27278471", "url": "https://pubmed.ncbi.nlm.nih.gov/27278471" }, { "database": "PubMed", "id": "27286256", "url": "https://pubmed.ncbi.nlm.nih.gov/27286256" }, { "database": "PubMed", "id": "27344177", "url": "https://pubmed.ncbi.nlm.nih.gov/27344177" }, { "database": "PubMed", "id": "27363027", "url": "https://pubmed.ncbi.nlm.nih.gov/27363027" }, { "database": "PubMed", "id": "27402964", "url": "https://pubmed.ncbi.nlm.nih.gov/27402964" }, { "database": "PubMed", "id": "27428469", "url": "https://pubmed.ncbi.nlm.nih.gov/27428469" }, { "database": "PubMed", "id": "27460083", "url": "https://pubmed.ncbi.nlm.nih.gov/27460083" }, { "database": "PubMed", "id": "27462783", "url": "https://pubmed.ncbi.nlm.nih.gov/27462783" }, { "database": "PubMed", "id": "27467982", "url": "https://pubmed.ncbi.nlm.nih.gov/27467982" }, { "database": "PubMed", "id": "27487141", "url": "https://pubmed.ncbi.nlm.nih.gov/27487141" }, { "database": "PubMed", "id": "27542844", "url": "https://pubmed.ncbi.nlm.nih.gov/27542844" }, { "database": "PubMed", "id": "27567948", "url": "https://pubmed.ncbi.nlm.nih.gov/27567948" }, { "database": "PubMed", "id": "27602495", "url": "https://pubmed.ncbi.nlm.nih.gov/27602495" }, { "database": "PubMed", "id": "27611942", "url": "https://pubmed.ncbi.nlm.nih.gov/27611942" }, { "database": "PubMed", "id": "27638858", "url": "https://pubmed.ncbi.nlm.nih.gov/27638858" }, { "database": "PubMed", "id": "27715394", "url": "https://pubmed.ncbi.nlm.nih.gov/27715394" }, { "database": "PubMed", "id": "27845385", "url": "https://pubmed.ncbi.nlm.nih.gov/27845385" }, { "database": "PubMed", "id": "28053698", "url": "https://pubmed.ncbi.nlm.nih.gov/28053698" }, { "database": "PubMed", "id": "28068967", "url": "https://pubmed.ncbi.nlm.nih.gov/28068967" }, { "database": "PubMed", "id": "28076322", "url": "https://pubmed.ncbi.nlm.nih.gov/28076322" }, { "database": "PubMed", "id": "28124908", "url": "https://pubmed.ncbi.nlm.nih.gov/28124908" }, { "database": "PubMed", "id": "28134933", "url": "https://pubmed.ncbi.nlm.nih.gov/28134933" }, { "database": "PubMed", "id": "28188308", "url": "https://pubmed.ncbi.nlm.nih.gov/28188308" }, { "database": "PubMed", "id": "28222177", "url": "https://pubmed.ncbi.nlm.nih.gov/28222177" }, { "database": "PubMed", "id": "28225063", "url": "https://pubmed.ncbi.nlm.nih.gov/28225063" }, { "database": "PubMed", "id": "28257035", "url": "https://pubmed.ncbi.nlm.nih.gov/28257035" }, { "database": "PubMed", "id": "28338656", "url": "https://pubmed.ncbi.nlm.nih.gov/28338656" }, { "database": "PubMed", "id": "28361970", "url": "https://pubmed.ncbi.nlm.nih.gov/28361970" }, { "database": "PubMed", "id": "28398603", "url": "https://pubmed.ncbi.nlm.nih.gov/28398603" }, { "database": "PubMed", "id": "28406574", "url": "https://pubmed.ncbi.nlm.nih.gov/28406574" }, { "database": "PubMed", "id": "28415713", "url": "https://pubmed.ncbi.nlm.nih.gov/28415713" }, { "database": "PubMed", "id": "28418903", "url": "https://pubmed.ncbi.nlm.nih.gov/28418903" }, { "database": "PubMed", "id": "28423580", "url": "https://pubmed.ncbi.nlm.nih.gov/28423580" }, { "database": "PubMed", "id": "28427224", "url": "https://pubmed.ncbi.nlm.nih.gov/28427224" }, { "database": "PubMed", "id": "28445805", "url": "https://pubmed.ncbi.nlm.nih.gov/28445805" }, { "database": "PubMed", "id": "28450296", "url": "https://pubmed.ncbi.nlm.nih.gov/28450296" }, { "database": "PubMed", "id": "28459432", "url": "https://pubmed.ncbi.nlm.nih.gov/28459432" }, { "database": "PubMed", "id": "28507287", "url": "https://pubmed.ncbi.nlm.nih.gov/28507287" }, { "database": "PubMed", "id": "28542214", "url": "https://pubmed.ncbi.nlm.nih.gov/28542214" }, { "database": "PubMed", "id": "28624785", "url": "https://pubmed.ncbi.nlm.nih.gov/28624785" }, { "database": "PubMed", "id": "28642549", "url": "https://pubmed.ncbi.nlm.nih.gov/28642549" }, { "database": "PubMed", "id": "28667800", "url": "https://pubmed.ncbi.nlm.nih.gov/28667800" }, { "database": "PubMed", "id": "28715434", "url": "https://pubmed.ncbi.nlm.nih.gov/28715434" }, { "database": "PubMed", "id": "28741790", "url": "https://pubmed.ncbi.nlm.nih.gov/28741790" }, { "database": "PubMed", "id": "29021002", "url": "https://pubmed.ncbi.nlm.nih.gov/29021002" }, { "database": "PubMed", "id": "29036202", "url": "https://pubmed.ncbi.nlm.nih.gov/29036202" }, { "database": "PubMed", "id": "29039492", "url": "https://pubmed.ncbi.nlm.nih.gov/29039492" }, { "database": "PubMed", "id": "29046395", "url": "https://pubmed.ncbi.nlm.nih.gov/29046395" }, { "database": "PubMed", "id": "29050315", "url": "https://pubmed.ncbi.nlm.nih.gov/29050315" }, { "database": "PubMed", "id": "29066806", "url": "https://pubmed.ncbi.nlm.nih.gov/29066806" }, { "database": "PubMed", "id": "29088849", "url": "https://pubmed.ncbi.nlm.nih.gov/29088849" }, { "database": "PubMed", "id": "29151962", "url": "https://pubmed.ncbi.nlm.nih.gov/29151962" }, { "database": "PubMed", "id": "29158989", "url": "https://pubmed.ncbi.nlm.nih.gov/29158989" }, { "database": "PubMed", "id": "29186907", "url": "https://pubmed.ncbi.nlm.nih.gov/29186907" }, { "database": "PubMed", "id": "29190494", "url": "https://pubmed.ncbi.nlm.nih.gov/29190494" }, { "database": "PubMed", "id": "29228673", "url": "https://pubmed.ncbi.nlm.nih.gov/29228673" }, { "database": "PubMed", "id": "29263678", "url": "https://pubmed.ncbi.nlm.nih.gov/29263678" }, { "database": "PubMed", "id": "29276408", "url": "https://pubmed.ncbi.nlm.nih.gov/29276408" }, { "database": "PubMed", "id": "29311227", "url": "https://pubmed.ncbi.nlm.nih.gov/29311227" }, { "database": "PubMed", "id": "29382358", "url": "https://pubmed.ncbi.nlm.nih.gov/29382358" }, { "database": "PubMed", "id": "29422613", "url": "https://pubmed.ncbi.nlm.nih.gov/29422613" }, { "database": "PubMed", "id": "29434841", "url": "https://pubmed.ncbi.nlm.nih.gov/29434841" }, { "database": "PubMed", "id": "29439667", "url": "https://pubmed.ncbi.nlm.nih.gov/29439667" }, { "database": "PubMed", "id": "29484384", "url": "https://pubmed.ncbi.nlm.nih.gov/29484384" }, { "database": "PubMed", "id": "29491429", "url": "https://pubmed.ncbi.nlm.nih.gov/29491429" }, { "database": "PubMed", "id": "29535802", "url": "https://pubmed.ncbi.nlm.nih.gov/29535802" }, { "database": "PubMed", "id": "29563383", "url": "https://pubmed.ncbi.nlm.nih.gov/29563383" }, { "database": "PubMed", "id": "29593542", "url": "https://pubmed.ncbi.nlm.nih.gov/29593542" }, { "database": "PubMed", "id": "29700289", "url": "https://pubmed.ncbi.nlm.nih.gov/29700289" }, { "database": "PubMed", "id": "29728077", "url": "https://pubmed.ncbi.nlm.nih.gov/29728077" }, { "database": "PubMed", "id": "29740072", "url": "https://pubmed.ncbi.nlm.nih.gov/29740072" }, { "database": "PubMed", "id": "29752441", "url": "https://pubmed.ncbi.nlm.nih.gov/29752441" }, { "database": "PubMed", "id": "29791208", "url": "https://pubmed.ncbi.nlm.nih.gov/29791208" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "29903032", "url": "https://pubmed.ncbi.nlm.nih.gov/29903032" }, { "database": "PubMed", "id": "29915029", "url": "https://pubmed.ncbi.nlm.nih.gov/29915029" }, { "database": "PubMed", "id": "29928374", "url": "https://pubmed.ncbi.nlm.nih.gov/29928374" }, { "database": "PubMed", "id": "29986550", "url": "https://pubmed.ncbi.nlm.nih.gov/29986550" }, { "database": "PubMed", "id": "29993014", "url": "https://pubmed.ncbi.nlm.nih.gov/29993014" }, { "database": "PubMed", "id": "30013514", "url": "https://pubmed.ncbi.nlm.nih.gov/30013514" }, { "database": "PubMed", "id": "30033448", "url": "https://pubmed.ncbi.nlm.nih.gov/30033448" }, { "database": "PubMed", "id": "30055645", "url": "https://pubmed.ncbi.nlm.nih.gov/30055645" }, { "database": "PubMed", "id": "30065198", "url": "https://pubmed.ncbi.nlm.nih.gov/30065198" }, { "database": "PubMed", "id": "30087707", "url": "https://pubmed.ncbi.nlm.nih.gov/30087707" }, { "database": "PubMed", "id": "30166526", "url": "https://pubmed.ncbi.nlm.nih.gov/30166526" }, { "database": "PubMed", "id": "30332774", "url": "https://pubmed.ncbi.nlm.nih.gov/30332774" }, { "database": "PubMed", "id": "30337877", "url": "https://pubmed.ncbi.nlm.nih.gov/30337877" }, { "database": "PubMed", "id": "30347788", "url": "https://pubmed.ncbi.nlm.nih.gov/30347788" }, { "database": "PubMed", "id": "30387148", "url": "https://pubmed.ncbi.nlm.nih.gov/30387148" }, { "database": "PubMed", "id": "30458784", "url": "https://pubmed.ncbi.nlm.nih.gov/30458784" }, { "database": "PubMed", "id": "30464516", "url": "https://pubmed.ncbi.nlm.nih.gov/30464516" }, { "database": "PubMed", "id": "30488595", "url": "https://pubmed.ncbi.nlm.nih.gov/30488595" }, { "database": "PubMed", "id": "30498362", "url": "https://pubmed.ncbi.nlm.nih.gov/30498362" }, { "database": "PubMed", "id": "30531837", "url": "https://pubmed.ncbi.nlm.nih.gov/30531837" }, { "database": "PubMed", "id": "30539198", "url": "https://pubmed.ncbi.nlm.nih.gov/30539198" }, { "database": "PubMed", "id": "30555628", "url": "https://pubmed.ncbi.nlm.nih.gov/30555628" }, { "database": "PubMed", "id": "30563275", "url": "https://pubmed.ncbi.nlm.nih.gov/30563275" }, { "database": "PubMed", "id": "30571746", "url": "https://pubmed.ncbi.nlm.nih.gov/30571746" }, { "database": "PubMed", "id": "30696915", "url": "https://pubmed.ncbi.nlm.nih.gov/30696915" }, { "database": "PubMed", "id": "30717801", "url": "https://pubmed.ncbi.nlm.nih.gov/30717801" }, { "database": "PubMed", "id": "30728047", "url": "https://pubmed.ncbi.nlm.nih.gov/30728047" }, { "database": "PubMed", "id": "30742951", "url": "https://pubmed.ncbi.nlm.nih.gov/30742951" }, { "database": "PubMed", "id": "30744493", "url": "https://pubmed.ncbi.nlm.nih.gov/30744493" }, { "database": "PubMed", "id": "30761269", "url": "https://pubmed.ncbi.nlm.nih.gov/30761269" }, { "database": "PubMed", "id": "30779783", "url": "https://pubmed.ncbi.nlm.nih.gov/30779783" }, { "database": "PubMed", "id": "30816469", "url": "https://pubmed.ncbi.nlm.nih.gov/30816469" }, { "database": "PubMed", "id": "30836148", "url": "https://pubmed.ncbi.nlm.nih.gov/30836148" }, { "database": "PubMed", "id": "30894654", "url": "https://pubmed.ncbi.nlm.nih.gov/30894654" }, { "database": "PubMed", "id": "30920523", "url": "https://pubmed.ncbi.nlm.nih.gov/30920523" }, { "database": "PubMed", "id": "31006845", "url": "https://pubmed.ncbi.nlm.nih.gov/31006845" }, { "database": "PubMed", "id": "31060904", "url": "https://pubmed.ncbi.nlm.nih.gov/31060904" }, { "database": "PubMed", "id": "31160603", "url": "https://pubmed.ncbi.nlm.nih.gov/31160603" }, { "database": "PubMed", "id": "31170089", "url": "https://pubmed.ncbi.nlm.nih.gov/31170089" }, { "database": "PubMed", "id": "31186741", "url": "https://pubmed.ncbi.nlm.nih.gov/31186741" }, { "database": "PubMed", "id": "31297342", "url": "https://pubmed.ncbi.nlm.nih.gov/31297342" }, { "database": "PubMed", "id": "31383893", "url": "https://pubmed.ncbi.nlm.nih.gov/31383893" }, { "database": "PubMed", "id": "31420553", "url": "https://pubmed.ncbi.nlm.nih.gov/31420553" }, { "database": "PubMed", "id": "31428520", "url": "https://pubmed.ncbi.nlm.nih.gov/31428520" }, { "database": "PubMed", "id": "31478830", "url": "https://pubmed.ncbi.nlm.nih.gov/31478830" }, { "database": "PubMed", "id": "31480645", "url": "https://pubmed.ncbi.nlm.nih.gov/31480645" }, { "database": "PubMed", "id": "31501460", "url": "https://pubmed.ncbi.nlm.nih.gov/31501460" }, { "database": "PubMed", "id": "31516757", "url": "https://pubmed.ncbi.nlm.nih.gov/31516757" }, { "database": "PubMed", "id": "31519958", "url": "https://pubmed.ncbi.nlm.nih.gov/31519958" }, { "database": "PubMed", "id": "31554180", "url": "https://pubmed.ncbi.nlm.nih.gov/31554180" }, { "database": "PubMed", "id": "31565187", "url": "https://pubmed.ncbi.nlm.nih.gov/31565187" }, { "database": "PubMed", "id": "31627430", "url": "https://pubmed.ncbi.nlm.nih.gov/31627430" }, { "database": "PubMed", "id": "31648990", "url": "https://pubmed.ncbi.nlm.nih.gov/31648990" }, { "database": "PubMed", "id": "31652779", "url": "https://pubmed.ncbi.nlm.nih.gov/31652779" }, { "database": "PubMed", "id": "31654241", "url": "https://pubmed.ncbi.nlm.nih.gov/31654241" }, { "database": "PubMed", "id": "31671408", "url": "https://pubmed.ncbi.nlm.nih.gov/31671408" }, { "database": "PubMed", "id": "31671889", "url": "https://pubmed.ncbi.nlm.nih.gov/31671889" }, { "database": "PubMed", "id": "31831830", "url": "https://pubmed.ncbi.nlm.nih.gov/31831830" }, { "database": "PubMed", "id": "31867162", "url": "https://pubmed.ncbi.nlm.nih.gov/31867162" }, { "database": "PubMed", "id": "31870092", "url": "https://pubmed.ncbi.nlm.nih.gov/31870092" }, { "database": "PubMed", "id": "31926619", "url": "https://pubmed.ncbi.nlm.nih.gov/31926619" }, { "database": "PubMed", "id": "32155953", "url": "https://pubmed.ncbi.nlm.nih.gov/32155953" }, { "database": "PubMed", "id": "32256987", "url": "https://pubmed.ncbi.nlm.nih.gov/32256987" }, { "database": "PubMed", "id": "32274611", "url": "https://pubmed.ncbi.nlm.nih.gov/32274611" }, { "database": "PubMed", "id": "32286266", "url": "https://pubmed.ncbi.nlm.nih.gov/32286266" }, { "database": "PubMed", "id": "32337793", "url": "https://pubmed.ncbi.nlm.nih.gov/32337793" }, { "database": "PubMed", "id": "32415208", "url": "https://pubmed.ncbi.nlm.nih.gov/32415208" }, { "database": "PubMed", "id": "32604782", "url": "https://pubmed.ncbi.nlm.nih.gov/32604782" }, { "database": "PubMed", "id": "32733919", "url": "https://pubmed.ncbi.nlm.nih.gov/32733919" }, { "database": "PubMed", "id": "32784087", "url": "https://pubmed.ncbi.nlm.nih.gov/32784087" }, { "database": "PubMed", "id": "32806748", "url": "https://pubmed.ncbi.nlm.nih.gov/32806748" }, { "database": "PubMed", "id": "32843133", "url": "https://pubmed.ncbi.nlm.nih.gov/32843133" }, { "database": "PubMed", "id": "32844749", "url": "https://pubmed.ncbi.nlm.nih.gov/32844749" }, { "database": "PubMed", "id": "32848136", "url": "https://pubmed.ncbi.nlm.nih.gov/32848136" }, { "database": "PubMed", "id": "32850845", "url": "https://pubmed.ncbi.nlm.nih.gov/32850845" }, { "database": "PubMed", "id": "32872257", "url": "https://pubmed.ncbi.nlm.nih.gov/32872257" }, { "database": "PubMed", "id": "33025708", "url": "https://pubmed.ncbi.nlm.nih.gov/33025708" }, { "database": "PubMed", "id": "33036231", "url": "https://pubmed.ncbi.nlm.nih.gov/33036231" }, { "database": "PubMed", "id": "33076263", "url": "https://pubmed.ncbi.nlm.nih.gov/33076263" }, { "database": "PubMed", "id": "33184263", "url": "https://pubmed.ncbi.nlm.nih.gov/33184263" }, { "database": "PubMed", "id": "33287873", "url": "https://pubmed.ncbi.nlm.nih.gov/33287873" }, { "database": "PubMed", "id": "33413438", "url": "https://pubmed.ncbi.nlm.nih.gov/33413438" }, { "database": "PubMed", "id": "33420364", "url": "https://pubmed.ncbi.nlm.nih.gov/33420364" }, { "database": "PubMed", "id": "33532186", "url": "https://pubmed.ncbi.nlm.nih.gov/33532186" }, { "database": "PubMed", "id": "33614634", "url": "https://pubmed.ncbi.nlm.nih.gov/33614634" }, { "database": "PubMed", "id": "33634070", "url": "https://pubmed.ncbi.nlm.nih.gov/33634070" }, { "database": "PubMed", "id": "33668531", "url": "https://pubmed.ncbi.nlm.nih.gov/33668531" }, { "database": "PubMed", "id": "33715263", "url": "https://pubmed.ncbi.nlm.nih.gov/33715263" }, { "database": "PubMed", "id": "33724150", "url": "https://pubmed.ncbi.nlm.nih.gov/33724150" }, { "database": "PubMed", "id": "33750427", "url": "https://pubmed.ncbi.nlm.nih.gov/33750427" }, { "database": "PubMed", "id": "33799345", "url": "https://pubmed.ncbi.nlm.nih.gov/33799345" }, { "database": "PubMed", "id": "33846818", "url": "https://pubmed.ncbi.nlm.nih.gov/33846818" }, { "database": "PubMed", "id": "33898431", "url": "https://pubmed.ncbi.nlm.nih.gov/33898431" }, { "database": "PubMed", "id": "33920284", "url": "https://pubmed.ncbi.nlm.nih.gov/33920284" }, { "database": "PubMed", "id": "33981002", "url": "https://pubmed.ncbi.nlm.nih.gov/33981002" }, { "database": "PubMed", "id": "35201437", "url": "https://pubmed.ncbi.nlm.nih.gov/35201437" }, { "database": "PubMed", "id": "35257717", "url": "https://pubmed.ncbi.nlm.nih.gov/35257717" }, { "database": "PubMed", "id": "35426066", "url": "https://pubmed.ncbi.nlm.nih.gov/35426066" }, { "database": "PubMed", "id": "35962191", "url": "https://pubmed.ncbi.nlm.nih.gov/35962191" }, { "database": "PubMed", "id": "35982848", "url": "https://pubmed.ncbi.nlm.nih.gov/35982848" }, { "database": "PubMed", "id": "36009384", "url": "https://pubmed.ncbi.nlm.nih.gov/36009384" }, { "database": "PubMed", "id": "7553664", "url": "https://pubmed.ncbi.nlm.nih.gov/7553664" }, { "database": "PubMed", "id": "7739563", "url": "https://pubmed.ncbi.nlm.nih.gov/7739563" }, { "database": "PubMed", "id": "8051157", "url": "https://pubmed.ncbi.nlm.nih.gov/8051157" }, { "database": "PubMed", "id": "8824286", "url": "https://pubmed.ncbi.nlm.nih.gov/8824286" }, { "database": "PubMed", "id": "8941336", "url": "https://pubmed.ncbi.nlm.nih.gov/8941336" }, { "database": "PubMed", "id": "9148935", "url": "https://pubmed.ncbi.nlm.nih.gov/9148935" }, { "database": "PubMed", "id": "9416004", "url": "https://pubmed.ncbi.nlm.nih.gov/9416004" }, { "database": "PubMed", "id": "9922457", "url": "https://pubmed.ncbi.nlm.nih.gov/9922457" }, { "database": "PubMed", "id": "15561106", "url": "https://pubmed.ncbi.nlm.nih.gov/15561106" }, { "database": "PubMed", "id": "19339212", "url": "https://pubmed.ncbi.nlm.nih.gov/19339212" }, { "database": "PubMed", "id": "19369195", "url": "https://pubmed.ncbi.nlm.nih.gov/19369195" } ], "site_lbl": "Tyr397", "uniprot_canonical_ac": "Q05397-1" } ], "record_id": "pubmed.29796177", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and functional characterization of novel mutations including frameshift mutation in exon 4 of CSF1R in patients with adult-onset leukoencephalopathy with axonal spheroids and pigmented glia.", "journal": "Journal of neurology", "date": "2018", "authors": "Miura T, Mezaki N, Konno T, Iwasaki A, Hara N, Miura M, Funayama M, Unai Y, Tashiro Y, Okita K, Kihara T, Ito N, Kanatsuka Y, Jones DT, Hara N, Ishiguro T, Tokutake T, Kasuga K, Nozaki H, Dickson DW, Onodera O, Wszolek ZK, Ikeuchi T", "reference": { "type": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 546, "end_pos": 546, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" }, { "database": "PubMed", "id": "31827782", "url": "https://pubmed.ncbi.nlm.nih.gov/31827782" } ], "site_lbl": "Tyr546", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 708, "end_pos": 708, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" } ], "site_lbl": "Tyr708", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 723, "end_pos": 723, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "9191055", "url": "https://pubmed.ncbi.nlm.nih.gov/9191055" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "21266043", "url": "https://pubmed.ncbi.nlm.nih.gov/21266043" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" } ], "site_lbl": "Tyr723", "uniprot_canonical_ac": "P07333-1" } ], "record_id": "pubmed.30136118", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homozygous Mutations in CSF1R Cause a Pediatric-Onset Leukoencephalopathy and Can Result in Congenital Absence of Microglia.", "journal": "American journal of human genetics", "date": "2019", "authors": "Oosterhof N, Chang IJ, Karimiani EG, Kuil LE, Jensen DM, Daza R, Young E, Astle L, van der Linde HC, Shivaram GM, Demmers J, Latimer CS, Keene CD, Loter E, Maroofian R, van Ham TJ, Hevner RF, Bennett JT", "reference": { "type": "PubMed", "id": "30982608", "url": "https://pubmed.ncbi.nlm.nih.gov/30982608" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30982608", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bi-allelic CSF1R Mutations Cause Skeletal Dysplasia of Dysosteosclerosis-Pyle Disease Spectrum and Degenerative Encephalopathy with Brain Malformation.", "journal": "American journal of human genetics", "date": "2019", "authors": "Guo L, Bertola DR, Takanohashi A, Saito A, Segawa Y, Yokota T, Ishibashi S, Nishida Y, Yamamoto GL, Franco JFDS, Honjo RS, Kim CA, Musso CM, Timmons M, Pizzino A, Taft RJ, Lajoie B, Knight MA, Fischbeck KH, Singleton AB, Ferreira CR, Wang Z, Yan L, Garbern JY, Simsek-Kiper PO, Ohashi H, Robey PG, Boyde A, Matsumoto N, Miyake N, Spranger J, Schiffmann R, Vanderver A, Nishimura G, Passos-Bueno MRDS, Simons C, Ishikawa K, Ikegawa S", "reference": { "type": "PubMed", "id": "30982609", "url": "https://pubmed.ncbi.nlm.nih.gov/30982609" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30982609", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clinicopathologic characterization and abnormal autophagy of CSF1R-related leukoencephalopathy.", "journal": "Translational neurodegeneration", "date": "2019", "authors": "Tian Wo-Tu, Zhan Fei-Xia, Liu Qing, Luan Xing-Hua, Zhang Chao, Shang Liang, Zhang Ben-Yan, Pan Si-Jian, Miao Fei, Hu Jiong, Zhong Ping, Liu Shi-Hua, Zhu Ze-Yu, Zhou Hai-Yan, Sun Suya, Liu Xiao-Li, Huang Xiao-Jun, Jiang Jing-Wen, Ma Jian-Fang, Wang Ying, Chen Shu-Fen, Tang Hui-Dong, Chen Sheng-Di, Cao Li", "reference": { "type": "PubMed", "id": "31827782", "url": "https://pubmed.ncbi.nlm.nih.gov/31827782" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 546, "end_pos": 546, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" }, { "database": "PubMed", "id": "31827782", "url": "https://pubmed.ncbi.nlm.nih.gov/31827782" } ], "site_lbl": "Tyr546", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 699, "end_pos": 699, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "21049007", "url": "https://pubmed.ncbi.nlm.nih.gov/21049007" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "31827782", "url": "https://pubmed.ncbi.nlm.nih.gov/31827782" }, { "database": "PubMed", "id": "20489731", "url": "https://pubmed.ncbi.nlm.nih.gov/20489731" } ], "site_lbl": "Tyr699", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 809, "end_pos": 809, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "7681396", "url": "https://pubmed.ncbi.nlm.nih.gov/7681396" }, { "database": "PubMed", "id": "2168557", "url": "https://pubmed.ncbi.nlm.nih.gov/2168557" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "31827782", "url": "https://pubmed.ncbi.nlm.nih.gov/31827782" } ], "site_lbl": "Tyr809", "uniprot_canonical_ac": "P07333-1" } ], "record_id": "pubmed.31827782", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The amino-terminal domain of the v-fms oncogene product includes a functional signal peptide that directs synthesis of a transforming glycoprotein in the absence of feline leukemia virus gag sequences.", "journal": "J. Virol.", "date": "1986", "authors": "Wheeler E F, Roussel M F, Hampe A, Walker M H, Fried V A, Look A T, Rettenmier C W, Sherr C J", "reference": { "type": "PubMed", "id": "3525854", "url": "https://pubmed.ncbi.nlm.nih.gov/3525854" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3525854", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "'Replacement' of COOH-terminal truncation of v-fms with c-fms sequences markedly reduces transformation potential.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Browning P J, Bunn H F, Cline A, Shuman M, Nienhuis A W", "reference": { "type": "PubMed", "id": "3532121", "url": "https://pubmed.ncbi.nlm.nih.gov/3532121" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3532121", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An adapted protocol to derive microglia from stem cells and its application in the study of CSF1R-related disorders.", "journal": "Molecular neurodegeneration", "date": "2024-04-05", "authors": "Dorion Marie-France, Casas Diana, Shlaifer Irina, Yaqubi Moein, Fleming Peter, Karpilovsky Nathan, Chen Carol X-Q, Nicouleau Michael, Piscopo Valerio E C, MacDougall Emma J, Alluli Aeshah, Goldsmith Taylor M, Schneider Alexandria, Dorion Samuel, Aprahamian Nathalia, MacDonald Adam, Thomas Rhalena A, Dudley Roy W R, Hall Jeffrey A, Fon Edward A, Antel Jack P, Stratton Jo Anne, Durcan Thomas M, La Piana Roberta, Healy Luke M", "reference": { "type": "PubMed", "id": "38576039", "url": "https://pubmed.ncbi.nlm.nih.gov/38576039" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38576039", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Unifying considerations and evidence of macrophage activation mosaicism through human CSF1R and M1/M2 genes.", "journal": "Cell reports", "date": "2024-06-25", "authors": "Orsenigo Federica, Stewart Alexander, Hammer Clare P, Clarke Emma, Simpkin Daniel, Attia Hossameldin, Rockall Timothy, Gordon Siamon, Martinez Fernando O", "reference": { "type": "PubMed", "id": "38870011", "url": "https://pubmed.ncbi.nlm.nih.gov/38870011" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38870011", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel variants in CSF1R associated with adult-onset leukoencephalopathy with axonal spheroids and pigmented glia (ALSP).", "journal": "Journal of neurology", "date": "2024-09", "authors": "Schmitz Anne S, Raju Janani, K\u00f6hler Wolfgang, Klebe Stephan, Cheheb Khaled, Reschke Franziska, Biskup Saskia, Haack Tobias B, Roeben Benjamin, Kellner Melanie, Rahner Nils, Bloch Thomas, Lemke Johannes, Bender Benjamin, Sch\u00f6ls Ludger, Hengel Holger, Hayer Stefanie N", "reference": { "type": "PubMed", "id": "39031193", "url": "https://pubmed.ncbi.nlm.nih.gov/39031193" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39031193", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heterozygous missense CSF1R variants hamper in vitro CD34+-derived dendritic cell generation but not in vivo dendritic cell development.", "journal": "Molecular immunology", "date": "2024-10", "authors": "Beerepoot Shanice, Wolf Nicole I, van der Knaap Marjo S, Nierkens Stefan, Plantinga Maud", "reference": { "type": "PubMed", "id": "39182279", "url": "https://pubmed.ncbi.nlm.nih.gov/39182279" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39182279", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of the human c-fms proto-oncogene in hematopoietic cells and its deletion in the 5q- syndrome.", "journal": "Cell", "date": "1985", "authors": "Nienhuis A W, Bunn H F, Turner P H, Gopal T V, Nash W G, O'Brien S J, Sherr C J", "reference": { "type": "PubMed", "id": "4028159", "url": "https://pubmed.ncbi.nlm.nih.gov/4028159" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.4028159", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of human colony-stimulating factor-1 (CSF-1) receptor in murine pluripotent hematopoietic NFS-60 cells induces long-term proliferation in response to CSF-1 without loss of erythroid differentiation potential.", "journal": "Blood", "date": "1993-05-15", "authors": "Bourette R P, Mouchiroud G, Ouazana R, Morl\u00e9 F, Godet J, Blanchet J P", "reference": { "type": "PubMed", "id": "7683918", "url": "https://pubmed.ncbi.nlm.nih.gov/7683918" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7683918", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence requirements for binding of Src family tyrosine kinases to activated growth factor receptors.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Alonso G, Koegl M, Mazurenko N, Courtneidge SA", "reference": { "type": "PubMed", "id": "7730365", "url": "https://pubmed.ncbi.nlm.nih.gov/7730365" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05622-1", "protein_name": "Platelet-derived growth factor receptor beta", "gene_name": "Pdgfrb", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 561, "end_pos": 561, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "7730365", "url": "https://pubmed.ncbi.nlm.nih.gov/7730365" }, { "database": "PubMed", "id": "21049007", "url": "https://pubmed.ncbi.nlm.nih.gov/21049007" } ], "site_lbl": "Tyr561", "uniprot_canonical_ac": "P07333-1" }, { "start_pos": 578, "end_pos": 578, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P05622", "url": "https://www.uniprot.org/uniprotkb/P05622" }, { "database": "IntAct", "id": "P05622", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05622*" }, { "database": "iPTMnet", "id": "P05622", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05622" }, { "database": "PubMed", "id": "7730365", "url": "https://pubmed.ncbi.nlm.nih.gov/7730365" } ], "site_lbl": "Tyr578", "uniprot_canonical_ac": "P05622-1" }, { "start_pos": 739, "end_pos": 739, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P05622", "url": "https://www.uniprot.org/uniprotkb/P05622" }, { "database": "IntAct", "id": "P05622", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05622*" }, { "database": "iPTMnet", "id": "P05622", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05622" }, { "database": "PubMed", "id": "10644978", "url": "https://pubmed.ncbi.nlm.nih.gov/10644978" }, { "database": "PubMed", "id": "7730365", "url": "https://pubmed.ncbi.nlm.nih.gov/7730365" }, { "database": "PubMed", "id": "19742316", "url": "https://pubmed.ncbi.nlm.nih.gov/19742316" } ], "site_lbl": "Tyr739", "uniprot_canonical_ac": "P05622-1" }, { "start_pos": 750, "end_pos": 750, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P05622", "url": "https://www.uniprot.org/uniprotkb/P05622" }, { "database": "IntAct", "id": "P05622", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05622*" }, { "database": "iPTMnet", "id": "P05622", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05622" }, { "database": "PubMed", "id": "18515860", "url": "https://pubmed.ncbi.nlm.nih.gov/18515860" }, { "database": "PubMed", "id": "7730365", "url": "https://pubmed.ncbi.nlm.nih.gov/7730365" }, { "database": "PubMed", "id": "19742316", "url": "https://pubmed.ncbi.nlm.nih.gov/19742316" } ], "site_lbl": "Tyr750", "uniprot_canonical_ac": "P05622-1" } ], "record_id": "pubmed.7730365", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptional regulation of the c-fms (CSF-1R) proto-oncogene in human breast carcinoma cells by glucocorticoids.", "journal": "Oncogene", "date": "1995", "authors": "Sapi E, Flick M B, Gilmore-Hebert M, Rodov S, Kacinski B M", "reference": { "type": "PubMed", "id": "7845678", "url": "https://pubmed.ncbi.nlm.nih.gov/7845678" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7845678", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence analysis of two genomic regions containing the KIT and the FMS receptor tyrosine kinase genes.", "journal": "Genomics", "date": "1997", "authors": "Andre C, Hampe A, Lachaume P, Martin E, Wang X P, Manus V, Hu W X, Galibert F", "reference": { "type": "PubMed", "id": "9027509", "url": "https://pubmed.ncbi.nlm.nih.gov/9027509" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12766-1", "protein_name": "HMG domain-containing protein 3", "gene_name": "HMGXB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10721-1", "protein_name": "Mast/stem cell growth factor receptor Kit", "gene_name": "KIT", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9027509", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recognition of activated CSF-1 receptor in breast carcinomas by a tyrosine 723 phosphospecific antibody.", "journal": "Oncogene", "date": "1997", "authors": "Flick MB, Sapi E, Perrotta PL, Maher MG, Halaban R, Carter D, Kacinski BM", "reference": { "type": "PubMed", "id": "9191055", "url": "https://pubmed.ncbi.nlm.nih.gov/9191055" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07333-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "CSF1R", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 723, "end_pos": 723, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P07333", "url": "https://www.uniprot.org/uniprotkb/P07333" }, { "database": "iPTMnet", "id": "P07333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333" }, { "database": "PubMed", "id": "9191055", "url": "https://pubmed.ncbi.nlm.nih.gov/9191055" }, { "database": "IntAct", "id": "P07333", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "21266043", "url": "https://pubmed.ncbi.nlm.nih.gov/21266043" }, { "database": "PubMed", "id": "22974529", "url": "https://pubmed.ncbi.nlm.nih.gov/22974529" }, { "database": "PubMed", "id": "23924795", "url": "https://pubmed.ncbi.nlm.nih.gov/23924795" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24336230", "url": "https://pubmed.ncbi.nlm.nih.gov/24336230" }, { "database": "PubMed", "id": "29796177", "url": "https://pubmed.ncbi.nlm.nih.gov/29796177" }, { "database": "PubMed", "id": "30136118", "url": "https://pubmed.ncbi.nlm.nih.gov/30136118" } ], "site_lbl": "Tyr723", "uniprot_canonical_ac": "P07333-1" } ], "record_id": "pubmed.9191055", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three-dimensional structure of dimeric human recombinant macrophage colony-stimulating factor.", "journal": "Science", "date": "1992", "authors": "Pandit J, Bohm A, Jancarik J, Halenbeck R, Koths K, Kim SH", "reference": { "type": "PubMed", "id": "1455231", "url": "https://pubmed.ncbi.nlm.nih.gov/1455231" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1455231", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a high molecular weight macrophage colony-stimulating factor as a glycosaminoglycan-containing species.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Suzu S, Ohtsuki T, Yanai N, Takatsu Z, Kawashima T, Takaku F, Nagata N, Motoyoshi K", "reference": { "type": "PubMed", "id": "1531650", "url": "https://pubmed.ncbi.nlm.nih.gov/1531650" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1531650", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of colony-stimulating factor-1 (CSF-1) messenger RNA in human endometrial glands during the menstrual cycle: molecular cloning of a novel transcript that predicts a cell surface form of CSF-1.", "journal": "Mol. Endocrinol.", "date": "1991", "authors": "Pampfer S, Tabibzadeh S, Chuan F C, Pollard J W", "reference": { "type": "PubMed", "id": "1791839", "url": "https://pubmed.ncbi.nlm.nih.gov/1791839" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1791839", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "VEGF, M-CSF and CA 15-3 as a new tumor marker panel in breast malignancies: a multivariate analysis with ROC curve.", "journal": "Growth factors (Chur, Switzerland)", "date": "2013", "authors": "Lawicki S, Bedkowska GE, Szmitkowski M", "reference": { "type": "PubMed", "id": "23688065", "url": "https://pubmed.ncbi.nlm.nih.gov/23688065" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "biomarkers": [ { "best_biomarker_role": [ "diagnostic" ], "biomarker_canonical_id": "AN6402", "assessed_biomarker_entity": [ "Macrophage colony-stimulating factor 1" ], "biomarker_id": "AN6402-1", "biomarker": [ "increased CSF1 level" ], "condition": { "id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland." }, "name_list": [ "breast cancer", "breast tumor", "malignant neoplasm of breast", "malignant tumor of the breast", "mammary cancer", "mammary tumor", "primary breast cancer", "hereditary breast carcinoma", "breast cancer susceptibility, autosomal dominant, somatic mutation", "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "breast cancer, lobular, somatic", "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "breast cancer, protection against, autosomal dominant, somatic mutation", "breast cancer, somatic", "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "familial breast cancer", "familial breast carcinoma", "familial cancer of breast", "familial cancer of the breast", "hereditary breast cancer", "Breast cancer" ], "id_list": [ "DOID:1612", "MONDO:0016419", "MIM:114480" ] } } ], "record_id": "pubmed.23688065", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human macrophage-colony stimulating factor: alternative RNA and protein processing from a single gene.", "journal": "Molecular immunology", "date": "1988", "authors": "Cerretti DP, Wignall J, Anderson D, Tushinski RJ, Gallis BM, Stya M, Gillis S, Urdal DL, Cosman D", "reference": { "type": "PubMed", "id": "2460758", "url": "https://pubmed.ncbi.nlm.nih.gov/2460758" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 489, "end_pos": 554, "sequence_org": "FSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV", "sequence_mut": "", "comment": "Produces biologically active protein which is secreted.", "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" }, { "database": "PubMed", "id": "2460758", "url": "https://pubmed.ncbi.nlm.nih.gov/2460758" } ], "uniprot_canonical_ac": "P09603-1" } ], "record_id": "pubmed.2460758", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Amino-terminal region of human macrophage colony-stimulating factor (M-CSF) is sufficient for its in vitro biological activity: molecular cloning and expression of carboxyl-terminal deletion mutants of human M-CSF.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1989", "authors": "Takahashi M, Hirato T, Takano M, Nishida T, Nagamura K, Kamogashira T, Nakai S, Hirai Y", "reference": { "type": "PubMed", "id": "2660794", "url": "https://pubmed.ncbi.nlm.nih.gov/2660794" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2660794", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of a complementary DNA encoding human macrophage-specific colony-stimulating factor (CSF-1).", "journal": "Science", "date": "1985", "authors": "Kawasaki E S, Ladner M B, Wang A M, Van Arsdell J, Warren M K, Coyne M Y, Schweickart V L, Lee M T, Wilson K J, Boosman A", "reference": { "type": "PubMed", "id": "2996129", "url": "https://pubmed.ncbi.nlm.nih.gov/2996129" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2996129", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Synthesis of membrane-bound colony-stimulating factor 1 (CSF-1) and downmodulation of CSF-1 receptors in NIH 3T3 cells transformed by cotransfection of the human CSF-1 and c-fms (CSF-1 receptor) genes.", "journal": "Mol. Cell. Biol.", "date": "1987", "authors": "Rettenmier C W, Roussel M F, Ashmun R A, Ralph P, Price K, Sherr C J", "reference": { "type": "PubMed", "id": "3039346", "url": "https://pubmed.ncbi.nlm.nih.gov/3039346" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3039346", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Macrophage colony-stimulating factor is produced by human T lymphoblastoid cell line, CEM-ON: identification by amino-terminal amino acid sequence analysis.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1988", "authors": "Takahashi M, Hong Y M, Yasuda S, Takano M, Kawai K, Nakai S, Hirai Y", "reference": { "type": "PubMed", "id": "3259875", "url": "https://pubmed.ncbi.nlm.nih.gov/3259875" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3259875", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential processing of colony-stimulating factor 1 precursors encoded by two human cDNAs.", "journal": "Molecular and cellular biology", "date": "1988", "authors": "Rettenmier CW, Roussel MF", "reference": { "type": "PubMed", "id": "3264877", "url": "https://pubmed.ncbi.nlm.nih.gov/3264877" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3264877", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human CSF-1: molecular cloning and expression of 4-kb cDNA encoding the human urinary protein.", "journal": "Science", "date": "1987", "authors": "Wong G G, Temple P A, Leary A C, Witek-Giannotti J S, Yang Y C, Ciarletta A B, Chung M, Murtha P, Kriz R, Kaufman R J", "reference": { "type": "PubMed", "id": "3493529", "url": "https://pubmed.ncbi.nlm.nih.gov/3493529" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3493529", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Macrophage colony-stimulating factor purified from normal human urine. Amino-terminal sequence and amino acid composition.", "journal": "FEBS Lett.", "date": "1987", "authors": "Sakai N, Umeda T, Suzuki H, Ishimatsu Y, Shikita M", "reference": { "type": "PubMed", "id": "3498652", "url": "https://pubmed.ncbi.nlm.nih.gov/3498652" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3498652", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human CSF-1: gene structure and alternative splicing of mRNA precursors.", "journal": "EMBO J.", "date": "1987", "authors": "Ladner MB, Martin GA, Noble JA, Nikoloff DM, Tal R, Kawasaki ES, White TJ", "reference": { "type": "PubMed", "id": "3500041", "url": "https://pubmed.ncbi.nlm.nih.gov/3500041" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3500041", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adenine is an anti-inflammatory metabolite found to be more abundant in M-CSF over GM-CSF-differentiated human macrophages.", "journal": "Immunology letters", "date": "2024-02", "authors": "Harber Karl J, Nguyen Thuc-Anh, Schomakers Bauke V, Heister Daan A F, de Vries Helga E, van Weeghel Michel, Van den Bossche Jan, de Winther Menno P J", "reference": { "type": "PubMed", "id": "38142781", "url": "https://pubmed.ncbi.nlm.nih.gov/38142781" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04141-1", "protein_name": "Granulocyte-macrophage colony-stimulating factor", "gene_name": "CSF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38142781", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "M-CSF secreted by gastric cancer cells exacerbates the progression of gastric cancer by increasing the expression of SHP2 in tumor-associated macrophages.", "journal": "Aging", "date": "2023-12-29", "authors": "Zhang Shaohua, Ren Dongfei, Hou Huiyu, Yao Li, Yuan Hufang", "reference": { "type": "PubMed", "id": "38159254", "url": "https://pubmed.ncbi.nlm.nih.gov/38159254" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38159254", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CSF1 is expressed by the intestinal epithelial cells to regulate M\u03c6 macrophages and maintain epithelial homeostasis and is downregulated in neonates with necrotizing enterocolitis.", "journal": "BMC pediatrics", "date": "2024-09-28", "authors": "Sun Xu, Xu Lingqi, Ma Shurong, Du Jun, Gu Huajian, Wang Jian", "reference": { "type": "PubMed", "id": "39342173", "url": "https://pubmed.ncbi.nlm.nih.gov/39342173" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39342173", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural analysis of proteoglycan macrophage colony-stimulating factor.", "journal": "The Journal of biological chemistry", "date": "1994-08-05", "authors": "Kimura F, Suzu S, Nakamura Y, Wakimoto N, Kanatani Y, Yanai N, Nagata N, Motoyoshi K", "reference": { "type": "PubMed", "id": "8051056", "url": "https://pubmed.ncbi.nlm.nih.gov/8051056" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "icn3d_view": {}, "start_pos": 309, "start_aa": "Ser", "end_pos": 309, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser309", "evidence": [ { "id": "P09603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P09603#ptm_processing" }, { "id": "8051056", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8051056" } ], "filter_code": "000000000000000100000.00000000001000.00.01101", "uniprot_canonical_ac": "P09603-1" } ], "mutagenesis": [ { "start_pos": 252, "end_pos": 252, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of 43 kDa subunit.", "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" }, { "database": "PubMed", "id": "8051056", "url": "https://pubmed.ncbi.nlm.nih.gov/8051056" } ], "uniprot_canonical_ac": "P09603-1" }, { "start_pos": 309, "end_pos": 309, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of chondroitin sulfate attachment.", "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" }, { "database": "PubMed", "id": "8051056", "url": "https://pubmed.ncbi.nlm.nih.gov/8051056" } ], "uniprot_canonical_ac": "P09603-1" }, { "start_pos": 444, "end_pos": 444, "sequence_org": "R", "sequence_mut": "A", "comment": "Does not affect production of 150-200 kDa subunit.", "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" }, { "database": "PubMed", "id": "8051056", "url": "https://pubmed.ncbi.nlm.nih.gov/8051056" } ], "uniprot_canonical_ac": "P09603-1" } ], "record_id": "pubmed.8051056", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structure of recombinant human carboxy-terminal-truncated macrophage colony-stimulating factor derived from mammalian cells.", "journal": "J. Biochem.", "date": "1993", "authors": "Yamanishi K, Yasuda S, Masui Y, Nishida T, Shindo Y, Takano M, Ohmoto Y, Takahashi M, Adachi M", "reference": { "type": "PubMed", "id": "8262907", "url": "https://pubmed.ncbi.nlm.nih.gov/8262907" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8262907", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Assignment of the inter- and intramolecular disulfide linkages in recombinant human macrophage colony stimulating factor using fast atom bombardment mass spectrometry.", "journal": "Biochemistry", "date": "1993", "authors": "Glocker MO, Arbogast B, Schreurs J, Deinzer ML", "reference": { "type": "PubMed", "id": "8422357", "url": "https://pubmed.ncbi.nlm.nih.gov/8422357" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09603-1", "protein_name": "Macrophage colony-stimulating factor 1", "gene_name": "CSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09603", "url": "https://www.uniprot.org/uniprotkb/P09603" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8422357", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Breast cancer risk associated with polymorphism in CYP19 in Japanese women.", "journal": "International journal of cancer", "date": "2000", "authors": "Miyoshi Y, Iwao K, Ikeda N, Egawa C, Noguchi S", "reference": { "type": "PubMed", "id": "10956405", "url": "https://pubmed.ncbi.nlm.nih.gov/10956405" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11511-1", "protein_name": "Aromatase", "gene_name": "CYP19A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprotkb/P11511" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10956405", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Aromatase and breast cancer: W39R, an inactive protein.", "journal": "European journal of endocrinology", "date": "2002", "authors": "Nativelle-Serpentini C, Lambard S, Seralini GE, Sourdaine P", "reference": { "type": "PubMed", "id": "11916629", "url": "https://pubmed.ncbi.nlm.nih.gov/11916629" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11511-1", "protein_name": "Aromatase", "gene_name": "CYP19A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprotkb/P11511" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11916629", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biochemical and molecular genetic analyses on placental aromatase (P-450AROM) deficiency.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Harada N, Ogawa H, Shozu M, Yamada K, Suhara K, Nishida E, Takagi Y", "reference": { "type": "PubMed", "id": "1371509", "url": "https://pubmed.ncbi.nlm.nih.gov/1371509" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11511-1", "protein_name": "Aromatase", "gene_name": "CYP19A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprotkb/P11511" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1371509", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dysmetabolic syndrome in a man with a novel mutation of the aromatase gene: effects of testosterone, alendronate, and estradiol treatment.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Maffei L, Murata Y, Rochira V, Tubert G, Aranda C, Vazquez M, Clyne CD, Davis S, Simpson ER, Carani C", "reference": { "type": "PubMed", "id": "14715828", "url": "https://pubmed.ncbi.nlm.nih.gov/14715828" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11511-1", "protein_name": "Aromatase", "gene_name": "CYP19A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprotkb/P11511" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14715828", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Effect of R264C polymorphism in CYP19A1 gene on BRCA1/2-negative hereditary breast cancer from Shanghai population of China].", "journal": "Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics", "date": "2006", "authors": "Song CG, Hu Z, Yuan WT, Di GH, Shen ZZ, Huang W, Shao ZM", "reference": { "type": "PubMed", "id": "16604491", "url": "https://pubmed.ncbi.nlm.nih.gov/16604491" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11511-1", "protein_name": "Aromatase", "gene_name": "CYP19A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprotkb/P11511" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16604491", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]