[ { "title": "Differential induction of 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase genes in Arabidopsis thaliana by wounding and pathogenic attack.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1991", "authors": "Keith B, Dong X N, Ausubel F M, Fink G R", "reference": { "type": "PubMed", "id": "1681544", "url": "https://pubmed.ncbi.nlm.nih.gov/1681544" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P29976-1", "protein_name": "Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic", "gene_name": "DHS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q00218-1", "protein_name": "Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic", "gene_name": "DHS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P29976", "url": "https://www.uniprot.org/uniprotkb/P29976" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.1681544", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of cell cycle regulatory genes and morphological alterations in response to salt stress in Arabidopsis thaliana.", "journal": "Planta", "date": "2000", "authors": "Burssens S, Himanen K, van de Cotte B, Beeckman T, Van Montagu M, Inz\u00e9 D, Verbruggen N", "reference": { "type": "PubMed", "id": "11089675", "url": "https://pubmed.ncbi.nlm.nih.gov/11089675" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30183-1", "protein_name": "Cyclin-B1-1", "gene_name": "CYCB1-1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39071-1", "protein_name": "Cyclin-A2-1", "gene_name": "CYCA2-1; CYCA2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P24100-1", "protein_name": "Cyclin-dependent kinase A-1", "gene_name": "CDKA-1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P30183", "url": "https://www.uniprot.org/uniprotkb/P30183" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11089675", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genes regulating the plant cell cycle: isolation of a mitotic-like cyclin from Arabidopsis thaliana.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1992", "authors": "Hemerly A, Bergounioux C, Van Montagu M, Inz\u00e9 D, Ferreira P", "reference": { "type": "PubMed", "id": "1373494", "url": "https://pubmed.ncbi.nlm.nih.gov/1373494" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30183-1", "protein_name": "Cyclin-B1-1", "gene_name": "CYCB1-1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P30183", "url": "https://www.uniprot.org/uniprotkb/P30183" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.1373494", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Developmental expression of the arabidopsis cyclin gene cyc1At.", "journal": "Plant Cell", "date": "1994", "authors": "Ferreira P C, Hemerly A S, Engler J D, van Montagu M, Engler G, Inz\u00e9 D", "reference": { "type": "PubMed", "id": "7866022", "url": "https://pubmed.ncbi.nlm.nih.gov/7866022" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30183-1", "protein_name": "Cyclin-B1-1", "gene_name": "CYCB1-1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P30183", "url": "https://www.uniprot.org/uniprotkb/P30183" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7866022", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Induction of cdc2a and cyc1At expression in Arabidopsis thaliana during early phases of nematode-induced feeding cell formation.", "journal": "Plant J.", "date": "1996", "authors": "Niebel A, de Almeida Engler J, Hemerly A, Ferreira P, Inz\u00e9 D, Van Montagu M, Gheysen G", "reference": { "type": "PubMed", "id": "9011085", "url": "https://pubmed.ncbi.nlm.nih.gov/9011085" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30183-1", "protein_name": "Cyclin-B1-1", "gene_name": "CYCB1-1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P24100-1", "protein_name": "Cyclin-dependent kinase A-1", "gene_name": "CDKA-1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P30183", "url": "https://www.uniprot.org/uniprotkb/P30183" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9011085", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide identification of touch- and darkness-regulated Arabidopsis genes: a focus on calmodulin-like and XTH genes.", "journal": "New Phytol.", "date": "2005", "authors": "Lee Dennis, Polisensky Diana H, Braam Janet", "reference": { "type": "PubMed", "id": "15720654", "url": "https://pubmed.ncbi.nlm.nih.gov/15720654" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30187-1", "protein_name": "Calmodulin-like protein 10", "gene_name": "CML10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LX26-1", "protein_name": "Probable calcium-binding protein CML1", "gene_name": "CML1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LE22-1", "protein_name": "Probable calcium-binding protein CML27", "gene_name": "CML27", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LI84-1", "protein_name": "Probable calcium-binding protein CML16", "gene_name": "CML16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SGI8-1", "protein_name": "Probable calcium-binding protein CML40", "gene_name": "CML40", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FIH9-1", "protein_name": "Calcium-binding protein CML37", "gene_name": "CML37", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SRE6-1", "protein_name": "Calcium-binding protein CML38", "gene_name": "CML38", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVG9-1", "protein_name": "Calcium-binding protein CML42", "gene_name": "CML42", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W4L0-1", "protein_name": "Probable calcium-binding protein CML49", "gene_name": "CML49", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9S744-1", "protein_name": "Calmodulin-like protein 9", "gene_name": "CML9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22845-1", "protein_name": "Calmodulin-like protein 5", "gene_name": "CML5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P30188-1", "protein_name": "Probable calcium-binding protein CML35", "gene_name": "CML35", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P25071-1", "protein_name": "Calmodulin-like protein 12", "gene_name": "CML12; TCH3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P25070-1", "protein_name": "Calcium-binding protein CML24", "gene_name": "CML24", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P30187", "url": "https://www.uniprot.org/uniprotkb/P30187" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15720654", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation of an Arabidopsis cDNA sequence encoding a 22 kDa calcium-binding protein (CaBP-22) related to calmodulin.", "journal": "Plant Mol. Biol.", "date": "1993", "authors": "Ling V, Zielinski R E", "reference": { "type": "PubMed", "id": "8507824", "url": "https://pubmed.ncbi.nlm.nih.gov/8507824" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30187-1", "protein_name": "Calmodulin-like protein 10", "gene_name": "CML10", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P30187", "url": "https://www.uniprot.org/uniprotkb/P30187" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8507824", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and expression of kin2, one of two cold- and ABA-induced genes of Arabidopsis thaliana.", "journal": "Plant Mol. Biol.", "date": "1992", "authors": "Kurkela S, Borg-Franck M", "reference": { "type": "PubMed", "id": "1627780", "url": "https://pubmed.ncbi.nlm.nih.gov/1627780" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31169-1", "protein_name": "Stress-induced protein KIN2", "gene_name": "KIN2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P31169", "url": "https://www.uniprot.org/uniprotkb/P31169" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.1627780", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA sequence analysis and expression of two cold-regulated genes of Arabidopsis thaliana.", "journal": "Plant Mol. Biol.", "date": "1992", "authors": "Gilmour S J, Artus N N, Thomashow M F", "reference": { "type": "PubMed", "id": "1731964", "url": "https://pubmed.ncbi.nlm.nih.gov/1731964" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31169-1", "protein_name": "Stress-induced protein KIN2", "gene_name": "KIN2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P31168-1", "protein_name": "Dehydrin COR47", "gene_name": "COR47", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P31169", "url": "https://www.uniprot.org/uniprotkb/P31169" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.1731964", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A DEK domain-containing protein modulates chromatin structure and function in Arabidopsis.", "journal": "Plant Cell", "date": "2014", "authors": "Waidmann Sascha, Kusenda Branislav, Mayerhofer Juliane, Mechtler Karl, Jonak Claudia", "reference": { "type": "PubMed", "id": "25387881", "url": "https://pubmed.ncbi.nlm.nih.gov/25387881" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31169-1", "protein_name": "Stress-induced protein KIN2", "gene_name": "KIN2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42795-1", "protein_name": "Large ribosomal subunit protein uL5z", "gene_name": "RPL11A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SYP3-1", "protein_name": "Putative F-box/kelch-repeat protein At1g20940", "gene_name": "F9H16.7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SYA9-1", "protein_name": "Probable transcription factor At1g61730", "gene_name": "T13M11.9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SB42-1", "protein_name": "GLABROUS1 enhancer-binding protein-like", "gene_name": "GEBPL", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SF36-1", "protein_name": "PWWP domain-containing protein 2", "gene_name": "PDP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XI93-1", "protein_name": "Nodulin-related protein 2", "gene_name": "F16A14.14; F7A19.2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4K4Y5-1", "protein_name": "DEK domain-containing chromatin-associated protein 4", "gene_name": "DEK4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FEN9-1", "protein_name": "Chromatin remodeling protein SHL", "gene_name": "SHL", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65719-1", "protein_name": "Heat shock 70 kDa protein 3", "gene_name": "HSP70-3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P30181-1", "protein_name": "DNA topoisomerase 1 alpha", "gene_name": "TOP1ALPHA; TOP1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O82265-1", "protein_name": "Sister-chromatid cohesion protein 3", "gene_name": "SCC3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P32961-1", "protein_name": "Nitrilase 1", "gene_name": "NIT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SUA1-1", "protein_name": "DEK domain-containing chromatin-associated protein 3", "gene_name": "DEK3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FNE4-1", "protein_name": "PWWP domain-containing protein 3", "gene_name": "PDP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FVE6-1", "protein_name": "Histone deacetylase HDT1", "gene_name": "HDA3; HDT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38900-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase CYP19-1", "gene_name": "CYP19-1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "B6EUB3-1", "protein_name": "Sister chromatid cohesion protein PDS5 homolog A", "gene_name": "PDS5A", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P31169", "url": "https://www.uniprot.org/uniprotkb/P31169" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.25387881", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of an Arabidopsis thaliana gene (TMKL1) encoding a putative transmembrane protein with an unusual kinase-like domain.", "journal": "Plant Mol. Biol.", "date": "1993", "authors": "Valon C, Smalle J, Goodman H M, Giraudat J", "reference": { "type": "PubMed", "id": "8219075", "url": "https://pubmed.ncbi.nlm.nih.gov/8219075" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P33543-1", "protein_name": "Putative kinase-like protein TMKL1", "gene_name": "TMKL1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P33543", "url": "https://www.uniprot.org/uniprotkb/P33543" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8219075", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and mechanism of imidazoleglycerol-phosphate dehydratase.", "journal": "Structure", "date": "2005", "authors": "Glynn Steven E, Baker Patrick J, Sedelnikova Svetlana E, Davies Claire L, Eadsforth Thomas C, Levy Colin W, Rodgers H Fiona, Blackburn G Michael, Hawkes Timothy R, Viner Russell, Rice David W", "reference": { "type": "PubMed", "id": "16338409", "url": "https://pubmed.ncbi.nlm.nih.gov/16338409" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34047-1", "protein_name": "Imidazoleglycerol-phosphate dehydratase 1, chloroplastic", "gene_name": "HISN5A", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P34047", "url": "https://www.uniprot.org/uniprotkb/P34047" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16338409", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of cDNAs encoding imidazoleglycerolphosphate dehydratase from Arabidopsis thaliana.", "journal": "Plant Physiol.", "date": "1994", "authors": "Tada S, Volrath S, Guyer D, Scheidegger A, Ryals J, Ohta D, Ward E", "reference": { "type": "PubMed", "id": "8066131", "url": "https://pubmed.ncbi.nlm.nih.gov/8066131" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34047-1", "protein_name": "Imidazoleglycerol-phosphate dehydratase 1, chloroplastic", "gene_name": "HISN5A", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P34047", "url": "https://www.uniprot.org/uniprotkb/P34047" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8066131", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An S18 ribosomal protein gene copy at the Arabidopsis PFL locus affects plant development by its specific expression in meristems.", "journal": "EMBO J.", "date": "1994", "authors": "Van Lijsebettens M, Vanderhaeghen R, De Block M, Bauw G, Villarroel R, Van Montagu M", "reference": { "type": "PubMed", "id": "7913892", "url": "https://pubmed.ncbi.nlm.nih.gov/7913892" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34788-1", "protein_name": "Small ribosomal subunit protein uS13z/uS13y/uS13x", "gene_name": "RPS18A; RPS18B; RPS18C", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P34788", "url": "https://www.uniprot.org/uniprotkb/P34788" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7913892", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence analysis of a 24-kb contiguous genomic region at the Arabidopsis thaliana PFL locus on chromosome 1.", "journal": "FEBS Lett.", "date": "1997", "authors": "Terryn N, Neyt P, De Clercq R, De Keyser A, Van Den Daele H, Ardiles W, D\u00e9hais P, Rouz\u00e9 P, Gielen J, Villarroel R, Van Montagu M", "reference": { "type": "PubMed", "id": "9369203", "url": "https://pubmed.ncbi.nlm.nih.gov/9369203" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34788-1", "protein_name": "Small ribosomal subunit protein uS13z/uS13y/uS13x", "gene_name": "RPS18A; RPS18B; RPS18C", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04157-1", "protein_name": "Ras-related protein RABG3b", "gene_name": "RABG3B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SQI2-1", "protein_name": "Protein GIGANTEA", "gene_name": "GI", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64380-1", "protein_name": "Polyadenylate-binding protein 3", "gene_name": "PAB3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80548-1", "protein_name": "MA3 DOMAIN-CONTAINING TRANSLATION REGULATORY FACTOR 2", "gene_name": "MRF2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P34788", "url": "https://www.uniprot.org/uniprotkb/P34788" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9369203", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Developmental defects in mutants of the PsbP domain protein 5 in Arabidopsis thaliana.", "journal": "PloS one", "date": "2011", "authors": "Roose Johnna L, Frankel Laurie K, Bricker Terry M", "reference": { "type": "PubMed", "id": "22174848", "url": "https://pubmed.ncbi.nlm.nih.gov/22174848" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P82715-1", "protein_name": "PsbP domain-containing protein 5, chloroplastic", "gene_name": "PPD5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P82715", "url": "https://www.uniprot.org/uniprotkb/P82715" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22174848", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NAPP and PIRP encode subunits of a putative wave regulatory protein complex involved in plant cell morphogenesis.", "journal": "The Plant cell", "date": "2004-09", "authors": "Brembu Tore, Winge Per, Seem Martin, Bones Atle M", "reference": { "type": "PubMed", "id": "15316111", "url": "https://pubmed.ncbi.nlm.nih.gov/15316111" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5XPJ6-1", "protein_name": "Protein SCAR4", "gene_name": "SCAR4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LP46-1", "protein_name": "Protein SCAR3", "gene_name": "SCAR3; WAVE2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6AWX6-1", "protein_name": "Protein SCAR1", "gene_name": "SCAR1; WAVE1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5S2C3-1", "protein_name": "Protein PIR", "gene_name": "PIR121; PIR", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5S2C4-1", "protein_name": "Protein NAP1", "gene_name": "NAP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XPJ9-1", "protein_name": "Protein SCAR2", "gene_name": "SCAR2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94JY4-1", "protein_name": "Protein BRICK 1", "gene_name": "BRK1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q5XPJ6", "url": "https://www.uniprot.org/uniprotkb/Q5XPJ6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15316111", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of Arp2/3 complex-dependent actin polymerization by plant proteins distantly related to Scar/WAVE.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Frank Mary, Egile Coumaran, Dyachok Julia, Djakovic Stevan, Nolasco Michelle, Li Rong, Smith Laurie G", "reference": { "type": "PubMed", "id": "15534215", "url": "https://pubmed.ncbi.nlm.nih.gov/15534215" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5XPJ6-1", "protein_name": "Protein SCAR4", "gene_name": "SCAR4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XPK0-1", "protein_name": "Scar-like domain-containing protein WAVE 5", "gene_name": "WAVE5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LP46-1", "protein_name": "Protein SCAR3", "gene_name": "SCAR3; WAVE2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6AWX6-1", "protein_name": "Protein SCAR1", "gene_name": "SCAR1; WAVE1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XPJ9-1", "protein_name": "Protein SCAR2", "gene_name": "SCAR2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94JY4-1", "protein_name": "Protein BRICK 1", "gene_name": "BRK1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q5XPJ6", "url": "https://www.uniprot.org/uniprotkb/Q5XPJ6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15534215", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of Arabidopsis SCAR genes in ARP2-ARP3-dependent cell morphogenesis.", "journal": "Development", "date": "2007", "authors": "Uhrig Joachim F, Mutondo Moola, Zimmermann Ilona, Deeks Michael J, Machesky Laura M, Thomas Philipp, Uhrig Silke, Rambke Claudia, Hussey Patrick J, H\u00fclskamp Martin", "reference": { "type": "PubMed", "id": "17267444", "url": "https://pubmed.ncbi.nlm.nih.gov/17267444" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5XPJ6-1", "protein_name": "Protein SCAR4", "gene_name": "SCAR4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XGU0-1", "protein_name": "Rac-like GTP-binding protein ARAC9", "gene_name": "ARAC9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XPK0-1", "protein_name": "Scar-like domain-containing protein WAVE 5", "gene_name": "WAVE5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49597-1", "protein_name": "Protein phosphatase 2C 56", "gene_name": "ABI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LP46-1", "protein_name": "Protein SCAR3", "gene_name": "SCAR3; WAVE2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LSD6-1", "protein_name": "Actin-related protein 2", "gene_name": "ARP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q01593-1", "protein_name": "B3 domain-containing transcription factor ABI3", "gene_name": "ABI3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38919-1", "protein_name": "Rac-like GTP-binding protein ARAC4", "gene_name": "ARAC4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6AWX6-1", "protein_name": "Protein SCAR1", "gene_name": "SCAR1; WAVE1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XPJ9-1", "protein_name": "Protein SCAR2", "gene_name": "SCAR2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8SAB7-1", "protein_name": "Guanine nucleotide exchange factor SPIKE 1", "gene_name": "SPK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A0MES8-1", "protein_name": "Ethylene-responsive transcription factor ABI4", "gene_name": "ABI4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04719-1", "protein_name": "Protein phosphatase 2C 77", "gene_name": "ABI2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SBJ6-1", "protein_name": "Rac-like GTP-binding protein ARAC6", "gene_name": "ARAC6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SAF1-1", "protein_name": "Actin-related protein 3", "gene_name": "ARP3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q5XPJ6", "url": "https://www.uniprot.org/uniprotkb/Q5XPJ6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17267444", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "G\u03b31+G\u03b32+G\u03b33=G\u03b2: the search for heterotrimeric G-protein \u03b3 subunits in Arabidopsis is over.", "journal": "Journal of plant physiology", "date": "2012-03-15", "authors": "Thung Leena, Trusov Yuri, Chakravorty David, Botella Jos\u00e9 Ram\u00f3n", "reference": { "type": "PubMed", "id": "22209167", "url": "https://pubmed.ncbi.nlm.nih.gov/22209167" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6AWT8-1", "protein_name": "Guanine nucleotide-binding protein subunit gamma 3", "gene_name": "AGG3; GG3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93V47-1", "protein_name": "Guanine nucleotide-binding protein subunit gamma 2", "gene_name": "GG2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FDX9-1", "protein_name": "Guanine nucleotide-binding protein subunit gamma 1", "gene_name": "GG1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q6AWT8", "url": "https://www.uniprot.org/uniprotkb/Q6AWT8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22209167", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparative study of rice and Arabidopsis actin-depolymerizing factors gene families.", "journal": "J. Plant Physiol.", "date": "2006", "authors": "Feng Ying, Liu Qingpo, Xue Qingzhong", "reference": { "type": "PubMed", "id": "16360805", "url": "https://pubmed.ncbi.nlm.nih.gov/16360805" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q67ZM4-1", "protein_name": "Actin-depolymerizing factor 7", "gene_name": "ADF7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39251-1", "protein_name": "Actin-depolymerizing factor 2", "gene_name": "ADF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LQ81-1", "protein_name": "Actin-depolymerizing factor 10", "gene_name": "ADF10; ADF11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LZT3-1", "protein_name": "Putative actin-depolymerizing factor 11", "gene_name": "ADF11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O49606-1", "protein_name": "Actin-depolymerizing factor 9", "gene_name": "ADF9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZNT3-1", "protein_name": "Actin-depolymerizing factor 5", "gene_name": "ADF5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZSK2-1", "protein_name": "Actin-depolymerizing factor 6", "gene_name": "ADF6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LFH6-1", "protein_name": "Actin-depolymerizing factor 12", "gene_name": "ADF12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q570Y6-1", "protein_name": "Actin-depolymerizing factor 8", "gene_name": "ADF8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZSK3-1", "protein_name": "Actin-depolymerizing factor 4", "gene_name": "ADF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39250-1", "protein_name": "Actin-depolymerizing factor 1", "gene_name": "ADF1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZSK4-1", "protein_name": "Actin-depolymerizing factor 3", "gene_name": "ADF3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q67ZM4", "url": "https://www.uniprot.org/uniprotkb/Q67ZM4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16360805", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spatial and temporal expression of actin depolymerizing factors ADF7 and ADF10 during male gametophyte development in Arabidopsis thaliana.", "journal": "Plant Cell Physiol.", "date": "2011", "authors": "Bou Daher Firas, van Oostende Chlo\u00eb, Geitmann Anja", "reference": { "type": "PubMed", "id": "21632657", "url": "https://pubmed.ncbi.nlm.nih.gov/21632657" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q67ZM4-1", "protein_name": "Actin-depolymerizing factor 7", "gene_name": "ADF7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LFH6-1", "protein_name": "Actin-depolymerizing factor 12", "gene_name": "ADF12", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q67ZM4", "url": "https://www.uniprot.org/uniprotkb/Q67ZM4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21632657", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis actin-depolymerizing factor7 severs actin filaments and regulates actin cable turnover to promote normal pollen tube growth.", "journal": "The Plant cell", "date": "2013-09", "authors": "Zheng Yiyan, Xie Yurong, Jiang Yuxiang, Qu Xiaolu, Huang Shanjin", "reference": { "type": "PubMed", "id": "24058157", "url": "https://pubmed.ncbi.nlm.nih.gov/24058157" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q67ZM4-1", "protein_name": "Actin-depolymerizing factor 7", "gene_name": "ADF7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q67ZM4", "url": "https://www.uniprot.org/uniprotkb/Q67ZM4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.24058157", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and disruption of an Arabidopsis zinc finger gene controlling seed germination.", "journal": "Genes Dev.", "date": "2000", "authors": "Papi M, Sabatini S, Bouchez D, Camilleri C, Costantino P, Vittorioso P", "reference": { "type": "PubMed", "id": "10640273", "url": "https://pubmed.ncbi.nlm.nih.gov/10640273" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q43385-1", "protein_name": "Dof zinc finger protein DOF3.7", "gene_name": "DAG1; DOF3.7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q43385", "url": "https://www.uniprot.org/uniprotkb/Q43385" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10640273", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inactivation of the phloem-specific Dof zinc finger gene DAG1 affects response to light and integrity of the testa of Arabidopsis seeds.", "journal": "Plant Physiol.", "date": "2002", "authors": "Papi Maura, Sabatini Sabrina, Altamura Maria Maddalena, Hennig Lars, Sch\u00e4fer Eberhard, Costantino Paolo, Vittorioso Paola", "reference": { "type": "PubMed", "id": "11842145", "url": "https://pubmed.ncbi.nlm.nih.gov/11842145" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q43385-1", "protein_name": "Dof zinc finger protein DOF3.7", "gene_name": "DAG1; DOF3.7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q43385", "url": "https://www.uniprot.org/uniprotkb/Q43385" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11842145", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A rolB regulatory factor belongs to a new class of single zinc finger plant proteins.", "journal": "Plant J.", "date": "1996", "authors": "De Paolis A, Sabatini S, De Pascalis L, Costantino P, Capone I", "reference": { "type": "PubMed", "id": "8771779", "url": "https://pubmed.ncbi.nlm.nih.gov/8771779" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q43385-1", "protein_name": "Dof zinc finger protein DOF3.7", "gene_name": "DAG1; DOF3.7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q43385", "url": "https://www.uniprot.org/uniprotkb/Q43385" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8771779", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An Arabidopsis neutral ceramidase mutant ncer1 accumulates hydroxyceramides and is sensitive to oxidative stress.", "journal": "Front. Plant Sci.", "date": "2015", "authors": "Li Jian, Bi Fang-Cheng, Yin Jian, Wu Jian-Xin, Rong Chan, Wu Jia-Li, Yao Nan", "reference": { "type": "PubMed", "id": "26150824", "url": "https://pubmed.ncbi.nlm.nih.gov/26150824" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q304B9-1", "protein_name": "Neutral ceramidase 2", "gene_name": "ATNCER2; NCER2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4KHQ8-1", "protein_name": "Neutral ceramidase 3", "gene_name": "NCER3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4HQM3-1", "protein_name": "Neutral ceramidase 1", "gene_name": "ATNCER1; NCER1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q304B9", "url": "https://www.uniprot.org/uniprotkb/Q304B9" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.26150824", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a single-copy Arabidopsis gene encoding a protein showing limited similarity to the N-terminus of the mammalian clathrin-assembly protein AP180.", "journal": "DNA Res.", "date": "1999", "authors": "Gupta R, Gray J C", "reference": { "type": "PubMed", "id": "10231030", "url": "https://pubmed.ncbi.nlm.nih.gov/10231030" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P94017-1", "protein_name": "Putative clathrin assembly protein At1g14910", "gene_name": "PICALM1B", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P94017", "url": "https://www.uniprot.org/uniprotkb/P94017" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10231030", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis endoplasmic reticulum retention receptor functions in yeast.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1993", "authors": "Lee H I, Gal S, Newman T C, Raikhel N V", "reference": { "type": "PubMed", "id": "8248265", "url": "https://pubmed.ncbi.nlm.nih.gov/8248265" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35402-1", "protein_name": "ER lumen protein-retaining receptor A", "gene_name": "ERD2A; ERD2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P35402", "url": "https://www.uniprot.org/uniprotkb/P35402" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8248265", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of the Arabidopsis thaliana invertase gene family.", "journal": "Planta", "date": "1998", "authors": "Tymowska-Lalanne Z, Kreis M", "reference": { "type": "PubMed", "id": "9951726", "url": "https://pubmed.ncbi.nlm.nih.gov/9951726" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PEF8-1", "protein_name": "Beta-fructofuranosidase, insoluble isoenzyme CWINV2", "gene_name": "CWINV2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q43866-1", "protein_name": "Beta-fructofuranosidase, insoluble isoenzyme CWINV1", "gene_name": "ATBFRUCT1; CWINV1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PEF8", "url": "https://www.uniprot.org/uniprotkb/Q1PEF8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9951726", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of AtNUC-L1 reveals a central role of nucleolin in nucleolus organization and silencing of AtNUC-L2 gene in Arabidopsis.", "journal": "Mol. Biol. Cell", "date": "2007", "authors": "Pontvianne Frederic, Mat\u00eda Isabel, Douet Julien, Tourmente Sylvette, Medina Francisco J, Echeverria Manuel, S\u00e1ez-V\u00e1squez Julio", "reference": { "type": "PubMed", "id": "17108323", "url": "https://pubmed.ncbi.nlm.nih.gov/17108323" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PEP5-1", "protein_name": "Nucleolin 2", "gene_name": "NUC-L2; NUCL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FVQ1-1", "protein_name": "Nucleolin 1", "gene_name": "NUCL1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PEP5", "url": "https://www.uniprot.org/uniprotkb/Q1PEP5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17108323", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sugar-inducible expression of the nucleolin-1 gene of Arabidopsis thaliana and its role in ribosome synthesis, growth and development.", "journal": "Plant J.", "date": "2007", "authors": "Kojima Hisae, Suzuki Takamasa, Kato Takenori, Enomoto Ken-ichi, Sato Shusei, Kato Tomohiko, Tabata Satoshi, S\u00e1ez-Vasquez Julio, Echeverr\u00eda Manuel, Nakagawa Tsuyoshi, Ishiguro Sumie, Nakamura Kenzo", "reference": { "type": "PubMed", "id": "17286797", "url": "https://pubmed.ncbi.nlm.nih.gov/17286797" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PEP5-1", "protein_name": "Nucleolin 2", "gene_name": "NUC-L2; NUCL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FVQ1-1", "protein_name": "Nucleolin 1", "gene_name": "NUCL1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PEP5", "url": "https://www.uniprot.org/uniprotkb/Q1PEP5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17286797", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dual role of a SAS10/C1D family protein in ribosomal RNA gene expression and processing is essential for reproduction in Arabidopsis thaliana.", "journal": "PLoS Genet.", "date": "2016", "authors": "Chen Ying-Jiun C, Wang Huei-Jing, Jauh Guang-Yuh", "reference": { "type": "PubMed", "id": "27792779", "url": "https://pubmed.ncbi.nlm.nih.gov/27792779" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PEP5-1", "protein_name": "Nucleolin 2", "gene_name": "NUC-L2; NUCL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GUI6-1", "protein_name": "Lysine-specific demethylase JMJ14", "gene_name": "JMJ14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H1E7-1", "protein_name": "Protein NUCLEOLAR FACTOR 1", "gene_name": "NOF1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L3P4-1", "protein_name": "Protein THALLO", "gene_name": "THAL", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FVQ1-1", "protein_name": "Nucleolin 1", "gene_name": "NUCL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FJY5-1", "protein_name": "M phase phosphoprotein 10", "gene_name": "MPP10", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PEP5", "url": "https://www.uniprot.org/uniprotkb/Q1PEP5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.27792779", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of the isopentenyl diphosphate isomerase gene family from Arabidopsis thaliana.", "journal": "Plant Mol. Biol.", "date": "1998", "authors": "Campbell M, Hahn F M, Poulter C D, Leustek T", "reference": { "type": "PubMed", "id": "9484444", "url": "https://pubmed.ncbi.nlm.nih.gov/9484444" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q42553-1", "protein_name": "Isopentenyl-diphosphate Delta-isomerase II, chloroplastic", "gene_name": "IPP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38929-1", "protein_name": "Isopentenyl-diphosphate Delta-isomerase I, chloroplastic", "gene_name": "IPP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q42553", "url": "https://www.uniprot.org/uniprotkb/Q42553" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9484444", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three Arabidopsis fatty acyl-coenzyme A reductases, FAR1, FAR4, and FAR5, generate primary fatty alcohols associated with suberin deposition.", "journal": "Plant physiology", "date": "2010-08", "authors": "Domergue Fr\u00e9d\u00e9ric, Vishwanath Sollapura J, Joub\u00e8s J\u00e9r\u00f4me, Ono Jasmine, Lee Jennifer A, Bourdon Matthieu, Alhattab Reem, Lowe Christine, Pascal St\u00e9phanie, Lessire Ren\u00e9, Rowland Owen", "reference": { "type": "PubMed", "id": "20571114", "url": "https://pubmed.ncbi.nlm.nih.gov/20571114" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WRB0-1", "protein_name": "Probable fatty acyl-CoA reductase 5", "gene_name": "FAR5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39152-1", "protein_name": "Fatty acyl-CoA reductase 1", "gene_name": "FAR1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LXN3-1", "protein_name": "Probable fatty acyl-CoA reductase 4", "gene_name": "FAR4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WRB0", "url": "https://www.uniprot.org/uniprotkb/Q0WRB0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20571114", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of an Arabidopsis fatty alcohol:caffeoyl-Coenzyme A acyltransferase required for the synthesis of alkyl hydroxycinnamates in root waxes.", "journal": "Plant physiology", "date": "2012-09", "authors": "Kosma Dylan K, Molina Isabel, Ohlrogge John B, Pollard Mike", "reference": { "type": "PubMed", "id": "22797656", "url": "https://pubmed.ncbi.nlm.nih.gov/22797656" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WRB0-1", "protein_name": "Probable fatty acyl-CoA reductase 5", "gene_name": "FAR5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39152-1", "protein_name": "Fatty acyl-CoA reductase 1", "gene_name": "FAR1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LXN3-1", "protein_name": "Probable fatty acyl-CoA reductase 4", "gene_name": "FAR4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFQ7-1", "protein_name": "Fatty alcohol:caffeoyl-CoA acyltransferase", "gene_name": "FACT", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WRB0", "url": "https://www.uniprot.org/uniprotkb/Q0WRB0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22797656", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of amino acids conferring chain length substrate specificities on fatty alcohol-forming reductases FAR5 and FAR8 from Arabidopsis thaliana.", "journal": "The Journal of biological chemistry", "date": "2013-10-18", "authors": "Chac\u00f3n Mica\u00ebla G, Fournier Ashley E, Tran Frances, Dittrich-Domergue Franziska, Pulsifer Ian P, Domergue Fr\u00e9d\u00e9ric, Rowland Owen", "reference": { "type": "PubMed", "id": "24005667", "url": "https://pubmed.ncbi.nlm.nih.gov/24005667" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WRB0-1", "protein_name": "Probable fatty acyl-CoA reductase 5", "gene_name": "FAR5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q1PEI6-1", "protein_name": "Fatty acyl-CoA reductase 8", "gene_name": "FAR8", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WRB0", "url": "https://www.uniprot.org/uniprotkb/Q0WRB0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 238, "end_pos": 238, "sequence_org": "Y", "sequence_mut": "F", "comment": "Loss of enzymatic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q0WRB0", "url": "https://www.uniprot.org/uniprotkb/Q0WRB0" }, { "database": "PubMed", "id": "24005667", "url": "https://pubmed.ncbi.nlm.nih.gov/24005667" } ], "uniprot_canonical_ac": "Q0WRB0-1" }, { "start_pos": 242, "end_pos": 242, "sequence_org": "K", "sequence_mut": "I", "comment": "Loss of enzymatic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q0WRB0", "url": "https://www.uniprot.org/uniprotkb/Q0WRB0" }, { "database": "PubMed", "id": "24005667", "url": "https://pubmed.ncbi.nlm.nih.gov/24005667" } ], "uniprot_canonical_ac": "Q0WRB0-1" }, { "start_pos": 347, "end_pos": 347, "sequence_org": "T", "sequence_mut": "I", "comment": "Decreases protein stability and enzymatic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q0WRB0", "url": "https://www.uniprot.org/uniprotkb/Q0WRB0" }, { "database": "PubMed", "id": "24005667", "url": "https://pubmed.ncbi.nlm.nih.gov/24005667" } ], "uniprot_canonical_ac": "Q0WRB0-1" }, { "start_pos": 355, "end_pos": 355, "sequence_org": "A", "sequence_mut": "L", "comment": "Catalyzes the formation of C16:0 fatty alcohol instead of C18:0; when associated with M-377.", "evidence": [ { "database": "UniProtKB", "id": "Q0WRB0", "url": "https://www.uniprot.org/uniprotkb/Q0WRB0" }, { "database": "PubMed", "id": "24005667", "url": "https://pubmed.ncbi.nlm.nih.gov/24005667" } ], "uniprot_canonical_ac": "Q0WRB0-1" }, { "start_pos": 363, "end_pos": 363, "sequence_org": "P", "sequence_mut": "S", "comment": "Decreases protein stability and enzymatic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q0WRB0", "url": "https://www.uniprot.org/uniprotkb/Q0WRB0" }, { "database": "PubMed", "id": "24005667", "url": "https://pubmed.ncbi.nlm.nih.gov/24005667" } ], "uniprot_canonical_ac": "Q0WRB0-1" }, { "start_pos": 377, "end_pos": 377, "sequence_org": "V", "sequence_mut": "M", "comment": "Catalyzes the formation of C16:0 fatty alcohol instead of C18:0; when associated with L-355.", "evidence": [ { "database": "UniProtKB", "id": "Q0WRB0", "url": "https://www.uniprot.org/uniprotkb/Q0WRB0" }, { "database": "PubMed", "id": "24005667", "url": "https://pubmed.ncbi.nlm.nih.gov/24005667" } ], "uniprot_canonical_ac": "Q0WRB0-1" }, { "start_pos": 347, "end_pos": 347, "sequence_org": "I", "sequence_mut": "T", "comment": "Increases protein stability and enzymatic activity. Catalyzes the formation of C18:0 fatty alcohol instead of C16:0; when associated with A-355 and V-377.", "evidence": [ { "database": "UniProtKB", "id": "Q1PEI6", "url": "https://www.uniprot.org/uniprotkb/Q1PEI6" }, { "database": "PubMed", "id": "24005667", "url": "https://pubmed.ncbi.nlm.nih.gov/24005667" } ], "uniprot_canonical_ac": "Q1PEI6-1" }, { "start_pos": 355, "end_pos": 355, "sequence_org": "L", "sequence_mut": "A", "comment": "Catalyzes the formation of C18:0 fatty alcohol instead of C16:0; when associated with T-347 and V-377.", "evidence": [ { "database": "UniProtKB", "id": "Q1PEI6", "url": "https://www.uniprot.org/uniprotkb/Q1PEI6" }, { "database": "PubMed", "id": "24005667", "url": "https://pubmed.ncbi.nlm.nih.gov/24005667" } ], "uniprot_canonical_ac": "Q1PEI6-1" }, { "start_pos": 363, "end_pos": 363, "sequence_org": "S", "sequence_mut": "P", "comment": "Increases protein stability and enzymatic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q1PEI6", "url": "https://www.uniprot.org/uniprotkb/Q1PEI6" }, { "database": "PubMed", "id": "24005667", "url": "https://pubmed.ncbi.nlm.nih.gov/24005667" } ], "uniprot_canonical_ac": "Q1PEI6-1" }, { "start_pos": 377, "end_pos": 377, "sequence_org": "M", "sequence_mut": "V", "comment": "Catalyzes the formation of C18:0 fatty alcohol instead of C16:0; when associated with T-347 and A-355.", "evidence": [ { "database": "UniProtKB", "id": "Q1PEI6", "url": "https://www.uniprot.org/uniprotkb/Q1PEI6" }, { "database": "PubMed", "id": "24005667", "url": "https://pubmed.ncbi.nlm.nih.gov/24005667" } ], "uniprot_canonical_ac": "Q1PEI6-1" } ], "record_id": "pubmed.24005667", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation of Arabidopsis genes that differentiate between resistance responses mediated by the RPS2 and RPM1 disease resistance genes.", "journal": "Plant Cell", "date": "1996", "authors": "Reuber T L, Ausubel F M", "reference": { "type": "PubMed", "id": "8742710", "url": "https://pubmed.ncbi.nlm.nih.gov/8742710" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P54121-1", "protein_name": "Protein AIG2 A", "gene_name": "AIG2A; AIG2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P54120-1", "protein_name": "Immune-associated nucleotide-binding protein 8", "gene_name": "AIG1; IAN8", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P54121", "url": "https://www.uniprot.org/uniprotkb/P54121" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8742710", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomics and localization of the Arabidopsis DHHC-cysteine-rich domain S-acyltransferase protein family.", "journal": "Plant Physiol.", "date": "2012", "authors": "Batistic Oliver", "reference": { "type": "PubMed", "id": "22968831", "url": "https://pubmed.ncbi.nlm.nih.gov/22968831" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3EBC2-1", "protein_name": "Probable protein S-acyltransferase 17", "gene_name": "PAT17", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WQK2-1", "protein_name": "Probable protein S-acyltransferase 7", "gene_name": "PAT07", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q3EC11-1", "protein_name": "Probable protein S-acyltransferase 23", "gene_name": "PAT23", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5PNZ1-1", "protein_name": "Probable protein S-acyltransferase 3", "gene_name": "PAT03", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6DR03-1", "protein_name": "Protein S-acyltransferase 21", "gene_name": "PAT21", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M306-1", "protein_name": "Probable protein S-acyltransferase 5", "gene_name": "PAT05", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "B3DN87-1", "protein_name": "Probable protein S-acyltransferase 1", "gene_name": "PAT01", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M115-1", "protein_name": "Protein S-acyltransferase 18", "gene_name": "PAT18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80685-1", "protein_name": "Probable protein S-acyltransferase 2", "gene_name": "PAT02", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L5Y5-1", "protein_name": "Probable protein S-acyltransferase 19", "gene_name": "PAT19", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VYS8-1", "protein_name": "Probable protein S-acyltransferase 9", "gene_name": "PAT09", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94C49-1", "protein_name": "Probable protein S-acyltransferase 13", "gene_name": "PAT13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C533-1", "protein_name": "Probable protein S-acyltransferase 22", "gene_name": "PAT22", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FLM3-1", "protein_name": "Probable protein S-acyltransferase 6", "gene_name": "MEE6.13; PAT06", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LIE4-1", "protein_name": "Probable protein S-acyltransferase 20", "gene_name": "PAT20", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M1K5-1", "protein_name": "Probable protein S-acyltransferase 4", "gene_name": "PAT04; PAT4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SB58-1", "protein_name": "Protein S-acyltransferase 8", "gene_name": "PAT08", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93VV0-1", "protein_name": "Probable protein S-acyltransferase 16", "gene_name": "PAT16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5M757-1", "protein_name": "Probable protein S-acyltransferase 12", "gene_name": "A_TM018A10.8; PAT12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q500Z2-1", "protein_name": "Probable protein S-acyltransferase 15", "gene_name": "PAT15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q7XA86-1", "protein_name": "Protein S-acyltransferase 10", "gene_name": "PAT10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VYP5-1", "protein_name": "Probable protein S-acyltransferase 14", "gene_name": "PAT14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LIH7-1", "protein_name": "Protein S-acyltransferase 11", "gene_name": "PAT11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q52T38-1", "protein_name": "Protein S-acyltransferase 24", "gene_name": "PAT24", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q3EBC2", "url": "https://www.uniprot.org/uniprotkb/Q3EBC2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22968831", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the novel protein QQS as a component of the starch metabolic network in Arabidopsis leaves.", "journal": "The Plant journal : for cell and molecular biology", "date": "2009-05", "authors": "Li Ling, Foster Carol M, Gan Qinglei, Nettleton Dan, James Martha G, Myers Alan M, Wurtele Eve Syrkin", "reference": { "type": "PubMed", "id": "19154206", "url": "https://pubmed.ncbi.nlm.nih.gov/19154206" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3E7K4-1", "protein_name": "Protein QUA-QUINE STARCH", "gene_name": "QQS", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q3E7K4", "url": "https://www.uniprot.org/uniprotkb/Q3E7K4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19154206", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Extensive natural epigenetic variation at a de novo originated gene.", "journal": "PLoS Genet.", "date": "2013", "authors": "Silveira Amanda Bortolini, Trontin Charlotte, Cortijo Sandra, Barau Joan, Del Bem Luiz Eduardo Vieira, Loudet Olivier, Colot Vincent, Vincentz Michel", "reference": { "type": "PubMed", "id": "23593031", "url": "https://pubmed.ncbi.nlm.nih.gov/23593031" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3E7K4-1", "protein_name": "Protein QUA-QUINE STARCH", "gene_name": "QQS", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q3E7K4", "url": "https://www.uniprot.org/uniprotkb/Q3E7K4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.23593031", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcription factor WRKY46 regulates osmotic stress responses and stomatal movement independently in Arabidopsis.", "journal": "Plant J.", "date": "2014", "authors": "Ding Zhong Jie, Yan Jing Ying, Xu Xiao Yan, Yu Di Qiu, Li Gui Xin, Zhang Shu Qun, Zheng Shao Jian", "reference": { "type": "PubMed", "id": "24773321", "url": "https://pubmed.ncbi.nlm.nih.gov/24773321" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3E7K4-1", "protein_name": "Protein QUA-QUINE STARCH", "gene_name": "QQS", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SKD9-1", "protein_name": "Probable WRKY transcription factor 46", "gene_name": "WRKY46", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q3E7K4", "url": "https://www.uniprot.org/uniprotkb/Q3E7K4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.24773321", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The QQS orphan gene of Arabidopsis modulates carbon and nitrogen allocation in soybean.", "journal": "Plant biotechnology journal", "date": "2015-02", "authors": "Li Ling, Wurtele Eve Syrkin", "reference": { "type": "PubMed", "id": "25146936", "url": "https://pubmed.ncbi.nlm.nih.gov/25146936" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3E7K4-1", "protein_name": "Protein QUA-QUINE STARCH", "gene_name": "QQS", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q3E7K4", "url": "https://www.uniprot.org/uniprotkb/Q3E7K4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.25146936", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and analysis of the Arabidopsis thaliana BSH gene, a member of the SNF5 gene family.", "journal": "Nucleic acids research", "date": "1999-06-01", "authors": "Brzeski J, Podstolski W, Olczak K, Jerzmanowski A", "reference": { "type": "PubMed", "id": "10325430", "url": "https://pubmed.ncbi.nlm.nih.gov/10325430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P93045-1", "protein_name": "Chromatin structure-remodeling complex protein BSH", "gene_name": "BSH", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P93045", "url": "https://www.uniprot.org/uniprotkb/P93045" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10325430", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis thaliana SNF2 homolog AtBRM controls shoot development and flowering.", "journal": "Development", "date": "2004", "authors": "Farrona Sara, Hurtado Lidia, Bowman John L, Reyes Jos\u00e9 C", "reference": { "type": "PubMed", "id": "15371304", "url": "https://pubmed.ncbi.nlm.nih.gov/15371304" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P93045-1", "protein_name": "Chromatin structure-remodeling complex protein BSH", "gene_name": "BSH", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6EVK6-1", "protein_name": "Chromatin remodeling ATPase BRAHMA", "gene_name": "BRM", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XI07-1", "protein_name": "SWI/SNF complex subunit SWI3C", "gene_name": "SWI3C", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P93045", "url": "https://www.uniprot.org/uniprotkb/P93045" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15371304", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SWI3 subunits of putative SWI/SNF chromatin-remodeling complexes play distinct roles during Arabidopsis development.", "journal": "Plant Cell", "date": "2005", "authors": "Sarnowski Tomasz J, R\u00edos Gabino, J\u00e1sik Jan, Swiezewski Szymon, Kaczanowski Szymon, Li Yong, Kwiatkowska Aleksandra, Pawlikowska Katarzyna, Ko\u017abia\u0142 Marta, Ko\u017abia\u0142 Piotr, Koncz Csaba, Jerzmanowski Andrzej", "reference": { "type": "PubMed", "id": "16055636", "url": "https://pubmed.ncbi.nlm.nih.gov/16055636" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P93045-1", "protein_name": "Chromatin structure-remodeling complex protein BSH", "gene_name": "BSH", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84JG2-1", "protein_name": "SWI/SNF complex subunit SWI3B", "gene_name": "SWI3B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W475-1", "protein_name": "SWI/SNF complex subunit SWI3A", "gene_name": "SWI3A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VY05-1", "protein_name": "SWI/SNF complex subunit SWI3D", "gene_name": "SWI3D", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XI07-1", "protein_name": "SWI/SNF complex subunit SWI3C", "gene_name": "SWI3C", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P93045", "url": "https://www.uniprot.org/uniprotkb/P93045" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16055636", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A superfamily of proteins with novel cysteine-rich repeats.", "journal": "Plant Physiol.", "date": "2001", "authors": "Chen Z", "reference": { "type": "PubMed", "id": "11402176", "url": "https://pubmed.ncbi.nlm.nih.gov/11402176" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6NKQ9-1", "protein_name": "Plasmodesmata-located protein 8", "gene_name": "PDLP8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WPN8-1", "protein_name": "Plasmodesmata-located protein 7", "gene_name": "PDLP7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q3E9X6-1", "protein_name": "Cysteine-rich receptor-like protein kinase 21", "gene_name": "CRK21", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6E263-1", "protein_name": "Plasmodesmata-located protein 4", "gene_name": "PDLP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NM73-1", "protein_name": "Plasmodesmata-located protein 2", "gene_name": "PDLP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M0X5-1", "protein_name": "Cysteine-rich receptor-like protein kinase 25", "gene_name": "CRK25", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LZU4-1", "protein_name": "Cysteine-rich receptor-like protein kinase 4", "gene_name": "CRK4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZU94-1", "protein_name": "Plasmodesmata-located protein 6", "gene_name": "PDLP6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SYS7-1", "protein_name": "Putative cysteine-rich receptor-like protein kinase 39", "gene_name": "CRK39", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XEC7-1", "protein_name": "Cysteine-rich receptor-like protein kinase 37", "gene_name": "CRK37", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XEC8-1", "protein_name": "Cysteine-rich receptor-like protein kinase 38", "gene_name": "CRK38", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SYS3-1", "protein_name": "Cysteine-rich receptor-like protein kinase 40", "gene_name": "CRK40", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRL7-1", "protein_name": "Putative cysteine-rich repeat secretory protein 22", "gene_name": "CRRSP22", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRK5-1", "protein_name": "Putative cysteine-rich repeat secretory protein 32", "gene_name": "CRRSP32", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRM1-1", "protein_name": "Cysteine-rich repeat secretory protein 18", "gene_name": "CRRSP18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LJW1-1", "protein_name": "Putative cysteine-rich repeat secretory protein 14", "gene_name": "CRRSP14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LJW2-1", "protein_name": "Putative cysteine-rich repeat secretory protein 13", "gene_name": "CRRSP13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRK0-1", "protein_name": "Putative cysteine-rich repeat secretory protein 37", "gene_name": "CRRSP37", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRK1-1", "protein_name": "Putative cysteine-rich repeat secretory protein 36", "gene_name": "CRRSP36", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRK2-1", "protein_name": "Putative cysteine-rich repeat secretory protein 35", "gene_name": "CRRSP35", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRK3-1", "protein_name": "Cysteine-rich repeat secretory protein 34", "gene_name": "CRRSP34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRK4-1", "protein_name": "Putative cysteine-rich repeat secretory protein 33", "gene_name": "CRRSP33", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRK6-1", "protein_name": "Putative cysteine-rich repeat secretory protein 31", "gene_name": "CRRSP31", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRK8-1", "protein_name": "Cysteine-rich repeat secretory protein 29", "gene_name": "CRRSP29", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRK9-1", "protein_name": "Putative cysteine-rich repeat secretory protein 28", "gene_name": "CRRSP28", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRL0-1", "protein_name": "Putative cysteine-rich repeat secretory protein 27", "gene_name": "CRRSP27", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRL1-1", "protein_name": "Cysteine-rich repeat secretory protein 26", "gene_name": "CRRSP26", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRL2-1", "protein_name": "Putative cysteine-rich repeat secretory protein 25", "gene_name": "CRRSP25", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRL4-1", "protein_name": "Putative cysteine-rich repeat secretory protein 24", "gene_name": "CRRSP24", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRL6-1", "protein_name": "Putative cysteine-rich repeat secretory protein 23", "gene_name": "CRRSP23", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRL8-1", "protein_name": "Putative cysteine-rich repeat secretory protein 21", "gene_name": "CRRSP21", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRL9-1", "protein_name": "Putative cysteine-rich repeat secretory protein 20", "gene_name": "CRRSP20", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRM0-1", "protein_name": "Putative cysteine-rich repeat secretory protein 19", "gene_name": "CRRSP19", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRM2-1", "protein_name": "Putative cysteine-rich repeat secretory protein 17", "gene_name": "CRRSP17", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRM3-1", "protein_name": "Putative cysteine-rich repeat secretory protein 16", "gene_name": "CRRSP16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LV60-1", "protein_name": "Cysteine-rich repeat secretory protein 55", "gene_name": "CRRSP55", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22784-1", "protein_name": "Plasmodesmata-located protein 3", "gene_name": "PDLP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GXV7-1", "protein_name": "Plasmodesmata-located protein 1", "gene_name": "PDLP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65479-1", "protein_name": "Putative cysteine-rich receptor-like protein kinase 20", "gene_name": "CRK20", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O23081-1", "protein_name": "Cysteine-rich receptor-like protein kinase 41", "gene_name": "CRK41", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65468-1", "protein_name": "Cysteine-rich receptor-like protein kinase 8", "gene_name": "CRK8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65405-1", "protein_name": "Cysteine-rich receptor-like protein kinase 28", "gene_name": "CRK28", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65482-1", "protein_name": "Putative cysteine-rich receptor-like protein kinase 23", "gene_name": "CRK23", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O49564-1", "protein_name": "Cysteine-rich receptor-like protein kinase 27", "gene_name": "CRK27", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SH41-1", "protein_name": "Putative cysteine-rich repeat secretory protein 7", "gene_name": "CRRSP7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SH40-1", "protein_name": "Cysteine-rich repeat secretory protein 8", "gene_name": "CRRSP8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SH42-1", "protein_name": "Probable cysteine-rich repeat secretory protein 6", "gene_name": "CRRSP6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SH43-1", "protein_name": "Putative cysteine-rich repeat secretory protein 5", "gene_name": "CRRSP5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SIP6-1", "protein_name": "Putative cysteine-rich repeat secretory protein 10", "gene_name": "CRRSP10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVH9-1", "protein_name": "Putative cysteine-rich repeat secretory protein 40", "gene_name": "CRRSP40", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVI0-1", "protein_name": "Cysteine-rich repeat secretory protein 41", "gene_name": "CRRSP41", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SYB1-1", "protein_name": "Cysteine-rich repeat secretory protein 1", "gene_name": "CRRSP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5S8-1", "protein_name": "Cysteine-rich receptor-like protein kinase 5", "gene_name": "CRK5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A0MEX7-1", "protein_name": "Cysteine-rich repeat secretory protein 30", "gene_name": "CRRSP30", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H199-1", "protein_name": "Cysteine-rich receptor-like protein kinase 14", "gene_name": "CRK14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CAL2-1", "protein_name": "Cysteine-rich receptor-like protein kinase 3", "gene_name": "CRK3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8S9L6-1", "protein_name": "Cysteine-rich receptor-like protein kinase 29", "gene_name": "CRK29", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8RX80-1", "protein_name": "Cysteine-rich receptor-like protein kinase 18", "gene_name": "CRK18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L7G3-1", "protein_name": "Cysteine-rich receptor-like protein kinase 7", "gene_name": "CRK7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W4G6-1", "protein_name": "Cysteine-rich receptor-like protein kinase 15", "gene_name": "CRK15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LDT0-1", "protein_name": "Putative cysteine-rich receptor-like protein kinase 30", "gene_name": "CRK30", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LDS6-1", "protein_name": "Putative cysteine-rich receptor-like protein kinase 32", "gene_name": "CRK32", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LDM5-1", "protein_name": "Putative cysteine-rich receptor-like protein kinase 31", "gene_name": "CRK31", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LDQ3-1", "protein_name": "Cysteine-rich receptor-like protein kinase 34", "gene_name": "CRK34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LDN1-1", "protein_name": "Putative cysteine-rich receptor-like protein kinase 33", "gene_name": "CRK33", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LMB9-1", "protein_name": "Cysteine-rich receptor-like protein kinase 1", "gene_name": "CRK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9T0J1-1", "protein_name": "Cysteine-rich receptor-like protein kinase 26", "gene_name": "CRK26", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65483-1", "protein_name": "Cysteine-rich receptor-like protein kinase 24", "gene_name": "CRK24", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65472-1", "protein_name": "Putative cysteine-rich receptor-like protein kinase 12", "gene_name": "CRK12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65476-1", "protein_name": "Putative cysteine-rich receptor-like protein kinase 16", "gene_name": "CRK16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65469-1", "protein_name": "Putative cysteine-rich receptor-like protein kinase 9", "gene_name": "CRK9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5Q0E2-1", "protein_name": "Cysteine-rich repeat secretory protein 9", "gene_name": "CRRSP9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LPI0-1", "protein_name": "Putative cysteine-rich receptor-like protein kinase At4g11521", "gene_name": "F25E4.140", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CAC7-1", "protein_name": "Cysteine-rich repeat secretory protein 4", "gene_name": "CRRSP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FHD3-1", "protein_name": "Cysteine-rich repeat secretory protein 59", "gene_name": "CRRSP59", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FHD4-1", "protein_name": "Cysteine-rich repeat secretory protein 58", "gene_name": "CRRSP58", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FHD5-1", "protein_name": "Cysteine-rich repeat secretory protein 57", "gene_name": "CRRSP57", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ49-1", "protein_name": "Cysteine-rich repeat secretory protein 42", "gene_name": "CRRSP42", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ50-1", "protein_name": "Cysteine-rich repeat secretory protein 43", "gene_name": "CRRSP43", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ51-1", "protein_name": "Cysteine-rich repeat secretory protein 44", "gene_name": "CRRSP44", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ52-1", "protein_name": "Cysteine-rich repeat secretory protein 45", "gene_name": "CRRSP45", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ53-1", "protein_name": "Cysteine-rich repeat secretory protein 46", "gene_name": "CRRSP46", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ54-1", "protein_name": "Cysteine-rich repeat secretory protein 47", "gene_name": "CRRSP47", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ55-1", "protein_name": "Cysteine-rich repeat secretory protein 48", "gene_name": "CRRSP48", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ56-1", "protein_name": "Cysteine-rich repeat secretory protein 49", "gene_name": "CRRSP49", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ57-1", "protein_name": "Cysteine-rich repeat secretory protein 50", "gene_name": "CRRSP50", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ58-1", "protein_name": "Cysteine-rich repeat secretory protein 51", "gene_name": "CRRSP51", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ59-1", "protein_name": "Cysteine-rich repeat secretory protein 52", "gene_name": "CRRSP52", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ60-1", "protein_name": "Cysteine-rich repeat secretory protein 53", "gene_name": "CRRSP53", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ61-1", "protein_name": "Cysteine-rich repeat secretory protein 54", "gene_name": "CRRSP54", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GYA4-1", "protein_name": "Cysteine-rich receptor-like protein kinase 10", "gene_name": "CRK10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GWJ7-1", "protein_name": "Cysteine-rich receptor-like protein kinase 19", "gene_name": "CRK19", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L710-1", "protein_name": "Cysteine-rich receptor-like protein kinase 17", "gene_name": "CRK17; EMB1290", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GUJ2-1", "protein_name": "Plasmodesmata-located protein 5", "gene_name": "PDLP5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5S9-1", "protein_name": "Cysteine-rich receptor-like protein kinase 6", "gene_name": "CRK6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CAL3-1", "protein_name": "Cysteine-rich receptor-like protein kinase 2", "gene_name": "CRK2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NQ87-1", "protein_name": "Cysteine-rich receptor-like protein kinase 22", "gene_name": "CRK22", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FNE1-1", "protein_name": "Cysteine-rich receptor-like protein kinase 42", "gene_name": "CRK42", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRJ9-1", "protein_name": "Cysteine-rich repeat secretory protein 38", "gene_name": "CRRSP38", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0PW40-1", "protein_name": "Cysteine-rich receptor-like protein kinase 13", "gene_name": "CRK13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XEC6-1", "protein_name": "Cysteine-rich receptor-like protein kinase 36", "gene_name": "CRK36", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZP16-1", "protein_name": "Cysteine-rich receptor-like protein kinase 11", "gene_name": "CRK11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q6NKQ9", "url": "https://www.uniprot.org/uniprotkb/Q6NKQ9" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11402176", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 102 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Symplastic domains in the Arabidopsis shoot apical meristem correlate with PDLP1 expression patterns.", "journal": "Plant Signal. Behav.", "date": "2008", "authors": "Bayer Emmanuelle, Thomas Carole, Maule Andy", "reference": { "type": "PubMed", "id": "19704520", "url": "https://pubmed.ncbi.nlm.nih.gov/19704520" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6NKQ9-1", "protein_name": "Plasmodesmata-located protein 8", "gene_name": "PDLP8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WPN8-1", "protein_name": "Plasmodesmata-located protein 7", "gene_name": "PDLP7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6E263-1", "protein_name": "Plasmodesmata-located protein 4", "gene_name": "PDLP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NM73-1", "protein_name": "Plasmodesmata-located protein 2", "gene_name": "PDLP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZU94-1", "protein_name": "Plasmodesmata-located protein 6", "gene_name": "PDLP6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22784-1", "protein_name": "Plasmodesmata-located protein 3", "gene_name": "PDLP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GXV7-1", "protein_name": "Plasmodesmata-located protein 1", "gene_name": "PDLP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GUJ2-1", "protein_name": "Plasmodesmata-located protein 5", "gene_name": "PDLP5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q6NKQ9", "url": "https://www.uniprot.org/uniprotkb/Q6NKQ9" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19704520", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A family of plasmodesmal proteins with receptor-like properties for plant viral movement proteins.", "journal": "PLoS Pathog.", "date": "2010", "authors": "Amari Khalid, Boutant Emmanuel, Hofmann Christina, Schmitt-Keichinger Corinne, Fernandez-Calvino Lourdes, Didier Pascal, Lerich Alexander, Mutterer J\u00e9rome, Thomas Carole L, Heinlein Manfred, M\u00e9ly Yves, Maule Andrew J, Ritzenthaler Christophe", "reference": { "type": "PubMed", "id": "20886105", "url": "https://pubmed.ncbi.nlm.nih.gov/20886105" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6NKQ9-1", "protein_name": "Plasmodesmata-located protein 8", "gene_name": "PDLP8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WPN8-1", "protein_name": "Plasmodesmata-located protein 7", "gene_name": "PDLP7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6E263-1", "protein_name": "Plasmodesmata-located protein 4", "gene_name": "PDLP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NM73-1", "protein_name": "Plasmodesmata-located protein 2", "gene_name": "PDLP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZU94-1", "protein_name": "Plasmodesmata-located protein 6", "gene_name": "PDLP6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22784-1", "protein_name": "Plasmodesmata-located protein 3", "gene_name": "PDLP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GXV7-1", "protein_name": "Plasmodesmata-located protein 1", "gene_name": "PDLP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GUJ2-1", "protein_name": "Plasmodesmata-located protein 5", "gene_name": "PDLP5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q6NKQ9", "url": "https://www.uniprot.org/uniprotkb/Q6NKQ9" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20886105", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis thaliana Acyl-CoA-binding protein ACBP6 interacts with plasmodesmata-located protein PDLP8.", "journal": "Plant Signal. Behav.", "date": "2017", "authors": "Ye Zi-Wei, Chen Qin-Fang, Chye Mee-Len", "reference": { "type": "PubMed", "id": "28786767", "url": "https://pubmed.ncbi.nlm.nih.gov/28786767" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6NKQ9-1", "protein_name": "Plasmodesmata-located protein 8", "gene_name": "PDLP8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P57752-1", "protein_name": "Acyl-CoA-binding domain-containing protein 6", "gene_name": "ACBP6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q6NKQ9", "url": "https://www.uniprot.org/uniprotkb/Q6NKQ9" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.28786767", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of the pollen-specific actin-depolymerizing factor LlADF1.", "journal": "Plant Cell", "date": "2002", "authors": "Allwood Ellen G, Anthony Richard G, Smertenko Andrei P, Reichelt Stefanie, Drobak Bjorn K, Doonan John H, Weeds Alan G, Hussey Patrick J", "reference": { "type": "PubMed", "id": "12417710", "url": "https://pubmed.ncbi.nlm.nih.gov/12417710" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q39251-1", "protein_name": "Actin-depolymerizing factor 2", "gene_name": "ADF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LV35-1", "protein_name": "Actin-interacting protein 1-2", "gene_name": "AIP1-2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZU34-1", "protein_name": "Actin-interacting protein 1-1", "gene_name": "AIP1-1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q39251", "url": "https://www.uniprot.org/uniprotkb/Q39251" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12417710", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Green fluorescent protein-mTalin causes defects in actin organization and cell expansion in Arabidopsis and inhibits actin depolymerizing factor's actin depolymerizing activity in vitro.", "journal": "Plant physiology", "date": "2004-12", "authors": "Ketelaar Tijs, Anthony Richard G, Hussey Patrick J", "reference": { "type": "PubMed", "id": "15563618", "url": "https://pubmed.ncbi.nlm.nih.gov/15563618" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q39251-1", "protein_name": "Actin-depolymerizing factor 2", "gene_name": "ADF2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q39251", "url": "https://www.uniprot.org/uniprotkb/Q39251" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15563618", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Actin-depolymerizing factor2-mediated actin dynamics are essential for root-knot nematode infection of Arabidopsis.", "journal": "The Plant cell", "date": "2009-09", "authors": "Cl\u00e9ment Mathilde, Ketelaar Tijs, Rodiuc Natalia, Banora Mohamed Youssef, Smertenko Andrei, Engler Gilbert, Abad Pierre, Hussey Patrick J, de Almeida Engler Janice", "reference": { "type": "PubMed", "id": "19794115", "url": "https://pubmed.ncbi.nlm.nih.gov/19794115" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q39251-1", "protein_name": "Actin-depolymerizing factor 2", "gene_name": "ADF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZNT3-1", "protein_name": "Actin-depolymerizing factor 5", "gene_name": "ADF5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZSK2-1", "protein_name": "Actin-depolymerizing factor 6", "gene_name": "ADF6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZSK3-1", "protein_name": "Actin-depolymerizing factor 4", "gene_name": "ADF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZSK4-1", "protein_name": "Actin-depolymerizing factor 3", "gene_name": "ADF3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q39251", "url": "https://www.uniprot.org/uniprotkb/Q39251" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19794115", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of two NAD kinases from Arabidopsis. Identification of a calmodulin binding isoform.", "journal": "Plant Physiol.", "date": "2004", "authors": "Turner William L, Waller Jeffrey C, Vanderbeld Barb, Snedden Wayne A", "reference": { "type": "PubMed", "id": "15247403", "url": "https://pubmed.ncbi.nlm.nih.gov/15247403" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q56YN3-1", "protein_name": "NAD(H) kinase 1", "gene_name": "NADK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5W3-1", "protein_name": "NAD kinase 2, chloroplastic", "gene_name": "NADK2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q56YN3", "url": "https://www.uniprot.org/uniprotkb/Q56YN3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15247403", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stress induces the expression of AtNADK-1, a gene encoding a NAD(H) kinase in Arabidopsis thaliana.", "journal": "Molecular genetics and genomics : MGG", "date": "2005-03", "authors": "Berrin Jean-Guy, Pierrugues Olivier, Brutesco Catherine, Alonso B\u00e9atrice, Montillet Jean-Luc, Roby Dominique, Kazmaier Michael", "reference": { "type": "PubMed", "id": "15711971", "url": "https://pubmed.ncbi.nlm.nih.gov/15711971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q56YN3-1", "protein_name": "NAD(H) kinase 1", "gene_name": "NADK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5W3-1", "protein_name": "NAD kinase 2, chloroplastic", "gene_name": "NADK2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q500Y9-1", "protein_name": "NADH kinase", "gene_name": "NADK3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q56YN3", "url": "https://www.uniprot.org/uniprotkb/Q56YN3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15711971", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of putative gene encoded on ORF16 of the 81 kb contig of Arabidopsis thaliana chromosome III as alpha-mannosidase.", "journal": "Journal of bioscience and bioengineering", "date": "2001", "authors": "Fujiyama K, Kira Y, Iizuka M, Kimura Y, Seki T", "reference": { "type": "PubMed", "id": "16233119", "url": "https://pubmed.ncbi.nlm.nih.gov/16233119" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P94078-1", "protein_name": "Alpha-mannosidase At3g26720", "gene_name": "MLJ15.11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P94078", "url": "https://www.uniprot.org/uniprotkb/P94078" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16233119", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence analysis of an 81 kb contig from Arabidopsis thaliana chromosome III.", "journal": "Nucleic Acids Res.", "date": "1996", "authors": "Quigley F, Dao P, Cottet A, Mache R", "reference": { "type": "PubMed", "id": "8932388", "url": "https://pubmed.ncbi.nlm.nih.gov/8932388" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P94078-1", "protein_name": "Alpha-mannosidase At3g26720", "gene_name": "MLJ15.11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P35614-1", "protein_name": "Eukaryotic peptide chain release factor subunit 1-3", "gene_name": "ERF1-3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38953-1", "protein_name": "Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5", "gene_name": "MFE16.8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38960-1", "protein_name": "WD repeat-containing protein LWD2", "gene_name": "LWD2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P59468-1", "protein_name": "LOB domain-containing protein 24", "gene_name": "LBD24", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P59467-1", "protein_name": "LOB domain-containing protein 23", "gene_name": "LBD23", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38959-1", "protein_name": "Pentatricopeptide repeat-containing protein At3g26630, chloroplastic", "gene_name": "PCMP-A6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38956-1", "protein_name": "Protein DETOXIFICATION 29", "gene_name": "DTX29", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38961-1", "protein_name": "DNA cross-link repair protein SNM1", "gene_name": "SNM1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P25856-1", "protein_name": "Glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic", "gene_name": "GAPA1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q96500-1", "protein_name": "Light-regulated protein 1, chloroplastic", "gene_name": "LIR1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LSE4-1", "protein_name": "Protein COFACTOR ASSEMBLY OF COMPLEX C SUBUNIT B CCB1, chloroplastic", "gene_name": "CCB1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38954-1", "protein_name": "Inorganic phosphate transporter 2-1, chloroplastic", "gene_name": "PHT2-1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P94078", "url": "https://www.uniprot.org/uniprotkb/P94078" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8932388", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulated nuclear trafficking of rpL10A mediated by NIK1 represents a defense strategy of plant cells against virus.", "journal": "PLoS Pathog.", "date": "2008", "authors": "Carvalho Claudine M, Santos An\u00e9sia A, Pires Silvana R, Rocha Carolina S, Saraiva Daniela I, Machado Jo\u00e3o Paulo B, Mattos Eliciane C, Fietto Luciano G, Fontes Elizabeth P B", "reference": { "type": "PubMed", "id": "19112492", "url": "https://pubmed.ncbi.nlm.nih.gov/19112492" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42791-1", "protein_name": "Large ribosomal subunit protein eL18y", "gene_name": "RPL18B; RPL18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFS4-1", "protein_name": "Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 5", "gene_name": "CIK5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93VT9-1", "protein_name": "Large ribosomal subunit protein uL16z", "gene_name": "RPL10A; SAC52", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P42791", "url": "https://www.uniprot.org/uniprotkb/P42791" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19112492", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A cDNA encoding Arabidopsis thaliana cytoplasmic ribosomal protein L18.", "journal": "Gene", "date": "1995", "authors": "Baima S, Sessa G, Ruberti I, Morelli G", "reference": { "type": "PubMed", "id": "7875584", "url": "https://pubmed.ncbi.nlm.nih.gov/7875584" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42791-1", "protein_name": "Large ribosomal subunit protein eL18y", "gene_name": "RPL18B; RPL18", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P42791", "url": "https://www.uniprot.org/uniprotkb/P42791" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7875584", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lanosterol biosynthesis in plants.", "journal": "Archives of biochemistry and biophysics", "date": "2006-03-01", "authors": "Kolesnikova Mariya D, Xiong Quanbo, Lodeiro Silvia, Hua Ling, Matsuda Seiichi P T", "reference": { "type": "PubMed", "id": "16445886", "url": "https://pubmed.ncbi.nlm.nih.gov/16445886" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1G1A4-1", "protein_name": "Lanosterol synthase", "gene_name": "LAS1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1G1A4", "url": "https://www.uniprot.org/uniprotkb/Q1G1A4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16445886", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lanosterol synthase in dicotyledonous plants.", "journal": "Plant & cell physiology", "date": "2006-05", "authors": "Suzuki Masashi, Xiang Ting, Ohyama Kiyoshi, Seki Hikaru, Saito Kazuki, Muranaka Toshiya, Hayashi Hiroaki, Katsube Yuji, Kushiro Tetsuo, Shibuya Masaaki, Ebizuka Yutaka", "reference": { "type": "PubMed", "id": "16531458", "url": "https://pubmed.ncbi.nlm.nih.gov/16531458" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1G1A4-1", "protein_name": "Lanosterol synthase", "gene_name": "LAS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P38605-1", "protein_name": "Cycloartenol synthase", "gene_name": "CAS1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1G1A4", "url": "https://www.uniprot.org/uniprotkb/Q1G1A4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16531458", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Calmodulin interacts with MLO protein to regulate defence against mildew in barley.", "journal": "Nature", "date": "2002", "authors": "Kim Min C, Panstruga Ralph, Elliott Candace, M\u00fcller Judith, Devoto Alessandra, Yoon Hae W, Park Hyeong C, Cho Moo J, Schulze-Lefert Paul", "reference": { "type": "PubMed", "id": "11919636", "url": "https://pubmed.ncbi.nlm.nih.gov/11919636" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SXB6-1", "protein_name": "MLO-like protein 2", "gene_name": "MLO2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O49621-1", "protein_name": "MLO-like protein 1", "gene_name": "MLO1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SXB6", "url": "https://www.uniprot.org/uniprotkb/Q9SXB6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 453, "end_pos": 453, "sequence_org": "L", "sequence_mut": "R", "comment": "Disturbs binding to calmodulin; when associated with R-456.", "evidence": [ { "database": "UniProtKB", "id": "O49621", "url": "https://www.uniprot.org/uniprotkb/O49621" }, { "database": "PubMed", "id": "11919636", "url": "https://pubmed.ncbi.nlm.nih.gov/11919636" } ], "uniprot_canonical_ac": "O49621-1" }, { "start_pos": 456, "end_pos": 456, "sequence_org": "W", "sequence_mut": "R", "comment": "Disturbs binding to calmodulin; when associated with R-453.", "evidence": [ { "database": "UniProtKB", "id": "O49621", "url": "https://www.uniprot.org/uniprotkb/O49621" }, { "database": "PubMed", "id": "11919636", "url": "https://pubmed.ncbi.nlm.nih.gov/11919636" } ], "uniprot_canonical_ac": "O49621-1" } ], "record_id": "pubmed.11919636", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular phylogeny and evolution of the plant-specific seven-transmembrane MLO family.", "journal": "J. Mol. Evol.", "date": "2003", "authors": "Devoto Alessandra, Hartmann H Andreas, Piffanelli Pietro, Elliott Candace, Simmons Carl, Taramino Graziana, Goh Chern-Sing, Cohen Fred E, Emerson Brent C, Schulze-Lefert Paul, Panstruga Ralph", "reference": { "type": "PubMed", "id": "12569425", "url": "https://pubmed.ncbi.nlm.nih.gov/12569425" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SXB6-1", "protein_name": "MLO-like protein 2", "gene_name": "MLO2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22752-1", "protein_name": "MLO-like protein 7", "gene_name": "MLO7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94KB7-1", "protein_name": "MLO-like protein 6", "gene_name": "MLO6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94KB4-1", "protein_name": "MLO-like protein 9", "gene_name": "MLO9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94KB2-1", "protein_name": "MLO-like protein 13", "gene_name": "MLO13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94KB1-1", "protein_name": "MLO-like protein 14", "gene_name": "MLO14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94KB9-1", "protein_name": "MLO-like protein 3", "gene_name": "MLO3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O23693-1", "protein_name": "MLO-like protein 4", "gene_name": "MLO4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80580-1", "protein_name": "MLO-like protein 15", "gene_name": "MLO15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22757-1", "protein_name": "MLO-like protein 8", "gene_name": "MLO8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22815-1", "protein_name": "MLO-like protein 5", "gene_name": "MLO5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FI00-1", "protein_name": "MLO-like protein 11", "gene_name": "MLO11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FKY5-1", "protein_name": "MLO-like protein 10", "gene_name": "MLO10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80961-1", "protein_name": "MLO-like protein 12", "gene_name": "MLO12", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SXB6", "url": "https://www.uniprot.org/uniprotkb/Q9SXB6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12569425", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adenine phosphoribosyltransferase isoforms of Arabidopsis and their potential contributions to adenine and cytokinin metabolism.", "journal": "Physiologia plantarum", "date": "2002-05", "authors": "Allen Michael, Qin Wensheng, Moreau Fran\u00e7ois, Moffatt Barbara", "reference": { "type": "PubMed", "id": "12010467", "url": "https://pubmed.ncbi.nlm.nih.gov/12010467" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q42563-1", "protein_name": "Adenine phosphoribosyltransferase 2", "gene_name": "APT2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P31166-1", "protein_name": "Adenine phosphoribosyltransferase 1, chloroplastic", "gene_name": "APT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SUW2-1", "protein_name": "Adenine phosphoribosyltransferase 3", "gene_name": "APT3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q42563", "url": "https://www.uniprot.org/uniprotkb/Q42563" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12010467", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adenine phosphoribosyl transferase 1 is a key enzyme catalyzing cytokinin conversion from nucleobases to nucleotides in Arabidopsis.", "journal": "Molecular plant", "date": "2013-09", "authors": "Zhang Xinyan, Chen Yutao, Lin Xin, Hong Xinyu, Zhu Ying, Li Wenyang, He Wenrong, An Fengying, Guo Hongwei", "reference": { "type": "PubMed", "id": "23658065", "url": "https://pubmed.ncbi.nlm.nih.gov/23658065" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q42563-1", "protein_name": "Adenine phosphoribosyltransferase 2", "gene_name": "APT2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SU38-1", "protein_name": "Adenine phosphoribosyltransferase 4", "gene_name": "APT4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P31166-1", "protein_name": "Adenine phosphoribosyltransferase 1, chloroplastic", "gene_name": "APT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFP0-1", "protein_name": "Adenine phosphoribosyltransferase 5", "gene_name": "APT5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SUW2-1", "protein_name": "Adenine phosphoribosyltransferase 3", "gene_name": "APT3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q42563", "url": "https://www.uniprot.org/uniprotkb/Q42563" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 149, "end_pos": 149, "sequence_org": "R", "sequence_mut": "K", "comment": "In apt1-7; loss of activity and male sterility.", "evidence": [ { "database": "UniProtKB", "id": "P31166", "url": "https://www.uniprot.org/uniprotkb/P31166" }, { "database": "PubMed", "id": "23658065", "url": "https://pubmed.ncbi.nlm.nih.gov/23658065" } ], "uniprot_canonical_ac": "P31166-1" }, { "start_pos": 168, "end_pos": 168, "sequence_org": "G", "sequence_mut": "E", "comment": "In apt1-4; reduces activity 3-fold.", "evidence": [ { "database": "UniProtKB", "id": "P31166", "url": "https://www.uniprot.org/uniprotkb/P31166" }, { "database": "PubMed", "id": "23658065", "url": "https://pubmed.ncbi.nlm.nih.gov/23658065" } ], "uniprot_canonical_ac": "P31166-1" }, { "start_pos": 195, "end_pos": 195, "sequence_org": "G", "sequence_mut": "D", "comment": "In apt1-8; loss of activity and male sterility.", "evidence": [ { "database": "UniProtKB", "id": "P31166", "url": "https://www.uniprot.org/uniprotkb/P31166" }, { "database": "PubMed", "id": "23658065", "url": "https://pubmed.ncbi.nlm.nih.gov/23658065" } ], "uniprot_canonical_ac": "P31166-1" }, { "start_pos": 85, "end_pos": 85, "sequence_org": "P", "sequence_mut": "T", "comment": "In apt1-5; loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P31166", "url": "https://www.uniprot.org/uniprotkb/P31166" }, { "database": "PubMed", "id": "23658065", "url": "https://pubmed.ncbi.nlm.nih.gov/23658065" } ], "uniprot_canonical_ac": "P31166-1" }, { "start_pos": 99, "end_pos": 99, "sequence_org": "L", "sequence_mut": "F", "comment": "In apt1-6; reduces activity 10-fold.", "evidence": [ { "database": "UniProtKB", "id": "P31166", "url": "https://www.uniprot.org/uniprotkb/P31166" }, { "database": "PubMed", "id": "23658065", "url": "https://pubmed.ncbi.nlm.nih.gov/23658065" } ], "uniprot_canonical_ac": "P31166-1" } ], "record_id": "pubmed.23658065", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A second form of adenine phosphoribosyltransferase in Arabidopsis thaliana with relative specificity towards cytokinins.", "journal": "Plant J.", "date": "1996", "authors": "Schnorr K M, Gaillard C, Biget E, Nygaard P, Laloue M", "reference": { "type": "PubMed", "id": "8696367", "url": "https://pubmed.ncbi.nlm.nih.gov/8696367" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q42563-1", "protein_name": "Adenine phosphoribosyltransferase 2", "gene_name": "APT2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q42563", "url": "https://www.uniprot.org/uniprotkb/Q42563" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8696367", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The deubiquitinating enzyme AMSH3 is required for intracellular trafficking and vacuole biogenesis in Arabidopsis thaliana.", "journal": "Plant Cell", "date": "2010", "authors": "Isono Erika, Katsiarimpa Anthi, M\u00fcller Isabel Karin, Anzenberger Franziska, Stierhof York-Dieter, Geldner Niko, Chory Joanne, Schwechheimer Claus", "reference": { "type": "PubMed", "id": "20543027", "url": "https://pubmed.ncbi.nlm.nih.gov/20543027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q56ZI2-1", "protein_name": "Patellin-2", "gene_name": "PATL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NKP9-1", "protein_name": "AMSH-like ubiquitin thioesterase 2", "gene_name": "AMSH2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VYB5-1", "protein_name": "AMSH-like ubiquitin thioesterase 1", "gene_name": "AMSH1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O23654-1", "protein_name": "V-type proton ATPase catalytic subunit A", "gene_name": "VHA-A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65719-1", "protein_name": "Heat shock 70 kDa protein 3", "gene_name": "HSP70-3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P22953-1", "protein_name": "Heat shock 70 kDa protein 1", "gene_name": "HSC70-1; HSP70-1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5PNU3-1", "protein_name": "AMSH-like ubiquitin thioesterase 3", "gene_name": "AMSH3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q56WK6-1", "protein_name": "Patellin-1", "gene_name": "PATL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VY07-1", "protein_name": "Clathrin interactor EPSIN 1", "gene_name": "EPSIN1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SR37-1", "protein_name": "Beta-glucosidase 23", "gene_name": "BGLU23", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q56ZI2", "url": "https://www.uniprot.org/uniprotkb/Q56ZI2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 411, "end_pos": 413, "sequence_org": "HTH", "sequence_mut": "ATA", "comment": "In amsh3-axa; loss of ubiquitin thioesterase activity and seedling growth arrest.", "evidence": [ { "database": "UniProtKB", "id": "Q5PNU3", "url": "https://www.uniprot.org/uniprotkb/Q5PNU3" }, { "database": "PubMed", "id": "20543027", "url": "https://pubmed.ncbi.nlm.nih.gov/20543027" } ], "uniprot_canonical_ac": "Q5PNU3-1" } ], "record_id": "pubmed.20543027", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of Phosphoinositide-Binding Protein PATELLIN2 as a Substrate of Arabidopsis MPK4 MAP Kinase during Septum Formation in Cytokinesis.", "journal": "Plant & cell physiology", "date": "2016-08", "authors": "Suzuki Takamasa, Matsushima Chiyuki, Nishimura Shingo, Higashiyama Tetsuya, Sasabe Michiko, Machida Yasunori", "reference": { "type": "PubMed", "id": "27335345", "url": "https://pubmed.ncbi.nlm.nih.gov/27335345" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q56ZI2-1", "protein_name": "Patellin-2", "gene_name": "PATL2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q56ZI2", "url": "https://www.uniprot.org/uniprotkb/Q56ZI2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 536, "end_pos": 536, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q56ZI2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q56ZI2" }, { "database": "PubMed", "id": "23572148", "url": "https://pubmed.ncbi.nlm.nih.gov/23572148" }, { "database": "PubMed", "id": "25561503", "url": "https://pubmed.ncbi.nlm.nih.gov/25561503" }, { "database": "PubMed", "id": "27335345", "url": "https://pubmed.ncbi.nlm.nih.gov/27335345" } ], "site_lbl": "Ser536", "uniprot_canonical_ac": "Q56ZI2-1" } ], "record_id": "pubmed.27335345", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Brassicaceae-specific secreted peptides, STMPs, function in plant growth and pathogen defense.", "journal": "J. Integr. Plant Biol.", "date": "2020", "authors": "Yu Zipeng, Xu Yang, Zhu Lifei, Zhang Lei, Liu Lin, Zhang Di, Li Dandan, Wu Changai, Huang Jinguang, Yang Guodong, Yan Kang, Zhang Shizhong, Zheng Chengchao", "reference": { "type": "PubMed", "id": "31001913", "url": "https://pubmed.ncbi.nlm.nih.gov/31001913" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6DBB8-1", "protein_name": "Precursor of secreted transmembrane peptide 7", "gene_name": "STMP7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4KCH3-1", "protein_name": "Serine rich endogenous peptide 15", "gene_name": "PROSCOOP15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04468-1", "protein_name": "Secreted transmembrane peptide 6", "gene_name": "STMP6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A0A1P8ANJ1-1", "protein_name": "Secreted transmembrane peptide 5", "gene_name": "STMP5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LE06-1", "protein_name": "Serine rich endogenous peptide 13", "gene_name": "PROSCOOP13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FIW1-1", "protein_name": "Secreted transmembrane peptide 9", "gene_name": "STMP9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q570K8-1", "protein_name": "Serine rich endogenous peptide 4", "gene_name": "PROSCOOP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A0A1P8AQ95-1", "protein_name": "Secreted transmembrane peptide 4", "gene_name": "STMP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A0JQ18-1", "protein_name": "Serine rich endogenous peptide 14", "gene_name": "PROSCOOP14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "B3H4Y2-1", "protein_name": "Secreted transmembrane peptide 3", "gene_name": "STMP3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q6DBB8", "url": "https://www.uniprot.org/uniprotkb/Q6DBB8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.31001913", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Imaging photosynthesis in wounded leaves of Arabidopsis thaliana.", "journal": "J. Exp. Bot.", "date": "2006", "authors": "Quilliam Richard S, Swarbrick Philip J, Scholes Julie D, Rolfe Stephen A", "reference": { "type": "PubMed", "id": "16339783", "url": "https://pubmed.ncbi.nlm.nih.gov/16339783" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q67XZ3-1", "protein_name": "Beta-fructofuranosidase, insoluble isoenzyme CWINV3", "gene_name": "CWINV3; FRUCT5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LIB9-1", "protein_name": "Beta-fructofuranosidase, insoluble isoenzyme CWINV5", "gene_name": "CWINV5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q43866-1", "protein_name": "Beta-fructofuranosidase, insoluble isoenzyme CWINV1", "gene_name": "ATBFRUCT1; CWINV1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q67XZ3", "url": "https://www.uniprot.org/uniprotkb/Q67XZ3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16339783", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The aspartate aminotransferase gene family of Arabidopsis encodes isoenzymes localized to three distinct subcellular compartments.", "journal": "Plant J.", "date": "1995", "authors": "Schultz C J, Coruzzi G M", "reference": { "type": "PubMed", "id": "7894512", "url": "https://pubmed.ncbi.nlm.nih.gov/7894512" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46646-1", "protein_name": "Aspartate aminotransferase, cytoplasmic isozyme 2", "gene_name": "ASP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P46643-1", "protein_name": "Aspartate aminotransferase, mitochondrial", "gene_name": "ASP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P46644-1", "protein_name": "Aspartate aminotransferase 3, chloroplastic", "gene_name": "ASP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P46645-1", "protein_name": "Aspartate aminotransferase, cytoplasmic isozyme 1", "gene_name": "ASP2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P46646", "url": "https://www.uniprot.org/uniprotkb/P46646" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7894512", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AtJ1, a mitochondrial homologue of the Escherichia coli DnaJ protein.", "journal": "Plant Mol. Biol.", "date": "1996", "authors": "Kroczynska B, Zhou R, Wood C, Miernyk J A", "reference": { "type": "PubMed", "id": "8790294", "url": "https://pubmed.ncbi.nlm.nih.gov/8790294" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38813-1", "protein_name": "Chaperone protein dnaJ 1, mitochondrial", "gene_name": "ATJ1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38813", "url": "https://www.uniprot.org/uniprotkb/Q38813" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8790294", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Negative gravitropism in plant roots.", "journal": "Nature plants", "date": "2016-10-17", "authors": "Ge Liangfa, Chen Rujin", "reference": { "type": "PubMed", "id": "27748769", "url": "https://pubmed.ncbi.nlm.nih.gov/27748769" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1G3U5-1", "protein_name": "Protein LAZY 3", "gene_name": "DRO2; LAZY3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q58G53-1", "protein_name": "Protein LAZY 2", "gene_name": "DRO3; LAZY2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XVG3-1", "protein_name": "Protein LAZY 4", "gene_name": "DRO1; LAZY4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1G3U5", "url": "https://www.uniprot.org/uniprotkb/Q1G3U5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.27748769", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DRO1 influences root system architecture in Arabidopsis and Prunus species.", "journal": "Plant J.", "date": "2017", "authors": "Guseman Jessica M, Webb Kevin, Srinivasan Chinnathambi, Dardick Chris", "reference": { "type": "PubMed", "id": "28029738", "url": "https://pubmed.ncbi.nlm.nih.gov/28029738" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1G3U5-1", "protein_name": "Protein LAZY 3", "gene_name": "DRO2; LAZY3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XVG3-1", "protein_name": "Protein LAZY 4", "gene_name": "DRO1; LAZY4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1G3U5", "url": "https://www.uniprot.org/uniprotkb/Q1G3U5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 283, "end_pos": 287, "sequence_org": "IVLEI", "sequence_mut": "", "comment": "No shoot and root phenotypes when ectopically expressed in plants.", "evidence": [ { "database": "UniProtKB", "id": "Q5XVG3", "url": "https://www.uniprot.org/uniprotkb/Q5XVG3" }, { "database": "PubMed", "id": "28029738", "url": "https://pubmed.ncbi.nlm.nih.gov/28029738" } ], "uniprot_canonical_ac": "Q5XVG3-1" } ], "record_id": "pubmed.28029738", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LAZY Genes Mediate the Effects of Gravity on Auxin Gradients and Plant Architecture.", "journal": "Plant physiology", "date": "2017-10", "authors": "Yoshihara Takeshi, Spalding Edgar P", "reference": { "type": "PubMed", "id": "28821594", "url": "https://pubmed.ncbi.nlm.nih.gov/28821594" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1G3U5-1", "protein_name": "Protein LAZY 3", "gene_name": "DRO2; LAZY3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q58G53-1", "protein_name": "Protein LAZY 2", "gene_name": "DRO3; LAZY2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XVG3-1", "protein_name": "Protein LAZY 4", "gene_name": "DRO1; LAZY4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XV40-1", "protein_name": "Protein LAZY 1", "gene_name": "LAZY1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1G3U5", "url": "https://www.uniprot.org/uniprotkb/Q1G3U5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.28821594", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Several distinct genes encode nearly identical to 16 kDa proteolipids of the vacuolar H(+)-ATPase from Arabidopsis thaliana.", "journal": "Plant Mol. Biol.", "date": "1995", "authors": "Perera I Y, Li X, Sze H", "reference": { "type": "PubMed", "id": "7579175", "url": "https://pubmed.ncbi.nlm.nih.gov/7579175" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P59228-1", "protein_name": "V-type proton ATPase subunit c2", "gene_name": "AVA-P2; VHA-c2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P59229-1", "protein_name": "V-type proton ATPase subunit c4", "gene_name": "AVA-P4; VHA-c4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0DH92-1", "protein_name": "V-type proton ATPase subunit c1", "gene_name": "AVA-P1; VHA-c1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0DH93-1", "protein_name": "V-type proton ATPase subunit c3", "gene_name": "VHA-C3; VHA-c3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P59228", "url": "https://www.uniprot.org/uniprotkb/P59228" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7579175", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Root cap specific expression of an endo-beta-1,4-D-glucanase (cellulase): a new marker to study root development in Arabidopsis.", "journal": "Plant molecular biology", "date": "2004-09", "authors": "del Campillo Elena, Abdel-Aziz Amal, Crawford Damian, Patterson Sara E", "reference": { "type": "PubMed", "id": "15604746", "url": "https://pubmed.ncbi.nlm.nih.gov/15604746" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2V4L8-1", "protein_name": "Endoglucanase 3", "gene_name": "CEL5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C9H5-1", "protein_name": "Endoglucanase 9", "gene_name": "CEL3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q2V4L8", "url": "https://www.uniprot.org/uniprotkb/Q2V4L8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15604746", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The early responses of Arabidopsis thaliana cells to cadmium exposure explored by protein and metabolite profiling analyses.", "journal": "Proteomics", "date": "2006", "authors": "Sarry Jean-Emmanuel, Kuhn Lauriane, Ducruix C\u00e9line, Lafaye Alexandra, Junot Christophe, Hugouvieux V\u00e9ronique, Jourdain Agn\u00e8s, Bastien Olivier, Fievet Julie B, Vailhen Dominique, Amekraz Badia, Moulin Christophe, Ezan Eric, Garin J\u00e9r\u00f4me, Bourguignon Jacques", "reference": { "type": "PubMed", "id": "16502469", "url": "https://pubmed.ncbi.nlm.nih.gov/16502469" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52901-1", "protein_name": "Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial", "gene_name": "E1 ALPHA; E1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04151-1", "protein_name": "Calreticulin-1", "gene_name": "CRT1A; CRT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O23264-1", "protein_name": "Selenium-binding protein 1", "gene_name": "SBP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFA3-1", "protein_name": "Monodehydroascorbate reductase 1, peroxisomal", "gene_name": "MDAR1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XES1-1", "protein_name": "Calcium-transporting ATPase 4, endoplasmic reticulum-type", "gene_name": "ECA4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P52577-1", "protein_name": "Isoflavone reductase homolog P3", "gene_name": "F22H5.17", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P46309-1", "protein_name": "Glutamate--cysteine ligase, chloroplastic", "gene_name": "GSH1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42760-1", "protein_name": "Glutathione S-transferase F6", "gene_name": "GSTF6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q05431-1", "protein_name": "L-ascorbate peroxidase 1, cytosolic", "gene_name": "APX1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P92981-1", "protein_name": "5'-adenylylsulfate reductase 2, chloroplastic", "gene_name": "APR2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P92979-1", "protein_name": "5'-adenylylsulfate reductase 1, chloroplastic", "gene_name": "APR1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42547-1", "protein_name": "Catalase-3", "gene_name": "CAT3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SJQ9-1", "protein_name": "Fructose-bisphosphate aldolase 6, cytosolic", "gene_name": "FBA6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LV03-1", "protein_name": "Glutamate synthase 1 [NADH], chloroplastic", "gene_name": "GLT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M5K2-1", "protein_name": "Dihydrolipoyl dehydrogenase 2, mitochondrial", "gene_name": "LPD2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P52901", "url": "https://www.uniprot.org/uniprotkb/P52901" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16502469", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The mitochondrial pyruvate dehydrogenase complex: nucleotide and deduced amino-acid sequences of a cDNA encoding the Arabidopsis thaliana E1 alpha-subunit.", "journal": "Gene", "date": "1995", "authors": "Luethy M H, Miernyk J A, Randall D D", "reference": { "type": "PubMed", "id": "7590338", "url": "https://pubmed.ncbi.nlm.nih.gov/7590338" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52901-1", "protein_name": "Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial", "gene_name": "E1 ALPHA; E1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P52901", "url": "https://www.uniprot.org/uniprotkb/P52901" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7590338", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homologues of wheat ubiquitin-conjugating enzymes -- TaUBC1 and TaUBC4 are encoded by small multigene families in Arabidopsis thaliana.", "journal": "Plant Mol. Biol.", "date": "1994", "authors": "Sullivan M L, Carpenter T B, Vierstra R D", "reference": { "type": "PubMed", "id": "8155884", "url": "https://pubmed.ncbi.nlm.nih.gov/8155884" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42749-1", "protein_name": "Ubiquitin-conjugating enzyme E2 5", "gene_name": "UBC5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42750-1", "protein_name": "Ubiquitin-conjugating enzyme E2 6", "gene_name": "UBC6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42748-1", "protein_name": "Ubiquitin-conjugating enzyme E2 4", "gene_name": "UBC4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42745-1", "protein_name": "Ubiquitin-conjugating enzyme E2 2", "gene_name": "UBC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42746-1", "protein_name": "Ubiquitin-conjugating enzyme E2 3", "gene_name": "UBC3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P25865-1", "protein_name": "Ubiquitin-conjugating enzyme E2 1", "gene_name": "UBC1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P42749", "url": "https://www.uniprot.org/uniprotkb/P42749" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8155884", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Members of two gene families encoding ubiquitin-conjugating enzymes, AtUBC1-3 and AtUBC4-6, from Arabidopsis thaliana are differentially expressed.", "journal": "Plant Mol. Biol.", "date": "1996", "authors": "Thoma S, Sullivan M L, Vierstra R D", "reference": { "type": "PubMed", "id": "8790283", "url": "https://pubmed.ncbi.nlm.nih.gov/8790283" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42749-1", "protein_name": "Ubiquitin-conjugating enzyme E2 5", "gene_name": "UBC5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42750-1", "protein_name": "Ubiquitin-conjugating enzyme E2 6", "gene_name": "UBC6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42748-1", "protein_name": "Ubiquitin-conjugating enzyme E2 4", "gene_name": "UBC4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42745-1", "protein_name": "Ubiquitin-conjugating enzyme E2 2", "gene_name": "UBC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42746-1", "protein_name": "Ubiquitin-conjugating enzyme E2 3", "gene_name": "UBC3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P25865-1", "protein_name": "Ubiquitin-conjugating enzyme E2 1", "gene_name": "UBC1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P42749", "url": "https://www.uniprot.org/uniprotkb/P42749" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8790283", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis LAZY1 Family Plays a Key Role in Gravity Signaling within Statocytes and in Branch Angle Control of Roots and Shoots.", "journal": "The Plant cell", "date": "2017-08", "authors": "Taniguchi Masatoshi, Furutani Masahiko, Nishimura Takeshi, Nakamura Moritaka, Fushita Toyohito, Iijima Kohta, Baba Kenichiro, Tanaka Hirokazu, Toyota Masatsugu, Tasaka Masao, Morita Miyo Terao", "reference": { "type": "PubMed", "id": "28765510", "url": "https://pubmed.ncbi.nlm.nih.gov/28765510" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q58G53-1", "protein_name": "Protein LAZY 2", "gene_name": "DRO3; LAZY2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XVG3-1", "protein_name": "Protein LAZY 4", "gene_name": "DRO1; LAZY4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XV40-1", "protein_name": "Protein LAZY 1", "gene_name": "LAZY1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q58G53", "url": "https://www.uniprot.org/uniprotkb/Q58G53" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.28765510", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis thaliana expresses two functional isoforms of Arvp, a protein involved in the regulation of cellular lipid homeostasis.", "journal": "Biochimica et biophysica acta", "date": "2006-07", "authors": "For\u00e9s Oriol, Arr\u00f3 Montserrat, Pahissa Albert, Ferrero Sergi, Germann Melody, Stukey Joseph, McDonough Virginia, Nickels Joseph T, Campos Narciso, Ferrer Albert", "reference": { "type": "PubMed", "id": "16725371", "url": "https://pubmed.ncbi.nlm.nih.gov/16725371" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5MK24-1", "protein_name": "Protein ARV 1", "gene_name": "ARV1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5MK23-1", "protein_name": "Protein ARV 2", "gene_name": "ARV2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q5MK24", "url": "https://www.uniprot.org/uniprotkb/Q5MK24" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 1, "end_pos": 35, "sequence_org": "MAREKKTCVECGHKVKSLFIQYSPGNFRLMKCENC", "sequence_mut": "", "comment": "Normal ability to complement arv1-disrupted yeast.", "evidence": [ { "database": "UniProtKB", "id": "Q5MK23", "url": "https://www.uniprot.org/uniprotkb/Q5MK23" }, { "database": "PubMed", "id": "16725371", "url": "https://pubmed.ncbi.nlm.nih.gov/16725371" } ], "uniprot_canonical_ac": "Q5MK23-1" }, { "start_pos": 1, "end_pos": 46, "sequence_org": "MAREKKTCVECGHKVKSLFIQYSPGNFRLMKCENCEEVADEYVECE", "sequence_mut": "", "comment": "Impaired ability to complement arv1-disrupted yeast.", "evidence": [ { "database": "UniProtKB", "id": "Q5MK23", "url": "https://www.uniprot.org/uniprotkb/Q5MK23" }, { "database": "PubMed", "id": "16725371", "url": "https://pubmed.ncbi.nlm.nih.gov/16725371" } ], "uniprot_canonical_ac": "Q5MK23-1" }, { "start_pos": 1, "end_pos": 56, "sequence_org": "MAREKKTCVECGHKVKSLFIQYSPGNFRLMKCENCEEVADEYVECELLIIFIDLIL", "sequence_mut": "", "comment": "Impaired ability to complement arv1-disrupted yeast.", "evidence": [ { "database": "UniProtKB", "id": "Q5MK23", "url": "https://www.uniprot.org/uniprotkb/Q5MK23" }, { "database": "PubMed", "id": "16725371", "url": "https://pubmed.ncbi.nlm.nih.gov/16725371" } ], "uniprot_canonical_ac": "Q5MK23-1" }, { "start_pos": 1, "end_pos": 68, "sequence_org": "MAREKKTCVECGHKVKSLFIQYSPGNFRLMKCENCEEVADEYVECELLIIFIDLILHKTKAYRHLLYN", "sequence_mut": "", "comment": "Impaired ability to complement arv1-disrupted yeast.", "evidence": [ { "database": "UniProtKB", "id": "Q5MK23", "url": "https://www.uniprot.org/uniprotkb/Q5MK23" }, { "database": "PubMed", "id": "16725371", "url": "https://pubmed.ncbi.nlm.nih.gov/16725371" } ], "uniprot_canonical_ac": "Q5MK23-1" } ], "record_id": "pubmed.16725371", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis PAI gene arrangements, cytosine methylation and expression.", "journal": "Genetics", "date": "1999", "authors": "Melquist S, Luff B, Bender J", "reference": { "type": "PubMed", "id": "10471722", "url": "https://pubmed.ncbi.nlm.nih.gov/10471722" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q42440-1", "protein_name": "N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic", "gene_name": "PAI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q42440", "url": "https://www.uniprot.org/uniprotkb/Q42440" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10471722", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential expression of triplicate phosphoribosylanthranilate isomerase isogenes in the tryptophan biosynthetic pathway of Arabidopsis thaliana (L.) Heynh.", "journal": "Planta", "date": "2001", "authors": "He Y, Li J", "reference": { "type": "PubMed", "id": "11346937", "url": "https://pubmed.ncbi.nlm.nih.gov/11346937" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q42440-1", "protein_name": "N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic", "gene_name": "PAI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42527-1", "protein_name": "N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic", "gene_name": "PAI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q42440", "url": "https://www.uniprot.org/uniprotkb/Q42440" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11346937", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis phosphoribosylanthranilate isomerase: molecular genetic analysis of triplicate tryptophan pathway genes.", "journal": "The Plant cell", "date": "1995-04", "authors": "Li J, Zhao J, Rose A B, Schmidt R, Last R L", "reference": { "type": "PubMed", "id": "7773017", "url": "https://pubmed.ncbi.nlm.nih.gov/7773017" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q42440-1", "protein_name": "N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic", "gene_name": "PAI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LPI9-1", "protein_name": "N-(5'-phosphoribosyl)anthranilate isomerase 3, chloroplastic", "gene_name": "PAI3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42527-1", "protein_name": "N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic", "gene_name": "PAI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q42440", "url": "https://www.uniprot.org/uniprotkb/Q42440" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7773017", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epigenetic control of an endogenous gene family is revealed by a novel blue fluorescent mutant of Arabidopsis.", "journal": "Cell", "date": "1995", "authors": "Bender J, Fink G R", "reference": { "type": "PubMed", "id": "8521489", "url": "https://pubmed.ncbi.nlm.nih.gov/8521489" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q42440-1", "protein_name": "N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic", "gene_name": "PAI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q42440", "url": "https://www.uniprot.org/uniprotkb/Q42440" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8521489", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel phosphatase family, structurally related to dual-specificity phosphatases, that displays unique amino acid sequence and substrate specificity.", "journal": "Journal of molecular biology", "date": "2007-12-07", "authors": "Rom\u00e1-Mateo Carlos, R\u00edos Pablo, Tabernero Lydia, Attwood Teresa K, Pulido Rafael", "reference": { "type": "PubMed", "id": "17976645", "url": "https://pubmed.ncbi.nlm.nih.gov/17976645" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9ZVN4-1", "protein_name": "Inositol diphosphatase DSP1", "gene_name": "DSP1; PFA-DSP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q681Z2-1", "protein_name": "Inositol diphosphatase DSP3", "gene_name": "DSP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84MD6-1", "protein_name": "Inositol diphosphatase DSP2", "gene_name": "DSP2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 117, "end_pos": 117, "sequence_org": "E", "sequence_mut": "A", "comment": "Reduces phosphatase activity toward para-nitrophenyl phosphate 2-fold.", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "17976645", "url": "https://pubmed.ncbi.nlm.nih.gov/17976645" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 191, "end_pos": 191, "sequence_org": "D", "sequence_mut": "A", "comment": "Strongly reduces activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "17976645", "url": "https://pubmed.ncbi.nlm.nih.gov/17976645" } ], "uniprot_canonical_ac": "Q9ZVN4-1" } ], "record_id": "pubmed.17976645", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and functional characterization of a novel phosphatase from the Arabidopsis thaliana gene locus At1g05000.", "journal": "Proteins", "date": "2008-10", "authors": "Aceti David J, Bitto Eduard, Yakunin Alexander F, Proudfoot Michael, Bingman Craig A, Frederick Ronnie O, Sreenath Hassan K, Vojtik Frank C, Wrobel Russell L, Fox Brian G, Markley John L, Phillips George N", "reference": { "type": "PubMed", "id": "18433060", "url": "https://pubmed.ncbi.nlm.nih.gov/18433060" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9ZVN4-1", "protein_name": "Inositol diphosphatase DSP1", "gene_name": "DSP1; PFA-DSP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18433060", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phylogenetic and genetic linkage between novel atypical dual-specificity phosphatases from non-metazoan organisms.", "journal": "Molecular genetics and genomics : MGG", "date": "2011-04", "authors": "Rom\u00e1-Mateo Carlos, Sacrist\u00e1n-Reviriego Almudena, Beresford Nicola J, Caparr\u00f3s-Mart\u00edn Jos\u00e9 Antonio, Culi\u00e1\u00f1ez-Maci\u00e0 Francisco A, Mart\u00edn Humberto, Molina Mar\u00eda, Tabernero Lydia, Pulido Rafael", "reference": { "type": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9ZVN4-1", "protein_name": "Inositol diphosphatase DSP1", "gene_name": "DSP1; PFA-DSP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q681Z2-1", "protein_name": "Inositol diphosphatase DSP3", "gene_name": "DSP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P53965-1", "protein_name": "Inositol diphosphatase SIW14", "gene_name": "SIW14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q940L5-1", "protein_name": "Inositol diphosphatase DSP4", "gene_name": "DSP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFD7-1", "protein_name": "Inositol diphosphatase DSP5", "gene_name": "DSP5; PFA-DSP5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84MD6-1", "protein_name": "Inositol diphosphatase DSP2", "gene_name": "DSP2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 150, "end_pos": 150, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" }, { "database": "PubMed", "id": "35640071", "url": "https://pubmed.ncbi.nlm.nih.gov/35640071" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "H", "sequence_mut": "D", "comment": "Abolishes phosphatase activity toward the phosphoinositides PI(3,4,5)P3 and PI(3,5)P2; reduces phosphatase activity toward para-nitrophenyl phosphate and O-methylfluorescein phosphate. Strongly reduces activity against 5-InsP(7).", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "H", "sequence_mut": "E", "comment": "Abolishes phosphatase activity toward the phosphoinositides PI(3,4,5)P3 and PI(3,5)P2; reduces phosphatase activity toward para-nitrophenyl phosphate and O-methylfluorescein phosphate. Strongly reduces activity against 5-InsP(7).", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "H", "sequence_mut": "G", "comment": "Abolishes phosphatase activity toward the phosphoinositides PI(3,4,5)P3 and PI(3,5)P2; reduces phosphatase activity toward para-nitrophenyl phosphate and O-methylfluorescein phosphate. Strongly reduces activity against 5-InsP(7).", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "H", "sequence_mut": "L", "comment": "Abolishes phosphatase activity toward the phosphoinositides PI(3,4,5)P3 and PI(3,5)P2; reduces phosphatase activity toward para-nitrophenyl phosphate and O-methylfluorescein phosphate. Strongly reduces activity against 5-InsP(7).", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "H", "sequence_mut": "S", "comment": "Abolishes phosphatase activity toward the phosphoinositides PI(3,4,5)P3 and PI(3,5)P2; reduces phosphatase activity toward para-nitrophenyl phosphate and O-methylfluorescein phosphate. Strongly reduces activity against 5-InsP(7).", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" } ], "uniprot_canonical_ac": "Q9ZVN4-1" } ], "record_id": "pubmed.21409566", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A structural expos\u00e9 of noncanonical molecular reactivity within the protein tyrosine phosphatase WPD loop.", "journal": "Nature communications", "date": "2022-04-25", "authors": "Wang Huanchen, Perera Lalith, Jork Nikolaus, Zong Guangning, Riley Andrew M, Potter Barry V L, Jessen Henning J, Shears Stephen B", "reference": { "type": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9ZVN4-1", "protein_name": "Inositol diphosphatase DSP1", "gene_name": "DSP1; PFA-DSP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 150, "end_pos": 150, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" }, { "database": "PubMed", "id": "35640071", "url": "https://pubmed.ncbi.nlm.nih.gov/35640071" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "H", "sequence_mut": "D", "comment": "Abolishes phosphatase activity toward the phosphoinositides PI(3,4,5)P3 and PI(3,5)P2; reduces phosphatase activity toward para-nitrophenyl phosphate and O-methylfluorescein phosphate. Strongly reduces activity against 5-InsP(7).", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "H", "sequence_mut": "E", "comment": "Abolishes phosphatase activity toward the phosphoinositides PI(3,4,5)P3 and PI(3,5)P2; reduces phosphatase activity toward para-nitrophenyl phosphate and O-methylfluorescein phosphate. Strongly reduces activity against 5-InsP(7).", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "H", "sequence_mut": "G", "comment": "Abolishes phosphatase activity toward the phosphoinositides PI(3,4,5)P3 and PI(3,5)P2; reduces phosphatase activity toward para-nitrophenyl phosphate and O-methylfluorescein phosphate. Strongly reduces activity against 5-InsP(7).", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "H", "sequence_mut": "L", "comment": "Abolishes phosphatase activity toward the phosphoinositides PI(3,4,5)P3 and PI(3,5)P2; reduces phosphatase activity toward para-nitrophenyl phosphate and O-methylfluorescein phosphate. Strongly reduces activity against 5-InsP(7).", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "H", "sequence_mut": "S", "comment": "Abolishes phosphatase activity toward the phosphoinositides PI(3,4,5)P3 and PI(3,5)P2; reduces phosphatase activity toward para-nitrophenyl phosphate and O-methylfluorescein phosphate. Strongly reduces activity against 5-InsP(7).", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 157, "end_pos": 157, "sequence_org": "T", "sequence_mut": "A", "comment": "Strongly reduces activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 191, "end_pos": 191, "sequence_org": "D", "sequence_mut": "A", "comment": "Strongly reduces activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "17976645", "url": "https://pubmed.ncbi.nlm.nih.gov/17976645" } ], "uniprot_canonical_ac": "Q9ZVN4-1" } ], "record_id": "pubmed.35468885", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis PFA-DSP-Type Phosphohydrolases Target Specific Inositol Pyrophosphate Messengers.", "journal": "Biochemistry", "date": "2022-06-21", "authors": "Gaugler Philipp, Schneider Robin, Liu Guizhen, Qiu Danye, Weber Jonathan, Schmid Jochen, Jork Nikolaus, H\u00e4ner Markus, Ritter Kevin, Fern\u00e1ndez-Rebollo Nicol\u00e1s, Giehl Ricardo F H, Trung Minh Nguyen, Yadav Ranjana, Fiedler Dorothea, Gaugler Verena, Jessen Henning J, Schaaf Gabriel, Laha Debabrata", "reference": { "type": "PubMed", "id": "35640071", "url": "https://pubmed.ncbi.nlm.nih.gov/35640071" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9ZVN4-1", "protein_name": "Inositol diphosphatase DSP1", "gene_name": "DSP1; PFA-DSP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q681Z2-1", "protein_name": "Inositol diphosphatase DSP3", "gene_name": "DSP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P53965-1", "protein_name": "Inositol diphosphatase SIW14", "gene_name": "SIW14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12494-1", "protein_name": "Inositol hexakisphosphate kinase 1", "gene_name": "KCS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q940L5-1", "protein_name": "Inositol diphosphatase DSP4", "gene_name": "DSP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFD7-1", "protein_name": "Inositol diphosphatase DSP5", "gene_name": "DSP5; PFA-DSP5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84MD6-1", "protein_name": "Inositol diphosphatase DSP2", "gene_name": "DSP2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 150, "end_pos": 150, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVN4", "url": "https://www.uniprot.org/uniprotkb/Q9ZVN4" }, { "database": "PubMed", "id": "35468885", "url": "https://pubmed.ncbi.nlm.nih.gov/35468885" }, { "database": "PubMed", "id": "21409566", "url": "https://pubmed.ncbi.nlm.nih.gov/21409566" }, { "database": "PubMed", "id": "35640071", "url": "https://pubmed.ncbi.nlm.nih.gov/35640071" } ], "uniprot_canonical_ac": "Q9ZVN4-1" }, { "start_pos": 214, "end_pos": 214, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes catalytic activity. Sensitive to wortmannin.", "evidence": [ { "database": "UniProtKB", "id": "P53965", "url": "https://www.uniprot.org/uniprotkb/P53965" }, { "database": "PubMed", "id": "29540476", "url": "https://pubmed.ncbi.nlm.nih.gov/29540476" }, { "database": "PubMed", "id": "26828065", "url": "https://pubmed.ncbi.nlm.nih.gov/26828065" }, { "database": "PubMed", "id": "35640071", "url": "https://pubmed.ncbi.nlm.nih.gov/35640071" } ], "uniprot_canonical_ac": "P53965-1" } ], "record_id": "pubmed.35640071", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inflorescence-specific expression of AtK-1, a novel Arabidopsis thaliana homologue of shaggy/glycogen synthase kinase-3.", "journal": "Plant Mol. Biol.", "date": "1995", "authors": "Jonak C, Heberle-Bors E, Hirt H", "reference": { "type": "PubMed", "id": "7865793", "url": "https://pubmed.ncbi.nlm.nih.gov/7865793" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q39019-1", "protein_name": "Shaggy-related protein kinase kappa", "gene_name": "ASK10; SK41", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q39019", "url": "https://www.uniprot.org/uniprotkb/Q39019" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7865793", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of genes required for embryo development in Arabidopsis.", "journal": "Plant physiology", "date": "2004-07", "authors": "Tzafrir Iris, Pena-Muralla Rosanna, Dickerman Allan, Berg Michael, Rogers Rebecca, Hutchens Steven, Sweeney T Colleen, McElver John, Aux George, Patton David, Meinke David", "reference": { "type": "PubMed", "id": "15266054", "url": "https://pubmed.ncbi.nlm.nih.gov/15266054" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4V399-1", "protein_name": "Small ribosomal subunit biogenesis GTPase RsgA 1, mitochondrial", "gene_name": "EMB1688; rsgA", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6AWV1-1", "protein_name": "Probable ribonuclease P/MRP protein subunit POP5", "gene_name": "EMB1687", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LM50-1", "protein_name": "UPF0725 protein EMB2204", "gene_name": "EMB2204", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IHL3-1", "protein_name": "Transcription termination factor MTERF2, chloroplastic", "gene_name": "EMB2219; MTERF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80990-1", "protein_name": "Protein CIA1", "gene_name": "CIA1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VZM1-1", "protein_name": "N-terminal acetyltransferase A complex auxiliary subunit NAA15", "gene_name": "NAA15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8RWD7-1", "protein_name": "Protein EMBRYO DEFECTIVE 1674", "gene_name": "EMB1674", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93YU2-1", "protein_name": "Protein root UVB sensitive 6", "gene_name": "RUS6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LPR8-1", "protein_name": "Protein TIC 100", "gene_name": "EMB1211; TIC100", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8RVL2-1", "protein_name": "Calpain-type cysteine protease DEK1", "gene_name": "DEK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VY00-1", "protein_name": "Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1", "gene_name": "ESP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L7S8-1", "protein_name": "DEAD-box ATP-dependent RNA helicase 3, chloroplastic", "gene_name": "EMB1138; RH3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84W56-1", "protein_name": "Ribonuclease J", "gene_name": "RNJ", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84WW2-1", "protein_name": "6-phosphogluconolactonase 3, chloroplastic", "gene_name": "PGL3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L3P4-1", "protein_name": "Protein THALLO", "gene_name": "THAL", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L5Y0-1", "protein_name": "Vacuolar sorting protein 39", "gene_name": "VPS39", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8S4Y1-1", "protein_name": "Acetyl-CoA acetyltransferase 2", "gene_name": "ACCT2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O23255-1", "protein_name": "Adenosylhomocysteinase 1", "gene_name": "HOG1; SAHH1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O82486-1", "protein_name": "N(6)-adenosine-methyltransferase MT-A70-like", "gene_name": "MTA", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94AI4-1", "protein_name": "N6-adenosine-methyltransferase non-catalytic subunit MTB", "gene_name": "MTB", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q3MV14-1", "protein_name": "Protein DECREASED SIZE EXCLUSION LIMIT 1", "gene_name": "DSE1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A0A1P8ASY1-1", "protein_name": "DNA replication ATP-dependent helicase/nuclease JHS1", "gene_name": "EMB2411; JHS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IS91-1", "protein_name": "Protein SHORT ROOT IN SALT MEDIUM 1", "gene_name": "RSA1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4ISL7-1", "protein_name": "Protein TIC236, chloroplastic", "gene_name": "EMB2410; TIC236", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A5HEI1-1", "protein_name": "Sister chromatid cohesion protein SCC2", "gene_name": "SCC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4I1T7-1", "protein_name": "Nuclear pore complex protein NUP214", "gene_name": "NUP214", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IF36-1", "protein_name": "Protein FORGETTER 1", "gene_name": "FGT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IMH3-1", "protein_name": "Protein NUCLEOLAR COMPLEX ASSOCIATED 4", "gene_name": "NOC4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4J8G7-1", "protein_name": "Protein virilizer homolog", "gene_name": "VIR", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JTS8-1", "protein_name": "Protein NO VEIN", "gene_name": "NOV", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LVW6-1", "protein_name": "Protein THYLAKOID ASSEMBLY 8, chloroplastic", "gene_name": "THA8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SAA9-1", "protein_name": "Sterol 14-demethylase", "gene_name": "CYP51G1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SAU2-1", "protein_name": "Ribulose-5-phosphate-3-epimerase, chloroplastic", "gene_name": "RPE", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SYP1-1", "protein_name": "DExH-box ATP-dependent RNA helicase DExH12", "gene_name": "BRR2A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SZD6-1", "protein_name": "Polyprotein of EF-Ts, chloroplastic", "gene_name": "PETs", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q4V399", "url": "https://www.uniprot.org/uniprotkb/Q4V399" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15266054", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The nuclease FAN1 is involved in DNA crosslink repair in Arabidopsis thaliana independently of the nuclease MUS81.", "journal": "Nucleic acids research", "date": "2015-04-20", "authors": "Herrmann Natalie J, Knoll Alexander, Puchta Holger", "reference": { "type": "PubMed", "id": "25779053", "url": "https://pubmed.ncbi.nlm.nih.gov/25779053" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5XVJ4-1", "protein_name": "Fanconi-associated nuclease 1 homolog", "gene_name": "FAN1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q5XVJ4", "url": "https://www.uniprot.org/uniprotkb/Q5XVJ4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.25779053", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis hapless mutations define essential gametophytic functions.", "journal": "Genetics", "date": "2004", "authors": "Johnson Mark A, von Besser Kiera, Zhou Qing, Smith Evadne, Aux George, Patton David, Levin Joshua Z, Preuss Daphne", "reference": { "type": "PubMed", "id": "15514068", "url": "https://pubmed.ncbi.nlm.nih.gov/15514068" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2UVJ5-1", "protein_name": "Cation-chloride cotransporter 1", "gene_name": "CCC1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22715-1", "protein_name": "AP-1 complex subunit mu-2", "gene_name": "AP1M2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93Z16-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2", "gene_name": "HAP6; RPN2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LNU4-1", "protein_name": "26S proteasome non-ATPase regulatory subunit 3 homolog A", "gene_name": "RPN3A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JP36-1", "protein_name": "Protein HAPLESS 2", "gene_name": "HAP2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q2UVJ5", "url": "https://www.uniprot.org/uniprotkb/Q2UVJ5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15514068", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and functional characterization of cation-chloride cotransporters in plants.", "journal": "The Plant journal : for cell and molecular biology", "date": "2007-04", "authors": "Colmenero-Flores Jos\u00e9 M, Mart\u00ednez Germ\u00e1n, Gamba Gerardo, V\u00e1zquez Norma, Iglesias Domingo J, Brum\u00f3s Javier, Tal\u00f3n Manuel", "reference": { "type": "PubMed", "id": "17355435", "url": "https://pubmed.ncbi.nlm.nih.gov/17355435" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2UVJ5-1", "protein_name": "Cation-chloride cotransporter 1", "gene_name": "CCC1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q2UVJ5", "url": "https://www.uniprot.org/uniprotkb/Q2UVJ5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17355435", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.", "journal": "Plant physiology", "date": "2009-04", "authors": "Adamczyk Benjamin J, Fernandez Donna E", "reference": { "type": "PubMed", "id": "19211705", "url": "https://pubmed.ncbi.nlm.nih.gov/19211705" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PFA4-1", "protein_name": "Agamous-like MADS-box protein AGL30", "gene_name": "AGL30", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q7X9I0-1", "protein_name": "Agamous-like MADS-box protein AGL65", "gene_name": "AGL65", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LM46-1", "protein_name": "Agamous-like MADS-box protein AGL104", "gene_name": "AGL104", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q1PFC2-1", "protein_name": "Agamous-like MADS-box protein AGL66", "gene_name": "AGL66", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PFA4", "url": "https://www.uniprot.org/uniprotkb/Q1PFA4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19211705", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of the guanylate kinase homologues AGK-1 and AGK-2 from Arabidopsis thaliana and characterization of AGK-1.", "journal": "European journal of biochemistry", "date": "2000-01", "authors": "Kumar V, Spangenberg O, Konrad M", "reference": { "type": "PubMed", "id": "10632732", "url": "https://pubmed.ncbi.nlm.nih.gov/10632732" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P93757-1", "protein_name": "Guanylate kinase 1", "gene_name": "GK-1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M682-1", "protein_name": "Guanylate kinase 2", "gene_name": "AGK2; GK-2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P93757", "url": "https://www.uniprot.org/uniprotkb/P93757" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10632732", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The rice nuclear gene, VIRESCENT 2, is essential for chloroplast development and encodes a novel type of guanylate kinase targeted to plastids and mitochondria.", "journal": "The Plant journal : for cell and molecular biology", "date": "2007-11", "authors": "Sugimoto Hiroki, Kusumi Kensuke, Noguchi Ko, Yano Masahiro, Yoshimura Atsushi, Iba Koh", "reference": { "type": "PubMed", "id": "17727616", "url": "https://pubmed.ncbi.nlm.nih.gov/17727616" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P93757-1", "protein_name": "Guanylate kinase 1", "gene_name": "GK-1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94JM2-1", "protein_name": "Guanylate kinase 3, chloroplastic", "gene_name": "GK3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M682-1", "protein_name": "Guanylate kinase 2", "gene_name": "AGK2; GK-2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P93757", "url": "https://www.uniprot.org/uniprotkb/P93757" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17727616", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]