[ { "title": "Phosphoprotein network analysis of white adipose tissues unveils deregulated pathways in response to high-fat diet.", "journal": "Scientific reports", "date": "2016", "authors": "Shaik AA, Qiu B, Wee S, Choi H, Gunaratne J, Tergaonkar V", "reference": { "type": "PubMed", "id": "27180971", "url": "https://pubmed.ncbi.nlm.nih.gov/27180971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9QXG4-1", "protein_name": "Acetyl-coenzyme A synthetase, cytoplasmic", "gene_name": "Acss2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9QXG4", "url": "https://www.uniprot.org/uniprotkb/Q9QXG4" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 263, "end_pos": 263, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9QXG4", "url": "https://www.uniprot.org/uniprotkb/Q9QXG4" }, { "database": "PubMed", "id": "21183079", "url": "https://pubmed.ncbi.nlm.nih.gov/21183079" }, { "database": "PubMed", "id": "17242355", "url": "https://pubmed.ncbi.nlm.nih.gov/17242355" }, { "database": "iPTMnet", "id": "Q9QXG4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QXG4" }, { "database": "PubMed", "id": "27180971", "url": "https://pubmed.ncbi.nlm.nih.gov/27180971" } ], "site_lbl": "Ser263", "uniprot_canonical_ac": "Q9QXG4-1" } ], "record_id": "pubmed.27180971", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Acetyl-CoA synthetase regulates histone acetylation and hippocampal memory.", "journal": "Nature", "date": "2017", "authors": "Mews P, Donahue G, Drake AM, Luczak V, Abel T, Berger SL", "reference": { "type": "PubMed", "id": "28562591", "url": "https://pubmed.ncbi.nlm.nih.gov/28562591" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9QXG4-1", "protein_name": "Acetyl-coenzyme A synthetase, cytoplasmic", "gene_name": "Acss2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9QXG4", "url": "https://www.uniprot.org/uniprotkb/Q9QXG4" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.28562591", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A point mutation in the gene for asparagine-linked glycosylation 10B (Alg10b) causes nonsyndromic hearing impairment in mice (Mus musculus).", "journal": "PloS one", "date": "2013", "authors": "Probst FJ, Corrigan RR, Del Gaudio D, Salinger AP, Lorenzo I, Gao SS, Chiu I, Xia A, Oghalai JS, Justice MJ", "reference": { "type": "PubMed", "id": "24303013", "url": "https://pubmed.ncbi.nlm.nih.gov/24303013" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UGP8-1", "protein_name": "Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase", "gene_name": "Alg10b; Alg10", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UGP8", "url": "https://www.uniprot.org/uniprotkb/Q3UGP8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 389, "end_pos": 389, "sequence_org": "L", "sequence_mut": "S", "comment": "Significant hearing impairment, associated with loss or degeneration of cochlear outer hair cells.", "evidence": [ { "database": "UniProtKB", "id": "Q3UGP8", "url": "https://www.uniprot.org/uniprotkb/Q3UGP8" }, { "database": "PubMed", "id": "24303013", "url": "https://pubmed.ncbi.nlm.nih.gov/24303013" } ], "uniprot_canonical_ac": "Q3UGP8-1" } ], "record_id": "pubmed.24303013", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The natriuretic peptide clearance receptor locally modulates the physiological effects of the natriuretic peptide system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999-06-22", "authors": "Matsukawa N, Grzesik W J, Takahashi N, Pandey K N, Pang S, Yamauchi M, Smithies O", "reference": { "type": "PubMed", "id": "10377427", "url": "https://pubmed.ncbi.nlm.nih.gov/10377427" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70180-1", "protein_name": "Atrial natriuretic peptide receptor 3", "gene_name": "Npr3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P70180", "url": "https://www.uniprot.org/uniprotkb/P70180" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.10377427", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three new allelic mouse mutations that cause skeletal overgrowth involve the natriuretic peptide receptor C gene (Npr3).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Jaubert J, Jaubert F, Martin N, Washburn LL, Lee BK, Eicher EM, Guenet JL", "reference": { "type": "PubMed", "id": "10468599", "url": "https://pubmed.ncbi.nlm.nih.gov/10468599" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70180-1", "protein_name": "Atrial natriuretic peptide receptor 3", "gene_name": "Npr3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P70180", "url": "https://www.uniprot.org/uniprotkb/P70180" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.10468599", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Competitive binding of musclin to natriuretic peptide receptor 3 with atrial natriuretic peptide.", "journal": "The Journal of endocrinology", "date": "2009-05", "authors": "Kita Shunbun, Nishizawa Hitoshi, Okuno Yosuke, Tanaka Masaki, Yasui Atsutaka, Matsuda Morihiro, Yamada Yukio, Shimomura Iichiro", "reference": { "type": "PubMed", "id": "19244276", "url": "https://pubmed.ncbi.nlm.nih.gov/19244276" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70180-1", "protein_name": "Atrial natriuretic peptide receptor 3", "gene_name": "Npr3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P70180", "url": "https://www.uniprot.org/uniprotkb/P70180" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.19244276", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the 5'-flanking regulatory region of the mouse gene encoding the clearance receptor for atrial natriuretic peptide.", "journal": "Eur. J. Biochem.", "date": "1996", "authors": "Yanaka N, Kotera J, Taguchi I, Sugiura M, Kawashima K, Omori K", "reference": { "type": "PubMed", "id": "8620881", "url": "https://pubmed.ncbi.nlm.nih.gov/8620881" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70180-1", "protein_name": "Atrial natriuretic peptide receptor 3", "gene_name": "Npr3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P70180", "url": "https://www.uniprot.org/uniprotkb/P70180" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.8620881", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E2a-Pbx1 induces aberrant expression of tissue-specific and developmentally regulated genes when expressed in NIH 3T3 fibroblasts.", "journal": "Mol. Cell. Biol.", "date": "1997", "authors": "Fu X, Kamps MP", "reference": { "type": "PubMed", "id": "9032278", "url": "https://pubmed.ncbi.nlm.nih.gov/9032278" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70180-1", "protein_name": "Atrial natriuretic peptide receptor 3", "gene_name": "Npr3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P97807-1", "protein_name": "Fumarate hydratase, mitochondrial", "gene_name": "Fh1; Fh", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P97805-1", "protein_name": "Protein FAM3D", "gene_name": "Fam3d", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P97802-1", "protein_name": "Angiogenin-3", "gene_name": "Ang3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q91YD6-1", "protein_name": "Villin-like protein", "gene_name": "Vill", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P97808-1", "protein_name": "FXYD domain-containing ion transport regulator 5", "gene_name": "Fxyd5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O35718-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "Socs3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P70180", "url": "https://www.uniprot.org/uniprotkb/P70180" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.9032278", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of TMEM16 paralogs during murine embryogenesis.", "journal": "Dev. Dyn.", "date": "2008", "authors": "Rock JR, Harfe BD", "reference": { "type": "PubMed", "id": "18729231", "url": "https://pubmed.ncbi.nlm.nih.gov/18729231" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BHY3-1", "protein_name": "Anoctamin-1", "gene_name": "Ano1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6PB70-1", "protein_name": "Anoctamin-8", "gene_name": "Ano8", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "A2AHL1-1", "protein_name": "Anoctamin-3", "gene_name": "Ano3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P86044-1", "protein_name": "Anoctamin-9", "gene_name": "Ano9", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BH79-1", "protein_name": "Anoctamin-10", "gene_name": "Ano10", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8CFW1-1", "protein_name": "Anoctamin-2", "gene_name": "Ano2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.18729231", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression patterns of the Tmem16 gene family during cephalic development in the mouse.", "journal": "Gene expression patterns : GEP", "date": "2009", "authors": "Gritli-Linde A, Vaziri Sani F, Rock JR, Hallberg K, Iribarne D, Harfe BD, Linde A", "reference": { "type": "PubMed", "id": "19059364", "url": "https://pubmed.ncbi.nlm.nih.gov/19059364" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6PB70-1", "protein_name": "Anoctamin-8", "gene_name": "Ano8", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "A2AHL1-1", "protein_name": "Anoctamin-3", "gene_name": "Ano3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BH79-1", "protein_name": "Anoctamin-10", "gene_name": "Ano10", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.19059364", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inactivation of anoctamin-6/Tmem16f, a regulator of phosphatidylserine scrambling in osteoblasts, leads to decreased mineral deposition in skeletal tissues.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2013-02", "authors": "Ehlen Harald W A, Chinenkova Milana, Moser Markus, Munter Hans-Markus, Krause Yvonne, Gross Stefanie, Brachvogel Bent, Wuelling Manuela, Kornak Uwe, Vortkamp Andrea", "reference": { "type": "PubMed", "id": "22936354", "url": "https://pubmed.ncbi.nlm.nih.gov/22936354" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.22936354", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Calcium-dependent phospholipid scramblase activity of TMEM16 protein family members.", "journal": "The Journal of biological chemistry", "date": "2013-05-10", "authors": "Suzuki Jun, Fujii Toshihiro, Imao Takeshi, Ishihara Kenji, Kuba Hiroshi, Nagata Shigekazu", "reference": { "type": "PubMed", "id": "23532839", "url": "https://pubmed.ncbi.nlm.nih.gov/23532839" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q14AT5-1", "protein_name": "Anoctamin-7", "gene_name": "Ano7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8C5H1-1", "protein_name": "Anoctamin-4", "gene_name": "Ano4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "A2AHL1-1", "protein_name": "Anoctamin-3", "gene_name": "Ano3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P86044-1", "protein_name": "Anoctamin-9", "gene_name": "Ano9", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.23532839", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cryo-EM structures and functional characterization of the murine lipid scramblase TMEM16F.", "journal": "eLife", "date": "2019", "authors": "Alvadia C, Lim NK, Clerico Mosina V, Oostergetel GT, Dutzler R, Paulino C", "reference": { "type": "PubMed", "id": "30785399", "url": "https://pubmed.ncbi.nlm.nih.gov/30785399" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 370, "end_pos": 370, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on lipid scramblase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "30785399", "url": "https://pubmed.ncbi.nlm.nih.gov/30785399" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 478, "end_pos": 478, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreased lipid scramblase and ion channel activity. Requires lower calcium levels for activation of ion channel activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "30785399", "url": "https://pubmed.ncbi.nlm.nih.gov/30785399" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 559, "end_pos": 559, "sequence_org": "Q", "sequence_mut": "K", "comment": "Moderately decreased sensitivity to activation by calcium.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "30785399", "url": "https://pubmed.ncbi.nlm.nih.gov/30785399" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 563, "end_pos": 563, "sequence_org": "Y", "sequence_mut": "S", "comment": "No effect on lipid scramblase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "30785399", "url": "https://pubmed.ncbi.nlm.nih.gov/30785399" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 615, "end_pos": 615, "sequence_org": "G", "sequence_mut": "A", "comment": "Requires lower calcium levels for activation of scramblase and ion channel activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "30785399", "url": "https://pubmed.ncbi.nlm.nih.gov/30785399" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 623, "end_pos": 623, "sequence_org": "Q", "sequence_mut": "F", "comment": "No effect on lipid scramblase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "30785399", "url": "https://pubmed.ncbi.nlm.nih.gov/30785399" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 624, "end_pos": 624, "sequence_org": "E", "sequence_mut": "Q", "comment": "Expected to disrupt calcium binding. Loss of scramblase and ion channel activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "30785399", "url": "https://pubmed.ncbi.nlm.nih.gov/30785399" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 667, "end_pos": 667, "sequence_org": "E", "sequence_mut": "Q", "comment": "Requires much higher calcium levels for the activation of scramblase and ion channel activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "23021219", "url": "https://pubmed.ncbi.nlm.nih.gov/23021219" }, { "database": "PubMed", "id": "30785399", "url": "https://pubmed.ncbi.nlm.nih.gov/30785399" } ], "uniprot_canonical_ac": "Q6P9J9-1" } ], "record_id": "pubmed.30785399", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An inner activation gate controls TMEM16F phospholipid scrambling.", "journal": "Nature communications", "date": "2019", "authors": "Le T, Jia Z, Le SC, Zhang Y, Chen J, Yang H", "reference": { "type": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 409, "end_pos": 409, "sequence_org": "D", "sequence_mut": "G", "comment": "Increased speed of phospholipid scrambling.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 518, "end_pos": 518, "sequence_org": "F", "sequence_mut": "A", "comment": "Increased speed of phospholipid scrambling. Constitutive scramblase activity at basal cytosolic calcium levels; when associated with A-563 and A-612.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 518, "end_pos": 518, "sequence_org": "F", "sequence_mut": "E", "comment": "Constitutive phospholipid scramblase activity at basal cytosolic calcium levels.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 518, "end_pos": 518, "sequence_org": "F", "sequence_mut": "K", "comment": "Constitutive phospholipid scramblase activity at basal cytosolic calcium levels.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 518, "end_pos": 518, "sequence_org": "F", "sequence_mut": "L", "comment": "Decreased lipid scramblase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 518, "end_pos": 518, "sequence_org": "F", "sequence_mut": "Q", "comment": "Constitutive phospholipid scramblase activity at basal cytosolic calcium levels.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 518, "end_pos": 518, "sequence_org": "F", "sequence_mut": "W", "comment": "Slightly increased lipid scramblase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 563, "end_pos": 563, "sequence_org": "Y", "sequence_mut": "A", "comment": "Increased speed of phospholipid scrambling. Requires lower calcium levels for activation of scramblase and ion channel activity. Constitutive scramblase activity at basal cytosolic calcium levels; when associated with A-518 and A-612.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 563, "end_pos": 563, "sequence_org": "Y", "sequence_mut": "K", "comment": "Constitutive phospholipid scramblase activity at basal cytosolic calcium levels.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 563, "end_pos": 563, "sequence_org": "Y", "sequence_mut": "Q", "comment": "Constitutive phospholipid scramblase activity at basal cytosolic calcium levels.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 563, "end_pos": 563, "sequence_org": "Y", "sequence_mut": "W", "comment": "Loss of lipid scramblase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 612, "end_pos": 612, "sequence_org": "I", "sequence_mut": "A", "comment": "Increased speed of phospholipid scrambling. Constitutive scramblase activity at basal cytosolic calcium levels; when associated with A-518 and A-563.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 612, "end_pos": 612, "sequence_org": "I", "sequence_mut": "E", "comment": "Constitutive phospholipid scramblase activity at basal cytosolic calcium levels.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 612, "end_pos": 612, "sequence_org": "I", "sequence_mut": "K", "comment": "Constitutive phospholipid scramblase activity at basal cytosolic calcium levels.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 612, "end_pos": 612, "sequence_org": "I", "sequence_mut": "W", "comment": "Decreased lipid scramblase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 703, "end_pos": 703, "sequence_org": "D", "sequence_mut": "R", "comment": "Expected to disrupt calcium binding. Loss of scramblase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "31015464", "url": "https://pubmed.ncbi.nlm.nih.gov/31015464" } ], "uniprot_canonical_ac": "Q6P9J9-1" } ], "record_id": "pubmed.31015464", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TMEM16F Expressed in Kupffer Cells Regulates Liver Inflammation and Metabolism to Protect Against Listeria Monocytogenes.", "journal": "Advanced science (Weinheim, Baden-Wurttemberg, Germany)", "date": "2024-10", "authors": "Tang Jianlong, Song Hua, Li Shimin, Lam Sin Man, Ping Jieming, Yang Mengyun, Li Na, Chang Teding, Yu Ze, Liu Weixiang, Lu Yan, Zhu Min, Tang Zhaohui, Liu Zheng, Guo Yusong R, Shui Guanghou, Veillette Andr\u00e9, Zeng Zhutian, Wu Ning", "reference": { "type": "PubMed", "id": "39136057", "url": "https://pubmed.ncbi.nlm.nih.gov/39136057" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.39136057", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lowered responsiveness of the catalyst of adenylyl cyclase to stimulation by GS in heterologous desensitization: a role for adenosine 3',5'-monophosphate-dependent phosphorylation.", "journal": "Endocrinology", "date": "1992", "authors": "Premont RT, Jacobowitz O, Iyengar R", "reference": { "type": "PubMed", "id": "1332848", "url": "https://pubmed.ncbi.nlm.nih.gov/1332848" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01341-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "Adcy6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q01341", "url": "https://www.uniprot.org/uniprotkb/Q01341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.1332848", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and expression of a Ca(2+)-inhibitable adenylyl cyclase from NCB-20 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Yoshimura M, Cooper DM", "reference": { "type": "PubMed", "id": "1379717", "url": "https://pubmed.ncbi.nlm.nih.gov/1379717" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01341-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "Adcy6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q01341", "url": "https://www.uniprot.org/uniprotkb/Q01341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.1379717", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of the ankle-link complex in cochlear hair cells and its role in the hair bundle functioning.", "journal": "J. Neurosci.", "date": "2007", "authors": "Michalski N, Michel V, Bahloul A, Lefevre G, Barral J, Yagi H, Chardenoux S, Weil D, Martin P, Hardelin JP, Sato M, Petit C", "reference": { "type": "PubMed", "id": "17567809", "url": "https://pubmed.ncbi.nlm.nih.gov/17567809" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01341-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "Adcy6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q2QI47-1", "protein_name": "Usherin", "gene_name": "Ush2A; Ush2a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q3ZK22-1", "protein_name": "Vezatin", "gene_name": "Vezt", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P97479-1", "protein_name": "Unconventional myosin-VIIa", "gene_name": "Myo7a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q80VW5-1", "protein_name": "Whirlin", "gene_name": "Whrn", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8VHN7-1", "protein_name": "Adhesion G protein-coupled receptor V1", "gene_name": "Adgrv1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q01341", "url": "https://www.uniprot.org/uniprotkb/Q01341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.17567809", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adenylyl cyclase type 6 deletion decreases left ventricular function via impaired calcium handling.", "journal": "Circulation", "date": "2008-01-01", "authors": "Tang Tong, Gao Mei Hua, Lai N Chin, Firth Amy L, Takahashi Toshiyuki, Guo Tracy, Yuan Jason X-J, Roth David M, Hammond H Kirk", "reference": { "type": "PubMed", "id": "18071070", "url": "https://pubmed.ncbi.nlm.nih.gov/18071070" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01341-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "Adcy6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q01341", "url": "https://www.uniprot.org/uniprotkb/Q01341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.18071070", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adenylyl cyclase 6 deletion reduces left ventricular hypertrophy, dilation, dysfunction, and fibrosis in pressure-overloaded female mice.", "journal": "Journal of the American College of Cardiology", "date": "2010-04-06", "authors": "Tang Tong, Lai N Chin, Hammond H Kirk, Roth David M, Yang Yuan, Guo Tracy, Gao Mei Hua", "reference": { "type": "PubMed", "id": "20359598", "url": "https://pubmed.ncbi.nlm.nih.gov/20359598" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01341-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "Adcy6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q01341", "url": "https://www.uniprot.org/uniprotkb/Q01341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.20359598", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Primary cilium-dependent mechanosensing is mediated by adenylyl cyclase 6 and cyclic AMP in bone cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010-08", "authors": "Kwon Ronald Y, Temiyasathit Sara, Tummala Padmaja, Quah Clarence C, Jacobs Christopher R", "reference": { "type": "PubMed", "id": "20371630", "url": "https://pubmed.ncbi.nlm.nih.gov/20371630" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01341-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "Adcy6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q01341", "url": "https://www.uniprot.org/uniprotkb/Q01341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.20371630", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Impaired water reabsorption in mice deficient in the type VI adenylyl cyclase (AC6).", "journal": "FEBS letters", "date": "2010-07-02", "authors": "Chien Chen-Li, Wu Yu-Shuo, Lai Hsing-Lin, Chen Yen-Hui, Jiang Si-Tse, Shih Chia-Ming, Lin Sui-Shan, Chang Chen, Chern Yijuang", "reference": { "type": "PubMed", "id": "20466003", "url": "https://pubmed.ncbi.nlm.nih.gov/20466003" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01341-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "Adcy6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q01341", "url": "https://www.uniprot.org/uniprotkb/Q01341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.20466003", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adenylyl cyclase 6 mediates the action of cyclic AMP-dependent secretagogues in mouse pancreatic exocrine cells via protein kinase A pathway activation.", "journal": "The Journal of physiology", "date": "2013-08-01", "authors": "Sabbatini Maria E, D'Alecy Louis, Lentz Stephen I, Tang Tong, Williams John A", "reference": { "type": "PubMed", "id": "23753526", "url": "https://pubmed.ncbi.nlm.nih.gov/23753526" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01341-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "Adcy6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q01341", "url": "https://www.uniprot.org/uniprotkb/Q01341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.23753526", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adenylyl cyclase 6 deficiency ameliorates polycystic kidney disease.", "journal": "J. Am. Soc. Nephrol.", "date": "2014", "authors": "Rees Sara, Kittikulsuth Wararat, Roos Karl, Strait Kevin A, Van Hoek Alfred, Kohan Donald E", "reference": { "type": "PubMed", "id": "24158982", "url": "https://pubmed.ncbi.nlm.nih.gov/24158982" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01341-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "Adcy6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q01341", "url": "https://www.uniprot.org/uniprotkb/Q01341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.24158982", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adenylyl cyclase 6 mediates loading-induced bone adaptation in vivo.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2014-03", "authors": "Lee Kristen L, Hoey David A, Spasic Milos, Tang Tong, Hammond H Kirk, Jacobs Christopher R", "reference": { "type": "PubMed", "id": "24277577", "url": "https://pubmed.ncbi.nlm.nih.gov/24277577" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01341-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "Adcy6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q01341", "url": "https://www.uniprot.org/uniprotkb/Q01341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.24277577", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Non-raft adenylyl cyclase 2 defines a cAMP signaling compartment that selectively regulates IL-6 expression in airway smooth muscle cells: differential regulation of gene expression by AC isoforms.", "journal": "Naunyn-Schmiedeberg's archives of pharmacology", "date": "2014", "authors": "Bogard AS, Birg AV, Ostrom RS", "reference": { "type": "PubMed", "id": "24363043", "url": "https://pubmed.ncbi.nlm.nih.gov/24363043" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01341-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "Adcy6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P26769-1", "protein_name": "Adenylate cyclase type 2", "gene_name": "Adcy2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P21932-1", "protein_name": "Adenylate cyclase type 3", "gene_name": "Adcy3", "tax_name": "Rat" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q01341", "url": "https://www.uniprot.org/uniprotkb/Q01341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.24363043", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Renal phosphate wasting in the absence of adenylyl cyclase 6.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2014-12", "authors": "Fenton Robert A, Murray Fiona, Dominguez Rieg Jessica A, Tang Tong, Levi Moshe, Rieg Timo", "reference": { "type": "PubMed", "id": "24854272", "url": "https://pubmed.ncbi.nlm.nih.gov/24854272" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01341-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "Adcy6", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q01341", "url": "https://www.uniprot.org/uniprotkb/Q01341" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.24854272", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recognition of a sequestered self peptide by influenza virus-specific CD8+ cytolytic T lymphocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000-02-15", "authors": "Fan R, Tykodi S S, Braciale T J", "reference": { "type": "PubMed", "id": "10657609", "url": "https://pubmed.ncbi.nlm.nih.gov/10657609" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99KI0-1", "protein_name": "Aconitate hydratase, mitochondrial", "gene_name": "Aco2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99KI0", "url": "https://www.uniprot.org/uniprotkb/Q99KI0" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.10657609", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sialylation of Asparagine 612 Inhibits Aconitase Activity during Mouse Sperm Capacitation; a Possible Mechanism for the Switch from Oxidative Phosphorylation to Glycolysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2020", "authors": "Silva Balbin Villaverde AI, Ogle RA, Lewis P, Carbone V, Velkov T, Netherton JK, Baker MA", "reference": { "type": "PubMed", "id": "32839225", "url": "https://pubmed.ncbi.nlm.nih.gov/32839225" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99KI0-1", "protein_name": "Aconitate hydratase, mitochondrial", "gene_name": "Aco2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99KI0", "url": "https://www.uniprot.org/uniprotkb/Q99KI0" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 612, "start_aa": "Asn", "end_pos": 612, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn612", "evidence": [ { "id": "32839225", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32839225" }, { "id": "GLY_000492", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000492" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q99KI0-1" } ], "record_id": "pubmed.32839225", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "ACO2 deficiency increases vulnerability to Parkinson's disease via dysregulating mitochondrial function and histone acetylation-mediated transcription of autophagy genes.", "journal": "Communications biology", "date": "2023-11-25", "authors": "Zhu Junge, Xu Fanxi, Lai Hong, Yuan Huiyao, Li Xu-Ying, Hu Junya, Li Wei, Liu Lei, Wang Chaodong", "reference": { "type": "PubMed", "id": "38007539", "url": "https://pubmed.ncbi.nlm.nih.gov/38007539" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99KI0-1", "protein_name": "Aconitate hydratase, mitochondrial", "gene_name": "Aco2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q99798-1", "protein_name": "Aconitate hydratase, mitochondrial", "gene_name": "ACO2", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99KI0", "url": "https://www.uniprot.org/uniprotkb/Q99KI0" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.38007539", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mouse Apg16L, a novel WD-repeat protein, targets to the autophagic isolation membrane with the Apg12-Apg5 conjugate.", "journal": "Journal of cell science", "date": "2003", "authors": "Mizushima N, Kuma A, Kobayashi Y, Yamamoto A, Matsubae M, Takao T, Natsume T, Ohsumi Y, Yoshimori T", "reference": { "type": "PubMed", "id": "12665549", "url": "https://pubmed.ncbi.nlm.nih.gov/12665549" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q99J83-1", "protein_name": "Autophagy protein 5", "gene_name": "Atg5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9CQY1-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "Atg12", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "D3ZFK6-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Rat" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.12665549", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Golgi-resident small GTPase Rab33B interacts with Atg16L and modulates autophagosome formation.", "journal": "Mol. Biol. Cell", "date": "2008", "authors": "Itoh T, Fujita N, Kanno E, Yamamoto A, Yoshimori T, Fukuda M", "reference": { "type": "PubMed", "id": "18448665", "url": "https://pubmed.ncbi.nlm.nih.gov/18448665" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P97950-1", "protein_name": "Ras-related protein Rab-33A", "gene_name": "Rab33a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O35963-1", "protein_name": "Ras-related protein Rab-33B", "gene_name": "Rab33b", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9H082-1", "protein_name": "Ras-related protein Rab-33B", "gene_name": "RAB33B", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 47, "end_pos": 47, "sequence_org": "T", "sequence_mut": "N", "comment": "Affects interaction with ATG16L1.", "evidence": [ { "database": "UniProtKB", "id": "O35963", "url": "https://www.uniprot.org/uniprotkb/O35963" }, { "database": "PubMed", "id": "18448665", "url": "https://pubmed.ncbi.nlm.nih.gov/18448665" } ], "uniprot_canonical_ac": "O35963-1" }, { "start_pos": 92, "end_pos": 92, "sequence_org": "Q", "sequence_mut": "L", "comment": "Does not affect interaction with ATG16L1. Induces lipidation of LC3. Decreased GTPase catalytic efficiency.", "evidence": [ { "database": "UniProtKB", "id": "O35963", "url": "https://www.uniprot.org/uniprotkb/O35963" }, { "database": "PubMed", "id": "18448665", "url": "https://pubmed.ncbi.nlm.nih.gov/18448665" }, { "database": "PubMed", "id": "16855591", "url": "https://pubmed.ncbi.nlm.nih.gov/16855591" } ], "uniprot_canonical_ac": "O35963-1" } ], "record_id": "pubmed.18448665", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A key role for autophagy and the autophagy gene Atg16l1 in mouse and human intestinal Paneth cells.", "journal": "Nature", "date": "2008-11-13", "authors": "Cadwell Ken, Liu John Y, Brown Sarah L, Miyoshi Hiroyuki, Loh Joy, Lennerz Jochen K, Kishi Chieko, Kc Wumesh, Carrero Javier A, Hunt Steven, Stone Christian D, Brunt Elizabeth M, Xavier Ramnik J, Sleckman Barry P, Li Ellen, Mizushima Noboru, Stappenbeck Thaddeus S, Virgin Herbert W", "reference": { "type": "PubMed", "id": "18849966", "url": "https://pubmed.ncbi.nlm.nih.gov/18849966" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q676U5-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "ATG16L1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.18849966", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nod1 and Nod2 direct autophagy by recruiting ATG16L1 to the plasma membrane at the site of bacterial entry.", "journal": "Nature immunology", "date": "2010-01", "authors": "Travassos Leonardo H, Carneiro Leticia A M, Ramjeet Mahendrasingh, Hussey Seamus, Kim Yun-Gi, Magalh\u00e3es Jo\u00e3o G, Yuan Linda, Soares Fraser, Chea Evelyn, Le Bourhis Lionel, Boneca Ivo G, Allaoui Abdelmounaaim, Jones Nicola L, Nu\u00f1ez Gabriel, Girardin Stephen E, Philpott Dana J", "reference": { "type": "PubMed", "id": "19898471", "url": "https://pubmed.ncbi.nlm.nih.gov/19898471" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BHB0-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 1", "gene_name": "Nod1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8K3Z0-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 2", "gene_name": "Nod2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.19898471", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NOD2 stimulation induces autophagy in dendritic cells influencing bacterial handling and antigen presentation.", "journal": "Nature medicine", "date": "2010-01", "authors": "Cooney Rachel, Baker John, Brain Oliver, Danis Benedicte, Pichulik Tica, Allan Philip, Ferguson David J P, Campbell Barry J, Jewell Derek, Simmons Alison", "reference": { "type": "PubMed", "id": "19966812", "url": "https://pubmed.ncbi.nlm.nih.gov/19966812" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8K3Z0-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 2", "gene_name": "Nod2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.19966812", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy.", "journal": "Nat. Struct. Mol. Biol.", "date": "2013", "authors": "Gammoh Noor, Florey Oliver, Overholtzer Michael, Jiang Xuejun", "reference": { "type": "PubMed", "id": "23262492", "url": "https://pubmed.ncbi.nlm.nih.gov/23262492" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8TDY2-1", "protein_name": "RB1-inducible coiled-coil protein 1", "gene_name": "RB1CC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q676U5-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "ATG16L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ESK9-1", "protein_name": "RB1-inducible coiled-coil protein 1", "gene_name": "Rb1cc1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.23262492", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FIP200 regulates targeting of Atg16L1 to the isolation membrane.", "journal": "EMBO reports", "date": "2013", "authors": "Nishimura T, Kaizuka T, Cadwell K, Sahani MH, Saitoh T, Akira S, Virgin HW, Mizushima N", "reference": { "type": "PubMed", "id": "23392225", "url": "https://pubmed.ncbi.nlm.nih.gov/23392225" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8TDY2-1", "protein_name": "RB1-inducible coiled-coil protein 1", "gene_name": "RB1CC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q676U5-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "ATG16L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ESK9-1", "protein_name": "RB1-inducible coiled-coil protein 1", "gene_name": "Rb1cc1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.23392225", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The protein ATG16L1 suppresses inflammatory cytokines induced by the intracellular sensors Nod1 and Nod2 in an autophagy-independent manner.", "journal": "Immunity", "date": "2013-11-14", "authors": "Sorbara Matthew T, Ellison Lisa K, Ramjeet Mahendrasingh, Travassos Leonardo H, Jones Nicola L, Girardin Stephen E, Philpott Dana J", "reference": { "type": "PubMed", "id": "24238340", "url": "https://pubmed.ncbi.nlm.nih.gov/24238340" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q676U5-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "ATG16L1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.24238340", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Crohn's disease variant in Atg16l1 enhances its degradation by caspase 3.", "journal": "Nature", "date": "2014", "authors": "Murthy A, Li Y, Peng I, Reichelt M, Katakam AK, Noubade R, Roose-Girma M, DeVoss J, Diehl L, Graham RR, van Lookeren Campagne M", "reference": { "type": "PubMed", "id": "24553140", "url": "https://pubmed.ncbi.nlm.nih.gov/24553140" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q676U5-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "ATG16L1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 299, "end_pos": 299, "sequence_org": "D", "sequence_mut": "E", "comment": "Prevents cleavage by activated CASP3.", "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" }, { "database": "PubMed", "id": "24553140", "url": "https://pubmed.ncbi.nlm.nih.gov/24553140" } ], "uniprot_canonical_ac": "Q8C0J2-1" }, { "start_pos": 300, "end_pos": 300, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on the stability of the protein under normal conditions. Enhances cleavage and degradation mediated by activated CASP3 and CASP7. Results in reduced autophagy and defective clearance of intestinal pathogens. Increases secretion of pro-inflammatory cytokine IL1B and type IIFN.", "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" }, { "database": "PubMed", "id": "24821797", "url": "https://pubmed.ncbi.nlm.nih.gov/24821797" }, { "database": "PubMed", "id": "24553140", "url": "https://pubmed.ncbi.nlm.nih.gov/24553140" } ], "uniprot_canonical_ac": "Q8C0J2-1" }, { "start_pos": 299, "end_pos": 299, "sequence_org": "D", "sequence_mut": "E", "comment": "Prevents cleavage by activated CASP3.", "evidence": [ { "database": "UniProtKB", "id": "Q676U5", "url": "https://www.uniprot.org/uniprotkb/Q676U5" }, { "database": "PubMed", "id": "24553140", "url": "https://pubmed.ncbi.nlm.nih.gov/24553140" } ], "uniprot_canonical_ac": "Q676U5-1" } ], "record_id": "pubmed.24553140", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Atg16L1 T300A variant decreases selective autophagy resulting in altered cytokine signaling and decreased antibacterial defense.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Lassen KG, Kuballa P, Conway KL, Patel KK, Becker CE, Peloquin JM, Villablanca EJ, Norman JM, Liu TC, Heath RJ, Becker ML, Fagbami L, Horn H, Mercer J, Yilmaz OH, Jaffe JD, Shamji AF, Bhan AK, Carr SA, Daly MJ, Virgin HW, Schreiber SL, Stappenbeck TS, Xavier RJ", "reference": { "type": "PubMed", "id": "24821797", "url": "https://pubmed.ncbi.nlm.nih.gov/24821797" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 300, "end_pos": 300, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on the stability of the protein under normal conditions. Enhances cleavage and degradation mediated by activated CASP3 and CASP7. Results in reduced autophagy and defective clearance of intestinal pathogens. Increases secretion of pro-inflammatory cytokine IL1B and type IIFN.", "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" }, { "database": "PubMed", "id": "24821797", "url": "https://pubmed.ncbi.nlm.nih.gov/24821797" }, { "database": "PubMed", "id": "24553140", "url": "https://pubmed.ncbi.nlm.nih.gov/24553140" } ], "uniprot_canonical_ac": "Q8C0J2-1" } ], "record_id": "pubmed.24821797", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IKKalpha controls ATG16L1 degradation to prevent ER stress during inflammation.", "journal": "The Journal of experimental medicine", "date": "2017", "authors": "Diamanti MA, Gupta J, Bennecke M, De Oliveira T, Ramakrishnan M, Braczynski AK, Richter B, Beli P, Hu Y, Saleh M, Mittelbronn M, Dikic I, Greten FR", "reference": { "type": "PubMed", "id": "28082356", "url": "https://pubmed.ncbi.nlm.nih.gov/28082356" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 278, "end_pos": 278, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8C0J2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8C0J2" }, { "database": "PubMed", "id": "28082356", "url": "https://pubmed.ncbi.nlm.nih.gov/28082356" } ], "site_lbl": "Ser278", "uniprot_canonical_ac": "Q8C0J2-1" } ], "record_id": "pubmed.28082356", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SPATA33 is an autophagy mediator for cargo selectivity in germline mitophagy.", "journal": "Cell Death Differ.", "date": "2021", "authors": "Zhang Y, Xu X, Hu M, Wang X, Cheng H, Zhou R", "reference": { "type": "PubMed", "id": "33087875", "url": "https://pubmed.ncbi.nlm.nih.gov/33087875" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q676U5-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "ATG16L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60930-1", "protein_name": "Non-selective voltage-gated ion channel VDAC2", "gene_name": "Vdac2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8C624-1", "protein_name": "Spermatogenesis-associated protein 33", "gene_name": "Spata33", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.33087875", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Non-canonical autophagy functions of ATG16L1 in epithelial cells limit lethal infection by influenza A virus.", "journal": "The EMBO journal", "date": "2021", "authors": "Wang Y, Sharma P, Jefferson M, Zhang W, Bone B, Kipar A, Bitto D, Coombes JL, Pearson T, Man A, Zhekova A, Bao Y, Tripp RA, Carding SR, Yamauchi Y, Mayer U, Powell PP, Stewart JP, Wileman T", "reference": { "type": "PubMed", "id": "33586810", "url": "https://pubmed.ncbi.nlm.nih.gov/33586810" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8C0J2-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "Atg16l1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 231, "end_pos": 607, "sequence_org": "PLPVEQDDDIEVIVDETSDHTEETSPVRAVSRAATKRLSQPAGGLLDSITNIFGRRSVSSIPVPQDIMDTHPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSVLTGKVEKVLSKQHSSSINAVAWAPSGLHVVSVDKGSRAVLWAQP", "sequence_mut": "", "comment": "Impaired non-canonical autophagy, leading to susceptibility to influenza A virus (IAV) infection in mice.", "evidence": [ { "database": "UniProtKB", "id": "Q8C0J2", "url": "https://www.uniprot.org/uniprotkb/Q8C0J2" }, { "database": "PubMed", "id": "33586810", "url": "https://pubmed.ncbi.nlm.nih.gov/33586810" } ], "uniprot_canonical_ac": "Q8C0J2-1" } ], "record_id": "pubmed.33586810", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cidea-deficient mice have lean phenotype and are resistant to obesity.", "journal": "Nat. Genet.", "date": "2003", "authors": "Zhou Z, Yon Toh S, Chen Z, Guo K, Ng CP, Ponniah S, Lin SC, Hong W, Li P", "reference": { "type": "PubMed", "id": "12910269", "url": "https://pubmed.ncbi.nlm.nih.gov/12910269" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70302-1", "protein_name": "Lipid transferase CIDEA", "gene_name": "Cidea", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P56198-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "Cidec", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.12910269", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cidea, brown fat and obesity.", "journal": "Mechanisms of ageing and development", "date": "2004", "authors": "Li P", "reference": { "type": "PubMed", "id": "15063110", "url": "https://pubmed.ncbi.nlm.nih.gov/15063110" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70302-1", "protein_name": "Lipid transferase CIDEA", "gene_name": "Cidea", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.15063110", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cidea is associated with lipid droplets and insulin sensitivity in humans.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Puri V, Ranjit S, Konda S, Nicoloro SM, Straubhaar J, Chawla A, Chouinard M, Lin C, Burkart A, Corvera S, Perugini RA, Czech MP", "reference": { "type": "PubMed", "id": "18509062", "url": "https://pubmed.ncbi.nlm.nih.gov/18509062" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70302-1", "protein_name": "Lipid transferase CIDEA", "gene_name": "Cidea", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O60543-1", "protein_name": "Lipid transferase CIDEA", "gene_name": "CIDEA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56198-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "Cidec", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.18509062", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the lipid droplet targeting domain of the Cidea protein.", "journal": "J. Lipid Res.", "date": "2010", "authors": "Christianson Jennifer L, Boutet Emilie, Puri Vishwajeet, Chawla Anil, Czech Michael P", "reference": { "type": "PubMed", "id": "20810722", "url": "https://pubmed.ncbi.nlm.nih.gov/20810722" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70302-1", "protein_name": "Lipid transferase CIDEA", "gene_name": "Cidea", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.20810722", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fsp27 promotes lipid droplet growth by lipid exchange and transfer at lipid droplet contact sites.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Gong J, Sun Z, Wu L, Xu W, Schieber N, Xu D, Shui G, Yang H, Parton RG, Li P", "reference": { "type": "PubMed", "id": "22144693", "url": "https://pubmed.ncbi.nlm.nih.gov/22144693" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70302-1", "protein_name": "Lipid transferase CIDEA", "gene_name": "Cidea", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P56198-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "Cidec", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 182, "end_pos": 182, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes lipid droplet enlargement activity, but not localization to lipid droplets, nor enrichement at contact sites; when associated with A-186 and A-190.", "evidence": [ { "database": "UniProtKB", "id": "P56198", "url": "https://www.uniprot.org/uniprotkb/P56198" }, { "database": "PubMed", "id": "22144693", "url": "https://pubmed.ncbi.nlm.nih.gov/22144693" } ], "uniprot_canonical_ac": "P56198-1" }, { "start_pos": 186, "end_pos": 186, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes lipid droplet enlargement activity, but not localization to lipid droplets, nor enrichement at contact sites; when associated with A-182 and A-190.", "evidence": [ { "database": "UniProtKB", "id": "P56198", "url": "https://www.uniprot.org/uniprotkb/P56198" }, { "database": "PubMed", "id": "22144693", "url": "https://pubmed.ncbi.nlm.nih.gov/22144693" } ], "uniprot_canonical_ac": "P56198-1" }, { "start_pos": 190, "end_pos": 190, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolishes lipid droplet enlargement activity, but not localization to lipid droplets, nor enrichement at contact sites; when associated with A-182 and A-186.", "evidence": [ { "database": "UniProtKB", "id": "P56198", "url": "https://www.uniprot.org/uniprotkb/P56198" }, { "database": "PubMed", "id": "22144693", "url": "https://pubmed.ncbi.nlm.nih.gov/22144693" } ], "uniprot_canonical_ac": "P56198-1" } ], "record_id": "pubmed.22144693", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cidea is an essential transcriptional coactivator regulating mammary gland secretion of milk lipids.", "journal": "Nature medicine", "date": "2012", "authors": "Wang W, Lv N, Zhang S, Shui G, Qian H, Zhang J, Chen Y, Ye J, Xie Y, Shen Y, Wenk MR, Li P", "reference": { "type": "PubMed", "id": "22245780", "url": "https://pubmed.ncbi.nlm.nih.gov/22245780" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70302-1", "protein_name": "Lipid transferase CIDEA", "gene_name": "Cidea", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P28033-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "Cebpb", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P56198-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "Cidec", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 23, "end_pos": 23, "sequence_org": "K", "sequence_mut": "A", "comment": "Substantial reduction in nuclear localization and loss of XDH induction; when associated with A-24.", "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" }, { "database": "PubMed", "id": "22245780", "url": "https://pubmed.ncbi.nlm.nih.gov/22245780" } ], "uniprot_canonical_ac": "O70302-1" }, { "start_pos": 23, "end_pos": 23, "sequence_org": "K", "sequence_mut": "R", "comment": "Increased nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" }, { "database": "PubMed", "id": "22245780", "url": "https://pubmed.ncbi.nlm.nih.gov/22245780" } ], "uniprot_canonical_ac": "O70302-1" }, { "start_pos": 24, "end_pos": 24, "sequence_org": "K", "sequence_mut": "A", "comment": "Substantial reduction in nuclear localization and loss of XDH induction; when associated with A-23.", "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" }, { "database": "PubMed", "id": "22245780", "url": "https://pubmed.ncbi.nlm.nih.gov/22245780" } ], "uniprot_canonical_ac": "O70302-1" } ], "record_id": "pubmed.22245780", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The brown adipocyte protein CIDEA promotes lipid droplet fusion via a phosphatidic acid-binding amphipathic helix.", "journal": "eLife", "date": "2015-11-26", "authors": "Barneda David, Planas-Iglesias Joan, Gaspar Maria L, Mohammadyani Dariush, Prasannan Sunil, Dormann Dirk, Han Gil-Soo, Jesch Stephen A, Carman George M, Kagan Valerian, Parker Malcolm G, Ktistakis Nicholas T, Klein-Seetharaman Judith, Dixon Ann M, Henry Susan A, Christian Mark", "reference": { "type": "PubMed", "id": "26609809", "url": "https://pubmed.ncbi.nlm.nih.gov/26609809" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70302-1", "protein_name": "Lipid transferase CIDEA", "gene_name": "Cidea", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 166, "end_pos": 169, "sequence_org": "FKAV", "sequence_mut": "RKRR", "comment": "Abolished localization to lipid droplets.", "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" }, { "database": "PubMed", "id": "26609809", "url": "https://pubmed.ncbi.nlm.nih.gov/26609809" } ], "uniprot_canonical_ac": "O70302-1" }, { "start_pos": 166, "end_pos": 170, "sequence_org": "FKAVL", "sequence_mut": "RAVRR", "comment": "Abolished localization to lipid droplets.", "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" }, { "database": "PubMed", "id": "26609809", "url": "https://pubmed.ncbi.nlm.nih.gov/26609809" } ], "uniprot_canonical_ac": "O70302-1" }, { "start_pos": 167, "end_pos": 175, "sequence_org": "KAVLRNLLR", "sequence_mut": "EAVLENLLE", "comment": "Does not affect localization to lipid droplets but prevents lipid droplet fusion.", "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" }, { "database": "PubMed", "id": "26609809", "url": "https://pubmed.ncbi.nlm.nih.gov/26609809" } ], "uniprot_canonical_ac": "O70302-1" }, { "start_pos": 167, "end_pos": 175, "sequence_org": "KAVLRNLLR", "sequence_mut": "HAVLHNLLH", "comment": "Does not affect localization to lipid droplets or ability to mediate lipid droplet fusion.", "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" }, { "database": "PubMed", "id": "26609809", "url": "https://pubmed.ncbi.nlm.nih.gov/26609809" } ], "uniprot_canonical_ac": "O70302-1" }, { "start_pos": 171, "end_pos": 175, "sequence_org": "RNLLR", "sequence_mut": "ANLLA", "comment": "Abolished lipid transferase activity.", "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" }, { "database": "PubMed", "id": "26609809", "url": "https://pubmed.ncbi.nlm.nih.gov/26609809" } ], "uniprot_canonical_ac": "O70302-1" } ], "record_id": "pubmed.26609809", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential roles of cell death-inducing DNA fragmentation factor-alpha-like effector (CIDE) proteins in promoting lipid droplet fusion and growth in subpopulations of hepatocytes.", "journal": "J. Biol. Chem.", "date": "2016", "authors": "Xu W, Wu L, Yu M, Chen FJ, Arshad M, Xia X, Ren H, Yu J, Xu L, Xu D, Li JZ, Li P, Zhou L", "reference": { "type": "PubMed", "id": "26733203", "url": "https://pubmed.ncbi.nlm.nih.gov/26733203" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70302-1", "protein_name": "Lipid transferase CIDEA", "gene_name": "Cidea", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P56198-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "Cidec", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O70303-1", "protein_name": "Lipid transferase CIDEB", "gene_name": "Cideb", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.26733203", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CLSTN3\u03b2 enforces adipocyte multilocularity to facilitate lipid utilization.", "journal": "Nature", "date": "2022-12-07", "authors": "Qian Kevin, Tol Marcus J, Wu Jin, Uchiyama Lauren F, Xiao Xu, Cui Liujuan, Bedard Alexander H, Weston Thomas A, Rajendran Pradeep S, Vergnes Laurent, Shimanaka Yuta, Yin Yesheng, Jami-Alahmadi Yasaman, Cohn Whitaker, Bajar Bryce T, Lin Chia-Ho, Jin Benita, DeNardo Laura A, Black Douglas L, Whitelegge Julian P, Wohlschlegel James A, Reue Karen, Shivkumar Kalyanam, Chen Feng-Jung, Young Stephen G, Li Peng, Tontonoz Peter", "reference": { "type": "PubMed", "id": "36477540", "url": "https://pubmed.ncbi.nlm.nih.gov/36477540" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70302-1", "protein_name": "Lipid transferase CIDEA", "gene_name": "Cidea", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BQT9-1", "protein_name": "Calsyntenin-3", "gene_name": "CLSTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56198-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "Cidec", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q99JH7-1", "protein_name": "Calsyntenin-3", "gene_name": "Clstn3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.36477540", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CIDE, a novel family of cell death activators with homology to the 45 kDa subunit of the DNA fragmentation factor.", "journal": "The EMBO journal", "date": "1998", "authors": "Inohara N, Koseki T, Chen S, Wu X, Nunez G", "reference": { "type": "PubMed", "id": "9564035", "url": "https://pubmed.ncbi.nlm.nih.gov/9564035" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70302-1", "protein_name": "Lipid transferase CIDEA", "gene_name": "Cidea", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O60543-1", "protein_name": "Lipid transferase CIDEA", "gene_name": "CIDEA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O70303-1", "protein_name": "Lipid transferase CIDEB", "gene_name": "Cideb", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UHD4-1", "protein_name": "Lipid transferase CIDEB", "gene_name": "CIDEB", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70302", "url": "https://www.uniprot.org/uniprotkb/O70302" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.9564035", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of mouse brain-specific angiogenesis inhibitor 1 (BAI1) and phytanoyl-CoA alpha-hydroxylase-associated protein 1, a novel BAI1-binding protein.", "journal": "Brain Res. Mol. Brain Res.", "date": "2001", "authors": "Koh JT, Lee ZH, Ahn KY, Kim JK, Bae CS, Kim HH, Kee HJ, Kim KK", "reference": { "type": "PubMed", "id": "11245925", "url": "https://pubmed.ncbi.nlm.nih.gov/11245925" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8K0S0-1", "protein_name": "Phytanoyl-CoA hydroxylase-interacting protein", "gene_name": "Phyhip", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.11245925", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Overexpression of the p53-inducible brain-specific angiogenesis inhibitor 1 suppresses efficiently tumour angiogenesis.", "journal": "British journal of cancer", "date": "2002", "authors": "Duda DG, Sunamura M, Lozonschi L, Yokoyama T, Yatsuoka T, Motoi F, Horii A, Tani K, Asano S, Nakamura Y, Matsuno S", "reference": { "type": "PubMed", "id": "11875720", "url": "https://pubmed.ncbi.nlm.nih.gov/11875720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O14514-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "ADGRB1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.11875720", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAI1 is an engulfment receptor for apoptotic cells upstream of the ELMO/Dock180/Rac module.", "journal": "Nature", "date": "2007", "authors": "Park D, Tosello-Trampont AC, Elliott MR, Lu M, Haney LB, Ma Z, Klibanov AL, Mandell JW, Ravichandran KS", "reference": { "type": "PubMed", "id": "17960134", "url": "https://pubmed.ncbi.nlm.nih.gov/17960134" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BPU7-1", "protein_name": "Engulfment and cell motility protein 1", "gene_name": "Elmo1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BUR4-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "Dock1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 1487, "end_pos": 1489, "sequence_org": "RKR", "sequence_mut": "AAA", "comment": "Reduced binding to ELMO1 and failure to promote engulfment of apoptotic thymocytes.", "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" }, { "database": "PubMed", "id": "17960134", "url": "https://pubmed.ncbi.nlm.nih.gov/17960134" } ], "uniprot_canonical_ac": "Q3UHD1-1" } ], "record_id": "pubmed.17960134", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Brain-specific angiogenesis inhibitor-1 expression in astrocytes and neurons: implications for its dual function as an apoptotic engulfment receptor.", "journal": "Brain Behav. Immun.", "date": "2011", "authors": "Sokolowski JD, Nobles SL, Heffron DS, Park D, Ravichandran KS, Mandell JW", "reference": { "type": "PubMed", "id": "20888903", "url": "https://pubmed.ncbi.nlm.nih.gov/20888903" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.20888903", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Brain angiogenesis inhibitor 1 (BAI1) is a pattern recognition receptor that mediates macrophage binding and engulfment of Gram-negative bacteria.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011-02-01", "authors": "Das Soumita, Owen Katherine A, Ly Kim T, Park Daeho, Black Steven G, Wilson Jeffrey M, Sifri Costi D, Ravichandran Kodi S, Ernst Peter B, Casanova James E", "reference": { "type": "PubMed", "id": "21245295", "url": "https://pubmed.ncbi.nlm.nih.gov/21245295" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.21245295", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The adhesion-GPCR BAI1 regulates synaptogenesis by controlling the recruitment of the Par3/Tiam1 polarity complex to synaptic sites.", "journal": "J. Neurosci.", "date": "2013", "authors": "Duman Joseph G, Tzeng Christopher P, Tu Yen-Kuei, Munjal Tina, Schwechter Brandon, Ho Tammy Szu-Yu, Tolias Kimberley F", "reference": { "type": "PubMed", "id": "23595754", "url": "https://pubmed.ncbi.nlm.nih.gov/23595754" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "C0HL12-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O14514-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "ADGRB1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.23595754", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphatidylserine receptor BAI1 and apoptotic cells as new promoters of myoblast fusion.", "journal": "Nature", "date": "2013-05-09", "authors": "Hochreiter-Hufford Amelia E, Lee Chang Sup, Kinchen Jason M, Sokolowski Jennifer D, Arandjelovic Sanja, Call Jarrod A, Klibanov Alexander L, Yan Zhen, Mandell James W, Ravichandran Kodi S", "reference": { "type": "PubMed", "id": "23615608", "url": "https://pubmed.ncbi.nlm.nih.gov/23615608" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.23615608", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Brain-specific angiogenesis inhibitor-1 signaling, regulation, and enrichment in the postsynaptic density.", "journal": "J. Biol. Chem.", "date": "2013", "authors": "Stephenson JR, Paavola KJ, Schaefer SA, Kaur B, Van Meir EG, Hall RA", "reference": { "type": "PubMed", "id": "23782696", "url": "https://pubmed.ncbi.nlm.nih.gov/23782696" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P78352-1", "protein_name": "Disks large homolog 4", "gene_name": "DLG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14514-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "ADGRB1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.23782696", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAI1 regulates spatial learning and synaptic plasticity in the hippocampus.", "journal": "The Journal of clinical investigation", "date": "2015-04", "authors": "Zhu Dan, Li Chenchen, Swanson Andrew M, Villalba Rosa M, Guo Jidong, Zhang Zhaobin, Matheny Shannon, Murakami Tatsuro, Stephenson Jason R, Daniel Sarah, Fukata Masaki, Hall Randy A, Olson Jeffrey J, Neigh Gretchen N, Smith Yoland, Rainnie Donald G, Van Meir Erwin G", "reference": { "type": "PubMed", "id": "25751059", "url": "https://pubmed.ncbi.nlm.nih.gov/25751059" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P23804-1", "protein_name": "E3 ubiquitin-protein ligase Mdm2", "gene_name": "Mdm2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.25751059", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The adhesion GPCR BAI1 mediates macrophage ROS production and microbicidal activity against Gram-negative bacteria.", "journal": "Science signaling", "date": "2016", "authors": "Billings EA, Lee CS, Owen KA, D'Souza RS, Ravichandran KS, Casanova JE", "reference": { "type": "PubMed", "id": "26838550", "url": "https://pubmed.ncbi.nlm.nih.gov/26838550" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O14514-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "ADGRB1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.26838550", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LncRNA embryonic stem cells expressed 1 (Lncenc1) is identified as a novel regulator in neuropathic pain by interacting with EZH2 and downregulating the expression of Bai1 in mouse microglia.", "journal": "Experimental cell research", "date": "2021", "authors": "Zhang Z, Sun X, Zhao G, Ma Y, Zeng G", "reference": { "type": "PubMed", "id": "33340495", "url": "https://pubmed.ncbi.nlm.nih.gov/33340495" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.33340495", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mice lacking full length Adgrb1 (Bai1) exhibit social deficits, increased seizure susceptibility, and altered brain development.", "journal": "Experimental neurology", "date": "2022", "authors": "Shiu FH, Wong JC, Yamamoto T, Lala T, Purcell RH, Owino S, Zhu D, Van Meir EG, Hall RA, Escayg A", "reference": { "type": "PubMed", "id": "35114205", "url": "https://pubmed.ncbi.nlm.nih.gov/35114205" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.35114205", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAI1 localizes AMPA receptors at the cochlear afferent post-synaptic density and is essential for hearing.", "journal": "Cell reports", "date": "2024-04-23", "authors": "Carlton Adam J, Jeng Jing-Yi, Grandi Fiorella C, De Faveri Francesca, Amariutei Ana E, De Tomasi Lara, O'Connor Andrew, Johnson Stuart L, Furness David N, Brown Steve D M, Ceriani Federico, Bowl Michael R, Mustapha Mirna, Marcotti Walter", "reference": { "type": "PubMed", "id": "38564333", "url": "https://pubmed.ncbi.nlm.nih.gov/38564333" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3UHD1-1", "protein_name": "Adhesion G protein-coupled receptor B1", "gene_name": "Adgrb1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UHD1", "url": "https://www.uniprot.org/uniprotkb/Q3UHD1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.38564333", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Akt2 is implicated in skeletal muscle differentiation and specifically binds Prohibitin2/REA.", "journal": "Journal of cellular physiology", "date": "2008-01", "authors": "H\u00e9ron-Milhavet Lisa, Mamaeva Daria, Rochat Anne, Lamb Ned J C, Fernandez Anne", "reference": { "type": "PubMed", "id": "17565718", "url": "https://pubmed.ncbi.nlm.nih.gov/17565718" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P31751-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "AKT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99623-1", "protein_name": "Prohibitin-2", "gene_name": "PHB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O35129-1", "protein_name": "Prohibitin-2", "gene_name": "Phb2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.17565718", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel Akt/PKB-interacting protein promotes cell adhesion and inhibits familial amyotrophic lateral sclerosis-linked mutant SOD1-induced neuronal death via inhibition of PP2A-mediated dephosphorylation of Akt/PKB.", "journal": "Cell. Signal.", "date": "2008", "authors": "Nawa M, Kanekura K, Hashimoto Y, Aiso S, Matsuoka M", "reference": { "type": "PubMed", "id": "18160256", "url": "https://pubmed.ncbi.nlm.nih.gov/18160256" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P31750-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "Akt1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9WUA6-1", "protein_name": "RAC-gamma serine/threonine-protein kinase", "gene_name": "Akt3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P63330-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "Ppp2ca", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BSF8-1", "protein_name": "BTB/POZ domain-containing protein 10", "gene_name": "BTBD10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62137-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "Ppp1ca", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q80X66-1", "protein_name": "BTB/POZ domain-containing protein 10", "gene_name": "Btbd10", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.18160256", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Akt2-mediated phosphorylation of Pitx2 controls Ccnd1 mRNA decay during muscle cell differentiation.", "journal": "Cell death and differentiation", "date": "2010", "authors": "Gherzi R, Trabucchi M, Ponassi M, Gallouzi IE, Rosenfeld MG, Briata P", "reference": { "type": "PubMed", "id": "20019746", "url": "https://pubmed.ncbi.nlm.nih.gov/20019746" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q99697-1", "protein_name": "Pituitary homeobox 2", "gene_name": "PITX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97474-1", "protein_name": "Pituitary homeobox 2", "gene_name": "Pitx2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q99697", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99697" }, { "database": "PubMed", "id": "20019746", "url": "https://pubmed.ncbi.nlm.nih.gov/20019746" } ], "site_lbl": "Thr90", "uniprot_canonical_ac": "Q99697-1" }, { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "P31751-1", "kinase_gene_name": "AKT2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q99697", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99697" }, { "database": "PubMed", "id": "20019746", "url": "https://pubmed.ncbi.nlm.nih.gov/20019746" } ], "site_lbl": "Thr90", "uniprot_canonical_ac": "Q99697-1" } ], "mutagenesis": [ { "start_pos": 90, "end_pos": 90, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation by AKT2.", "evidence": [ { "database": "UniProtKB", "id": "P97474", "url": "https://www.uniprot.org/uniprotkb/P97474" }, { "database": "PubMed", "id": "20019746", "url": "https://pubmed.ncbi.nlm.nih.gov/20019746" } ], "uniprot_canonical_ac": "P97474-1" } ], "record_id": "pubmed.20019746", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isoform-specific regulation of Akt signaling by the endosomal protein WDFY2.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Walz Helena A, Shi Xiarong, Chouinard My, Bue Catherine A, Navaroli Deanna M, Hayakawa Akira, Zhou Qiong L, Nadler Jonathan, Leonard Deborah M, Corvera Silvia", "reference": { "type": "PubMed", "id": "20189988", "url": "https://pubmed.ncbi.nlm.nih.gov/20189988" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P31750-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "Akt1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BUB4-1", "protein_name": "WD repeat and FYVE domain-containing protein 2", "gene_name": "Wdfy2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.20189988", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Akt1 and Akt2: differentiating the aktion.", "journal": "Histology and histopathology", "date": "2011-05", "authors": "Heron-Milhavet Lisa, Khouya Nabil, Fernandez Anne, Lamb Ned J", "reference": { "type": "PubMed", "id": "21432781", "url": "https://pubmed.ncbi.nlm.nih.gov/21432781" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P31750-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "Akt1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P47197-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P47196-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "Akt1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31751-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "AKT2", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.21432781", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Akt determines cell fate through inhibition of the PERK-eIF2alpha phosphorylation pathway.", "journal": "Science signaling", "date": "2011", "authors": "Mounir Z, Krishnamoorthy JL, Wang S, Papadopoulou B, Campbell S, Muller WJ, Hatzoglou M, Koromilas AE", "reference": { "type": "PubMed", "id": "21954288", "url": "https://pubmed.ncbi.nlm.nih.gov/21954288" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P31750-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "Akt1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9WUA6-1", "protein_name": "RAC-gamma serine/threonine-protein kinase", "gene_name": "Akt3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NZJ5-1", "protein_name": "Eukaryotic translation initiation factor 2-alpha kinase 3", "gene_name": "EIF2AK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z2B5-1", "protein_name": "Eukaryotic translation initiation factor 2-alpha kinase 3", "gene_name": "Eif2ak3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 802, "end_pos": 802, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NZJ5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NZJ5" }, { "database": "PubMed", "id": "21954288", "url": "https://pubmed.ncbi.nlm.nih.gov/21954288" } ], "site_lbl": "Thr802", "uniprot_canonical_ac": "Q9NZJ5-1" }, { "start_pos": 802, "end_pos": 802, "kinase_uniprot_canonical_ac": "P31751-1", "kinase_gene_name": "AKT2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NZJ5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NZJ5" }, { "database": "PubMed", "id": "21954288", "url": "https://pubmed.ncbi.nlm.nih.gov/21954288" } ], "site_lbl": "Thr802", "uniprot_canonical_ac": "Q9NZJ5-1" }, { "start_pos": 980, "end_pos": 980, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2B5", "url": "https://www.uniprot.org/uniprotkb/Q9Z2B5" }, { "database": "PubMed", "id": "21543844", "url": "https://pubmed.ncbi.nlm.nih.gov/21543844" }, { "database": "PubMed", "id": "21954288", "url": "https://pubmed.ncbi.nlm.nih.gov/21954288" }, { "database": "iPTMnet", "id": "Q9Z2B5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z2B5" }, { "database": "PubMed", "id": "22509299", "url": "https://pubmed.ncbi.nlm.nih.gov/22509299" }, { "database": "PubMed", "id": "24371088", "url": "https://pubmed.ncbi.nlm.nih.gov/24371088" }, { "database": "PubMed", "id": "29449538", "url": "https://pubmed.ncbi.nlm.nih.gov/29449538" }, { "database": "PubMed", "id": "32029570", "url": "https://pubmed.ncbi.nlm.nih.gov/32029570" }, { "database": "PubMed", "id": "32180905", "url": "https://pubmed.ncbi.nlm.nih.gov/32180905" }, { "database": "PubMed", "id": "32811828", "url": "https://pubmed.ncbi.nlm.nih.gov/32811828" } ], "site_lbl": "Thr980", "uniprot_canonical_ac": "Q9Z2B5-1" } ], "mutagenesis": [ { "start_pos": 799, "end_pos": 799, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolished phosphorylation by AKT.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2B5", "url": "https://www.uniprot.org/uniprotkb/Q9Z2B5" }, { "database": "PubMed", "id": "21954288", "url": "https://pubmed.ncbi.nlm.nih.gov/21954288" } ], "uniprot_canonical_ac": "Q9Z2B5-1" } ], "record_id": "pubmed.21954288", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "KCTD20, a relative of BTBD10, is a positive regulator of Akt.", "journal": "BMC Biochem.", "date": "2013", "authors": "Nawa M, Matsuoka M", "reference": { "type": "PubMed", "id": "24156551", "url": "https://pubmed.ncbi.nlm.nih.gov/24156551" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P31750-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "Akt1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9WUA6-1", "protein_name": "RAC-gamma serine/threonine-protein kinase", "gene_name": "Akt3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8CDD8-1", "protein_name": "BTB/POZ domain-containing protein KCTD20", "gene_name": "Kctd20", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P63330-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "Ppp2ca", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q7Z5Y7-1", "protein_name": "BTB/POZ domain-containing protein KCTD20", "gene_name": "KCTD20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62137-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "Ppp1ca", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q80X66-1", "protein_name": "BTB/POZ domain-containing protein 10", "gene_name": "Btbd10", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 308, "end_pos": 308, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by IKKE, PDPK1 and TBK1", "evidence": [ { "database": "UniProtKB", "id": "P31750", "url": "https://www.uniprot.org/uniprotkb/P31750" }, { "database": "PRO", "id": "P31750", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P31750" }, { "database": "iPTMnet", "id": "P31750", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31750" }, { "database": "PubMed", "id": "31915252", "url": "https://pubmed.ncbi.nlm.nih.gov/31915252" }, { "database": "PubMed", "id": "10438924", "url": "https://pubmed.ncbi.nlm.nih.gov/10438924" }, { "database": "PubMed", "id": "11006271", "url": "https://pubmed.ncbi.nlm.nih.gov/11006271" }, { "database": "PubMed", "id": "11375936", "url": "https://pubmed.ncbi.nlm.nih.gov/11375936" }, { "database": "PubMed", "id": "11507090", "url": "https://pubmed.ncbi.nlm.nih.gov/11507090" }, { "database": "PubMed", "id": "11563975", "url": "https://pubmed.ncbi.nlm.nih.gov/11563975" }, { "database": "PubMed", "id": "11803463", "url": "https://pubmed.ncbi.nlm.nih.gov/11803463" }, { "database": "PubMed", "id": "12153489", "url": "https://pubmed.ncbi.nlm.nih.gov/12153489" }, { "database": "PubMed", "id": "12493740", "url": "https://pubmed.ncbi.nlm.nih.gov/12493740" }, { "database": "PubMed", "id": "12637511", "url": "https://pubmed.ncbi.nlm.nih.gov/12637511" }, { "database": "PubMed", "id": "12911789", "url": "https://pubmed.ncbi.nlm.nih.gov/12911789" }, { "database": "PubMed", "id": "12947100", "url": "https://pubmed.ncbi.nlm.nih.gov/12947100" }, { "database": "PubMed", "id": "14623889", "url": "https://pubmed.ncbi.nlm.nih.gov/14623889" }, { "database": "PubMed", "id": "15020199", "url": "https://pubmed.ncbi.nlm.nih.gov/15020199" }, { "database": "PubMed", "id": "15065872", "url": "https://pubmed.ncbi.nlm.nih.gov/15065872" }, { "database": "PubMed", "id": "15067018", "url": "https://pubmed.ncbi.nlm.nih.gov/15067018" }, { "database": "PubMed", "id": "15122342", "url": "https://pubmed.ncbi.nlm.nih.gov/15122342" }, { "database": "PubMed", "id": "15278907", "url": "https://pubmed.ncbi.nlm.nih.gov/15278907" }, { "database": "PubMed", "id": "15389876", "url": "https://pubmed.ncbi.nlm.nih.gov/15389876" }, { "database": "PubMed", "id": "15504738", "url": "https://pubmed.ncbi.nlm.nih.gov/15504738" }, { "database": "PubMed", "id": "15574782", "url": "https://pubmed.ncbi.nlm.nih.gov/15574782" }, { "database": "PubMed", "id": "15591229", "url": "https://pubmed.ncbi.nlm.nih.gov/15591229" }, { "database": "PubMed", "id": "15842198", "url": "https://pubmed.ncbi.nlm.nih.gov/15842198" }, { "database": "PubMed", "id": "16338957", "url": "https://pubmed.ncbi.nlm.nih.gov/16338957" }, { "database": "PubMed", "id": "16512910", "url": "https://pubmed.ncbi.nlm.nih.gov/16512910" }, { "database": "PubMed", "id": "16787946", "url": "https://pubmed.ncbi.nlm.nih.gov/16787946" }, { "database": "PubMed", "id": "16809629", "url": "https://pubmed.ncbi.nlm.nih.gov/16809629" }, { "database": "PubMed", "id": "16872509", "url": "https://pubmed.ncbi.nlm.nih.gov/16872509" }, { "database": "PubMed", "id": "17190838", "url": "https://pubmed.ncbi.nlm.nih.gov/17190838" }, { "database": "PubMed", "id": "17220321", "url": "https://pubmed.ncbi.nlm.nih.gov/17220321" }, { "database": "PubMed", "id": "17287469", "url": "https://pubmed.ncbi.nlm.nih.gov/17287469" }, { "database": "PubMed", "id": "17339838", "url": "https://pubmed.ncbi.nlm.nih.gov/17339838" }, { "database": "PubMed", "id": "17371830", "url": "https://pubmed.ncbi.nlm.nih.gov/17371830" }, { "database": "PubMed", "id": "17924178", "url": "https://pubmed.ncbi.nlm.nih.gov/17924178" }, { "database": "PubMed", "id": "17967879", "url": "https://pubmed.ncbi.nlm.nih.gov/17967879" }, { "database": "PubMed", "id": "17977562", "url": "https://pubmed.ncbi.nlm.nih.gov/17977562" }, { "database": "PubMed", "id": "18171481", "url": "https://pubmed.ncbi.nlm.nih.gov/18171481" }, { "database": "PubMed", "id": "18177853", "url": "https://pubmed.ncbi.nlm.nih.gov/18177853" }, { "database": "PubMed", "id": "18332223", "url": "https://pubmed.ncbi.nlm.nih.gov/18332223" }, { "database": "PubMed", "id": "18757368", "url": "https://pubmed.ncbi.nlm.nih.gov/18757368" }, { "database": "PubMed", "id": "18952837", "url": "https://pubmed.ncbi.nlm.nih.gov/18952837" }, { "database": "PubMed", "id": "19047061", "url": "https://pubmed.ncbi.nlm.nih.gov/19047061" }, { "database": "PubMed", "id": "19065678", "url": "https://pubmed.ncbi.nlm.nih.gov/19065678" }, { "database": "PubMed", "id": "19077278", "url": "https://pubmed.ncbi.nlm.nih.gov/19077278" }, { "database": "PubMed", "id": "19369943", "url": "https://pubmed.ncbi.nlm.nih.gov/19369943" }, { "database": "PubMed", "id": "19432987", "url": "https://pubmed.ncbi.nlm.nih.gov/19432987" }, { "database": "PubMed", "id": "19587782", "url": "https://pubmed.ncbi.nlm.nih.gov/19587782" }, { "database": "PubMed", "id": "19627269", "url": "https://pubmed.ncbi.nlm.nih.gov/19627269" }, { "database": "PubMed", "id": "19657063", "url": "https://pubmed.ncbi.nlm.nih.gov/19657063" }, { "database": "PubMed", "id": "19731018", "url": "https://pubmed.ncbi.nlm.nih.gov/19731018" }, { "database": "PubMed", "id": "19761823", "url": "https://pubmed.ncbi.nlm.nih.gov/19761823" }, { "database": "PubMed", "id": "19761830", "url": "https://pubmed.ncbi.nlm.nih.gov/19761830" }, { "database": "PubMed", "id": "19844585", "url": "https://pubmed.ncbi.nlm.nih.gov/19844585" }, { "database": "PubMed", "id": "20028942", "url": "https://pubmed.ncbi.nlm.nih.gov/20028942" }, { "database": "PubMed", "id": "20103705", "url": "https://pubmed.ncbi.nlm.nih.gov/20103705" }, { "database": "PubMed", "id": "20179753", "url": "https://pubmed.ncbi.nlm.nih.gov/20179753" }, { "database": "PubMed", "id": "20188786", "url": "https://pubmed.ncbi.nlm.nih.gov/20188786" }, { "database": "PubMed", "id": "20333297", "url": "https://pubmed.ncbi.nlm.nih.gov/20333297" }, { "database": "PubMed", "id": "20363892", "url": "https://pubmed.ncbi.nlm.nih.gov/20363892" }, { "database": "PubMed", "id": "20386333", "url": "https://pubmed.ncbi.nlm.nih.gov/20386333" }, { "database": "PubMed", "id": "20586915", "url": "https://pubmed.ncbi.nlm.nih.gov/20586915" }, { "database": "PubMed", "id": "20587420", "url": "https://pubmed.ncbi.nlm.nih.gov/20587420" }, { "database": "PubMed", "id": "20622167", "url": "https://pubmed.ncbi.nlm.nih.gov/20622167" }, { "database": "PubMed", "id": "20661274", "url": "https://pubmed.ncbi.nlm.nih.gov/20661274" }, { "database": "PubMed", "id": "20719961", "url": "https://pubmed.ncbi.nlm.nih.gov/20719961" }, { "database": "PubMed", "id": "20847051", "url": "https://pubmed.ncbi.nlm.nih.gov/20847051" }, { "database": "PubMed", "id": "20971978", "url": "https://pubmed.ncbi.nlm.nih.gov/20971978" }, { "database": "PubMed", "id": "20976192", "url": "https://pubmed.ncbi.nlm.nih.gov/20976192" }, { "database": "PubMed", "id": "21266327", "url": "https://pubmed.ncbi.nlm.nih.gov/21266327" }, { "database": "PubMed", "id": "21571071", "url": "https://pubmed.ncbi.nlm.nih.gov/21571071" }, { "database": "PubMed", "id": "21642988", "url": "https://pubmed.ncbi.nlm.nih.gov/21642988" }, { "database": "PubMed", "id": "21655268", "url": "https://pubmed.ncbi.nlm.nih.gov/21655268" }, { "database": "PubMed", "id": "21670491", "url": "https://pubmed.ncbi.nlm.nih.gov/21670491" }, { "database": "PubMed", "id": "21859896", "url": "https://pubmed.ncbi.nlm.nih.gov/21859896" }, { "database": "PubMed", "id": "21906027", "url": "https://pubmed.ncbi.nlm.nih.gov/21906027" }, { "database": "PubMed", "id": "21926268", "url": "https://pubmed.ncbi.nlm.nih.gov/21926268" }, { "database": "PubMed", "id": "21927580", "url": "https://pubmed.ncbi.nlm.nih.gov/21927580" }, { "database": "PubMed", "id": "22019461", "url": "https://pubmed.ncbi.nlm.nih.gov/22019461" }, { "database": "PubMed", "id": "22028912", "url": "https://pubmed.ncbi.nlm.nih.gov/22028912" }, { "database": "PubMed", "id": "22117619", "url": "https://pubmed.ncbi.nlm.nih.gov/22117619" }, { "database": "PubMed", "id": "22132131", "url": "https://pubmed.ncbi.nlm.nih.gov/22132131" }, { "database": "PubMed", "id": "22184110", "url": "https://pubmed.ncbi.nlm.nih.gov/22184110" }, { "database": "PubMed", "id": "22218715", "url": "https://pubmed.ncbi.nlm.nih.gov/22218715" }, { "database": "PubMed", "id": "22253608", "url": "https://pubmed.ncbi.nlm.nih.gov/22253608" }, { "database": "PubMed", "id": "22359505", "url": "https://pubmed.ncbi.nlm.nih.gov/22359505" }, { "database": "PubMed", "id": "22403300", "url": "https://pubmed.ncbi.nlm.nih.gov/22403300" }, { "database": "PubMed", "id": "22412835", "url": "https://pubmed.ncbi.nlm.nih.gov/22412835" }, { "database": "PubMed", "id": "22412912", "url": "https://pubmed.ncbi.nlm.nih.gov/22412912" }, { "database": "PubMed", "id": "22418434", "url": "https://pubmed.ncbi.nlm.nih.gov/22418434" }, { "database": "PubMed", "id": "22428049", "url": "https://pubmed.ncbi.nlm.nih.gov/22428049" }, { "database": "PubMed", "id": "22476915", "url": "https://pubmed.ncbi.nlm.nih.gov/22476915" }, { "database": "PubMed", "id": "22496778", "url": "https://pubmed.ncbi.nlm.nih.gov/22496778" }, { "database": "PubMed", "id": "22586587", "url": "https://pubmed.ncbi.nlm.nih.gov/22586587" }, { "database": "PubMed", "id": "22606274", "url": "https://pubmed.ncbi.nlm.nih.gov/22606274" }, { "database": "PubMed", "id": "22652602", "url": "https://pubmed.ncbi.nlm.nih.gov/22652602" }, { "database": "PubMed", "id": "22685300", "url": "https://pubmed.ncbi.nlm.nih.gov/22685300" }, { "database": "PubMed", "id": "22693641", "url": "https://pubmed.ncbi.nlm.nih.gov/22693641" }, { "database": "PubMed", "id": "22710723", "url": "https://pubmed.ncbi.nlm.nih.gov/22710723" }, { "database": "PubMed", "id": "22733590", "url": "https://pubmed.ncbi.nlm.nih.gov/22733590" }, { "database": "PubMed", "id": "22773877", "url": "https://pubmed.ncbi.nlm.nih.gov/22773877" }, { "database": "PubMed", "id": "22792172", "url": "https://pubmed.ncbi.nlm.nih.gov/22792172" }, { "database": "PubMed", "id": "22832498", "url": "https://pubmed.ncbi.nlm.nih.gov/22832498" }, { "database": "PubMed", "id": "22933110", "url": "https://pubmed.ncbi.nlm.nih.gov/22933110" }, { "database": "PubMed", "id": "22941977", "url": "https://pubmed.ncbi.nlm.nih.gov/22941977" }, { "database": "PubMed", "id": "23029230", "url": "https://pubmed.ncbi.nlm.nih.gov/23029230" }, { "database": "PubMed", "id": "23049865", "url": "https://pubmed.ncbi.nlm.nih.gov/23049865" }, { "database": "PubMed", "id": "23071621", "url": "https://pubmed.ncbi.nlm.nih.gov/23071621" }, { "database": "PubMed", "id": "23239877", "url": "https://pubmed.ncbi.nlm.nih.gov/23239877" }, { "database": "PubMed", "id": "23251389", "url": "https://pubmed.ncbi.nlm.nih.gov/23251389" }, { "database": "PubMed", "id": "23251519", "url": "https://pubmed.ncbi.nlm.nih.gov/23251519" }, { "database": "PubMed", "id": "23275438", "url": "https://pubmed.ncbi.nlm.nih.gov/23275438" }, { "database": "PubMed", "id": "23311350", "url": "https://pubmed.ncbi.nlm.nih.gov/23311350" }, { "database": "PubMed", "id": "23386984", "url": "https://pubmed.ncbi.nlm.nih.gov/23386984" }, { "database": "PubMed", "id": "23390495", "url": "https://pubmed.ncbi.nlm.nih.gov/23390495" }, { "database": "PubMed", "id": "23444402", "url": "https://pubmed.ncbi.nlm.nih.gov/23444402" }, { "database": "PubMed", "id": "23451056", "url": "https://pubmed.ncbi.nlm.nih.gov/23451056" }, { "database": "PubMed", "id": "23469174", "url": "https://pubmed.ncbi.nlm.nih.gov/23469174" }, { "database": "PubMed", "id": "23493568", "url": "https://pubmed.ncbi.nlm.nih.gov/23493568" }, { "database": "PubMed", "id": "23554947", "url": "https://pubmed.ncbi.nlm.nih.gov/23554947" }, { "database": "PubMed", "id": "23593332", "url": "https://pubmed.ncbi.nlm.nih.gov/23593332" }, { "database": "PubMed", "id": "23622715", "url": "https://pubmed.ncbi.nlm.nih.gov/23622715" }, { "database": "PubMed", "id": "23671593", "url": "https://pubmed.ncbi.nlm.nih.gov/23671593" }, { "database": "PubMed", "id": "23716717", "url": "https://pubmed.ncbi.nlm.nih.gov/23716717" }, { "database": "PubMed", "id": "23750258", "url": "https://pubmed.ncbi.nlm.nih.gov/23750258" }, { "database": "PubMed", "id": "23874604", "url": "https://pubmed.ncbi.nlm.nih.gov/23874604" }, { "database": "PubMed", "id": "23907468", "url": "https://pubmed.ncbi.nlm.nih.gov/23907468" }, { "database": "PubMed", "id": "23935891", "url": "https://pubmed.ncbi.nlm.nih.gov/23935891" }, { "database": "PubMed", "id": "23940776", "url": "https://pubmed.ncbi.nlm.nih.gov/23940776" }, { "database": "PubMed", "id": "23964069", "url": "https://pubmed.ncbi.nlm.nih.gov/23964069" }, { "database": "PubMed", "id": "24068327", "url": "https://pubmed.ncbi.nlm.nih.gov/24068327" }, { "database": "PubMed", "id": "24068707", "url": "https://pubmed.ncbi.nlm.nih.gov/24068707" }, { "database": "PubMed", "id": "24101676", "url": "https://pubmed.ncbi.nlm.nih.gov/24101676" }, { "database": "PubMed", "id": "24116102", "url": "https://pubmed.ncbi.nlm.nih.gov/24116102" }, { "database": "PubMed", "id": "24126057", "url": "https://pubmed.ncbi.nlm.nih.gov/24126057" }, { "database": "PubMed", "id": "24150605", "url": "https://pubmed.ncbi.nlm.nih.gov/24150605" }, { "database": "PubMed", "id": "24156551", "url": "https://pubmed.ncbi.nlm.nih.gov/24156551" }, { "database": "PubMed", "id": "24280377", "url": "https://pubmed.ncbi.nlm.nih.gov/24280377" }, { "database": "PubMed", "id": "24280772", "url": "https://pubmed.ncbi.nlm.nih.gov/24280772" }, { "database": "PubMed", "id": "24286194", "url": "https://pubmed.ncbi.nlm.nih.gov/24286194" }, { "database": "PubMed", "id": "24340073", "url": "https://pubmed.ncbi.nlm.nih.gov/24340073" }, { "database": "PubMed", "id": "24349514", "url": "https://pubmed.ncbi.nlm.nih.gov/24349514" }, { "database": "PubMed", "id": "24351823", "url": "https://pubmed.ncbi.nlm.nih.gov/24351823" }, { "database": "PubMed", "id": "24434432", "url": "https://pubmed.ncbi.nlm.nih.gov/24434432" }, { "database": "PubMed", "id": "24435134", "url": "https://pubmed.ncbi.nlm.nih.gov/24435134" }, { "database": "PubMed", "id": "24505362", "url": "https://pubmed.ncbi.nlm.nih.gov/24505362" }, { "database": "PubMed", "id": "24621388", "url": "https://pubmed.ncbi.nlm.nih.gov/24621388" }, { "database": "PubMed", "id": "24647338", "url": "https://pubmed.ncbi.nlm.nih.gov/24647338" }, { "database": "PubMed", "id": "24649407", "url": "https://pubmed.ncbi.nlm.nih.gov/24649407" }, { "database": "PubMed", "id": "24662050", "url": "https://pubmed.ncbi.nlm.nih.gov/24662050" }, { "database": "PubMed", "id": "24670364", "url": "https://pubmed.ncbi.nlm.nih.gov/24670364" }, { "database": "PubMed", "id": "24670654", "url": "https://pubmed.ncbi.nlm.nih.gov/24670654" }, { "database": "PubMed", "id": "24722238", "url": "https://pubmed.ncbi.nlm.nih.gov/24722238" }, { "database": "PubMed", "id": "24734904", "url": "https://pubmed.ncbi.nlm.nih.gov/24734904" }, { "database": "PubMed", "id": "24740015", "url": "https://pubmed.ncbi.nlm.nih.gov/24740015" }, { "database": "PubMed", "id": "24775271", "url": "https://pubmed.ncbi.nlm.nih.gov/24775271" }, { "database": "PubMed", "id": "24810050", "url": "https://pubmed.ncbi.nlm.nih.gov/24810050" }, { "database": "PubMed", "id": "24944899", "url": "https://pubmed.ncbi.nlm.nih.gov/24944899" }, { "database": "PubMed", "id": "24945938", "url": "https://pubmed.ncbi.nlm.nih.gov/24945938" }, { "database": "PubMed", "id": "24967341", "url": "https://pubmed.ncbi.nlm.nih.gov/24967341" }, { "database": "PubMed", "id": "24987368", "url": "https://pubmed.ncbi.nlm.nih.gov/24987368" }, { "database": "PubMed", "id": "25056877", "url": "https://pubmed.ncbi.nlm.nih.gov/25056877" }, { "database": "PubMed", "id": "25084011", "url": "https://pubmed.ncbi.nlm.nih.gov/25084011" }, { "database": "PubMed", "id": "25132272", "url": "https://pubmed.ncbi.nlm.nih.gov/25132272" }, { "database": "PubMed", "id": "25162417", "url": "https://pubmed.ncbi.nlm.nih.gov/25162417" }, { "database": "PubMed", "id": "25214523", "url": "https://pubmed.ncbi.nlm.nih.gov/25214523" }, { "database": "PubMed", "id": "25221930", "url": "https://pubmed.ncbi.nlm.nih.gov/25221930" }, { "database": "PubMed", "id": "25332884", "url": "https://pubmed.ncbi.nlm.nih.gov/25332884" }, { "database": "PubMed", "id": "25336920", "url": "https://pubmed.ncbi.nlm.nih.gov/25336920" }, { "database": "PubMed", "id": "25377878", "url": "https://pubmed.ncbi.nlm.nih.gov/25377878" }, { "database": "PubMed", "id": "25379771", "url": "https://pubmed.ncbi.nlm.nih.gov/25379771" }, { "database": "PubMed", "id": "25394413", "url": "https://pubmed.ncbi.nlm.nih.gov/25394413" }, { "database": "PubMed", "id": "25398386", "url": "https://pubmed.ncbi.nlm.nih.gov/25398386" }, { "database": "PubMed", "id": "25415296", "url": "https://pubmed.ncbi.nlm.nih.gov/25415296" }, { "database": "PubMed", "id": "25463972", "url": "https://pubmed.ncbi.nlm.nih.gov/25463972" }, { "database": "PubMed", "id": "25531328", "url": "https://pubmed.ncbi.nlm.nih.gov/25531328" }, { "database": "PubMed", "id": "25546475", "url": "https://pubmed.ncbi.nlm.nih.gov/25546475" }, { "database": "PubMed", "id": "25558238", "url": "https://pubmed.ncbi.nlm.nih.gov/25558238" }, { "database": "PubMed", "id": "25568666", "url": "https://pubmed.ncbi.nlm.nih.gov/25568666" }, { "database": "PubMed", "id": "25594415", "url": "https://pubmed.ncbi.nlm.nih.gov/25594415" }, { "database": "PubMed", "id": "25606824", "url": "https://pubmed.ncbi.nlm.nih.gov/25606824" }, { "database": "PubMed", "id": "25646773", "url": "https://pubmed.ncbi.nlm.nih.gov/25646773" }, { "database": "PubMed", "id": "25752217", "url": "https://pubmed.ncbi.nlm.nih.gov/25752217" }, { "database": "PubMed", "id": "25780086", "url": "https://pubmed.ncbi.nlm.nih.gov/25780086" }, { "database": "PubMed", "id": "25790465", "url": "https://pubmed.ncbi.nlm.nih.gov/25790465" }, { "database": "PubMed", "id": "25799367", "url": "https://pubmed.ncbi.nlm.nih.gov/25799367" }, { "database": "PubMed", "id": "25808491", "url": "https://pubmed.ncbi.nlm.nih.gov/25808491" }, { "database": "PubMed", "id": "25826077", "url": "https://pubmed.ncbi.nlm.nih.gov/25826077" }, { "database": "PubMed", "id": "25826083", "url": "https://pubmed.ncbi.nlm.nih.gov/25826083" }, { "database": "PubMed", "id": "25853295", "url": "https://pubmed.ncbi.nlm.nih.gov/25853295" }, { "database": "PubMed", "id": "25880554", "url": "https://pubmed.ncbi.nlm.nih.gov/25880554" }, { "database": "PubMed", "id": "25888638", "url": "https://pubmed.ncbi.nlm.nih.gov/25888638" }, { "database": "PubMed", "id": "26121028", "url": "https://pubmed.ncbi.nlm.nih.gov/26121028" }, { "database": "PubMed", "id": "26249804", "url": "https://pubmed.ncbi.nlm.nih.gov/26249804" }, { "database": "PubMed", "id": "26263164", "url": "https://pubmed.ncbi.nlm.nih.gov/26263164" }, { "database": "PubMed", "id": "26278110", "url": "https://pubmed.ncbi.nlm.nih.gov/26278110" }, { "database": "PubMed", "id": "26412745", "url": "https://pubmed.ncbi.nlm.nih.gov/26412745" }, { "database": "PubMed", "id": "26438830", "url": "https://pubmed.ncbi.nlm.nih.gov/26438830" }, { "database": "PubMed", "id": "26491103", "url": "https://pubmed.ncbi.nlm.nih.gov/26491103" }, { "database": "PubMed", "id": "26503303", "url": "https://pubmed.ncbi.nlm.nih.gov/26503303" }, { "database": "PubMed", "id": "26503641", "url": "https://pubmed.ncbi.nlm.nih.gov/26503641" }, { "database": "PubMed", "id": "26553931", "url": "https://pubmed.ncbi.nlm.nih.gov/26553931" }, { "database": "PubMed", "id": "26554359", "url": "https://pubmed.ncbi.nlm.nih.gov/26554359" }, { "database": "PubMed", "id": "26687764", "url": "https://pubmed.ncbi.nlm.nih.gov/26687764" }, { "database": "PubMed", "id": "26720454", "url": "https://pubmed.ncbi.nlm.nih.gov/26720454" }, { "database": "PubMed", "id": "26743335", "url": "https://pubmed.ncbi.nlm.nih.gov/26743335" }, { "database": "PubMed", "id": "26809587", "url": "https://pubmed.ncbi.nlm.nih.gov/26809587" }, { "database": "PubMed", "id": "26813160", "url": "https://pubmed.ncbi.nlm.nih.gov/26813160" }, { "database": "PubMed", "id": "26872208", "url": "https://pubmed.ncbi.nlm.nih.gov/26872208" }, { "database": "PubMed", "id": "26876212", "url": "https://pubmed.ncbi.nlm.nih.gov/26876212" }, { "database": "PubMed", "id": "26880110", "url": "https://pubmed.ncbi.nlm.nih.gov/26880110" }, { "database": "PubMed", "id": "26909311", "url": "https://pubmed.ncbi.nlm.nih.gov/26909311" }, { "database": "PubMed", "id": "26928911", "url": "https://pubmed.ncbi.nlm.nih.gov/26928911" }, { "database": "PubMed", "id": "26959121", "url": "https://pubmed.ncbi.nlm.nih.gov/26959121" }, { "database": "PubMed", "id": "27000529", "url": "https://pubmed.ncbi.nlm.nih.gov/27000529" }, { "database": "PubMed", "id": "27001940", "url": "https://pubmed.ncbi.nlm.nih.gov/27001940" }, { "database": "PubMed", "id": "27009084", "url": "https://pubmed.ncbi.nlm.nih.gov/27009084" }, { "database": "PubMed", "id": "27070899", "url": "https://pubmed.ncbi.nlm.nih.gov/27070899" }, { "database": "PubMed", "id": "27099352", "url": "https://pubmed.ncbi.nlm.nih.gov/27099352" }, { "database": "PubMed", "id": "27127181", "url": "https://pubmed.ncbi.nlm.nih.gov/27127181" }, { "database": "PubMed", "id": "27167344", "url": "https://pubmed.ncbi.nlm.nih.gov/27167344" }, { "database": "PubMed", "id": "27176481", "url": "https://pubmed.ncbi.nlm.nih.gov/27176481" }, { "database": "PubMed", "id": "27197158", "url": "https://pubmed.ncbi.nlm.nih.gov/27197158" }, { "database": "PubMed", "id": "27226588", "url": "https://pubmed.ncbi.nlm.nih.gov/27226588" }, { "database": "PubMed", "id": "27248324", "url": "https://pubmed.ncbi.nlm.nih.gov/27248324" }, { "database": "PubMed", "id": "27253992", "url": "https://pubmed.ncbi.nlm.nih.gov/27253992" }, { "database": "PubMed", "id": "27257474", "url": "https://pubmed.ncbi.nlm.nih.gov/27257474" }, { "database": "PubMed", "id": "27344443", "url": "https://pubmed.ncbi.nlm.nih.gov/27344443" }, { "database": "PubMed", "id": "27384491", "url": "https://pubmed.ncbi.nlm.nih.gov/27384491" }, { "database": "PubMed", "id": "27412013", "url": "https://pubmed.ncbi.nlm.nih.gov/27412013" }, { "database": "PubMed", "id": "27477105", "url": "https://pubmed.ncbi.nlm.nih.gov/27477105" }, { "database": "PubMed", "id": "27485212", "url": "https://pubmed.ncbi.nlm.nih.gov/27485212" }, { "database": "PubMed", "id": "27534430", "url": "https://pubmed.ncbi.nlm.nih.gov/27534430" }, { "database": "PubMed", "id": "27542970", "url": "https://pubmed.ncbi.nlm.nih.gov/27542970" }, { "database": "PubMed", "id": "27689988", "url": "https://pubmed.ncbi.nlm.nih.gov/27689988" }, { "database": "PubMed", "id": "27734117", "url": "https://pubmed.ncbi.nlm.nih.gov/27734117" }, { "database": "PubMed", "id": "27765055", "url": "https://pubmed.ncbi.nlm.nih.gov/27765055" }, { "database": "PubMed", "id": "27876711", "url": "https://pubmed.ncbi.nlm.nih.gov/27876711" }, { "database": "PubMed", "id": "27893783", "url": "https://pubmed.ncbi.nlm.nih.gov/27893783" }, { "database": "PubMed", "id": "28018219", "url": "https://pubmed.ncbi.nlm.nih.gov/28018219" }, { "database": "PubMed", "id": "28086800", "url": "https://pubmed.ncbi.nlm.nih.gov/28086800" }, { "database": "PubMed", "id": "28123341", "url": "https://pubmed.ncbi.nlm.nih.gov/28123341" }, { "database": "PubMed", "id": "28123943", "url": "https://pubmed.ncbi.nlm.nih.gov/28123943" }, { "database": "PubMed", "id": "28152035", "url": "https://pubmed.ncbi.nlm.nih.gov/28152035" }, { "database": "PubMed", "id": "28209968", "url": "https://pubmed.ncbi.nlm.nih.gov/28209968" }, { "database": "PubMed", "id": "28225038", "url": "https://pubmed.ncbi.nlm.nih.gov/28225038" }, { "database": "PubMed", "id": "28243164", "url": "https://pubmed.ncbi.nlm.nih.gov/28243164" }, { "database": "PubMed", "id": "28264587", "url": "https://pubmed.ncbi.nlm.nih.gov/28264587" }, { "database": "PubMed", "id": "28294959", "url": "https://pubmed.ncbi.nlm.nih.gov/28294959" }, { "database": "PubMed", "id": "28322786", "url": "https://pubmed.ncbi.nlm.nih.gov/28322786" }, { "database": "PubMed", "id": "28346493", "url": "https://pubmed.ncbi.nlm.nih.gov/28346493" }, { "database": "PubMed", "id": "28350865", "url": "https://pubmed.ncbi.nlm.nih.gov/28350865" }, { "database": "PubMed", "id": "28368423", "url": "https://pubmed.ncbi.nlm.nih.gov/28368423" }, { "database": "PubMed", "id": "28386126", "url": "https://pubmed.ncbi.nlm.nih.gov/28386126" }, { "database": "PubMed", "id": "28395173", "url": "https://pubmed.ncbi.nlm.nih.gov/28395173" }, { "database": "PubMed", "id": "28424421", "url": "https://pubmed.ncbi.nlm.nih.gov/28424421" }, { "database": "PubMed", "id": "28426713", "url": "https://pubmed.ncbi.nlm.nih.gov/28426713" }, { "database": "PubMed", "id": "28440748", "url": "https://pubmed.ncbi.nlm.nih.gov/28440748" }, { "database": "PubMed", "id": "28560349", "url": "https://pubmed.ncbi.nlm.nih.gov/28560349" }, { "database": "PubMed", "id": "28591208", "url": "https://pubmed.ncbi.nlm.nih.gov/28591208" }, { "database": "PubMed", "id": "28665395", "url": "https://pubmed.ncbi.nlm.nih.gov/28665395" }, { "database": "PubMed", "id": "28759639", "url": "https://pubmed.ncbi.nlm.nih.gov/28759639" }, { "database": "PubMed", "id": "28821740", "url": "https://pubmed.ncbi.nlm.nih.gov/28821740" }, { "database": "PubMed", "id": "28874678", "url": "https://pubmed.ncbi.nlm.nih.gov/28874678" }, { "database": "PubMed", "id": "28875936", "url": "https://pubmed.ncbi.nlm.nih.gov/28875936" }, { "database": "PubMed", "id": "28878342", "url": "https://pubmed.ncbi.nlm.nih.gov/28878342" }, { "database": "PubMed", "id": "28883758", "url": "https://pubmed.ncbi.nlm.nih.gov/28883758" }, { "database": "PubMed", "id": "28933316", "url": "https://pubmed.ncbi.nlm.nih.gov/28933316" }, { "database": "PubMed", "id": "28987868", "url": "https://pubmed.ncbi.nlm.nih.gov/28987868" }, { "database": "PubMed", "id": "29057818", "url": "https://pubmed.ncbi.nlm.nih.gov/29057818" }, { "database": "PubMed", "id": "29109428", "url": "https://pubmed.ncbi.nlm.nih.gov/29109428" }, { "database": "PubMed", "id": "29118722", "url": "https://pubmed.ncbi.nlm.nih.gov/29118722" }, { "database": "PubMed", "id": "29121094", "url": "https://pubmed.ncbi.nlm.nih.gov/29121094" }, { "database": "PubMed", "id": "29159980", "url": "https://pubmed.ncbi.nlm.nih.gov/29159980" }, { "database": "PubMed", "id": "29180704", "url": "https://pubmed.ncbi.nlm.nih.gov/29180704" }, { "database": "PubMed", "id": "29184057", "url": "https://pubmed.ncbi.nlm.nih.gov/29184057" }, { "database": "PubMed", "id": "29241457", "url": "https://pubmed.ncbi.nlm.nih.gov/29241457" }, { "database": "PubMed", "id": "29311937", "url": "https://pubmed.ncbi.nlm.nih.gov/29311937" }, { "database": "PubMed", "id": "29358916", "url": "https://pubmed.ncbi.nlm.nih.gov/29358916" }, { "database": "PubMed", "id": "29433422", "url": "https://pubmed.ncbi.nlm.nih.gov/29433422" }, { "database": "PubMed", "id": "29453154", "url": "https://pubmed.ncbi.nlm.nih.gov/29453154" }, { "database": "PubMed", "id": "29472543", "url": "https://pubmed.ncbi.nlm.nih.gov/29472543" }, { "database": "PubMed", "id": "29487597", "url": "https://pubmed.ncbi.nlm.nih.gov/29487597" }, { "database": "PubMed", "id": "29494346", "url": "https://pubmed.ncbi.nlm.nih.gov/29494346" }, { "database": "PubMed", "id": "29500670", "url": "https://pubmed.ncbi.nlm.nih.gov/29500670" }, { "database": "PubMed", "id": "29535623", "url": "https://pubmed.ncbi.nlm.nih.gov/29535623" }, { "database": "PubMed", "id": "29560100", "url": "https://pubmed.ncbi.nlm.nih.gov/29560100" }, { "database": "PubMed", "id": "29662189", "url": "https://pubmed.ncbi.nlm.nih.gov/29662189" }, { "database": "PubMed", "id": "29700562", "url": "https://pubmed.ncbi.nlm.nih.gov/29700562" }, { "database": "PubMed", "id": "29725001", "url": "https://pubmed.ncbi.nlm.nih.gov/29725001" }, { "database": "PubMed", "id": "29769144", "url": "https://pubmed.ncbi.nlm.nih.gov/29769144" }, { "database": "PubMed", "id": "29853881", "url": "https://pubmed.ncbi.nlm.nih.gov/29853881" }, { "database": "PubMed", "id": "29855474", "url": "https://pubmed.ncbi.nlm.nih.gov/29855474" }, { "database": "PubMed", "id": "29860106", "url": "https://pubmed.ncbi.nlm.nih.gov/29860106" }, { "database": "PubMed", "id": "29867489", "url": "https://pubmed.ncbi.nlm.nih.gov/29867489" }, { "database": "PubMed", "id": "29872253", "url": "https://pubmed.ncbi.nlm.nih.gov/29872253" }, { "database": "PubMed", "id": "29920520", "url": "https://pubmed.ncbi.nlm.nih.gov/29920520" }, { "database": "PubMed", "id": "29930536", "url": "https://pubmed.ncbi.nlm.nih.gov/29930536" }, { "database": "PubMed", "id": "29962852", "url": "https://pubmed.ncbi.nlm.nih.gov/29962852" }, { "database": "PubMed", "id": "30018139", "url": "https://pubmed.ncbi.nlm.nih.gov/30018139" }, { "database": "PubMed", "id": "30065170", "url": "https://pubmed.ncbi.nlm.nih.gov/30065170" }, { "database": "PubMed", "id": "30103648", "url": "https://pubmed.ncbi.nlm.nih.gov/30103648" }, { "database": "PubMed", "id": "30211334", "url": "https://pubmed.ncbi.nlm.nih.gov/30211334" }, { "database": "PubMed", "id": "30237867", "url": "https://pubmed.ncbi.nlm.nih.gov/30237867" }, { "database": "PubMed", "id": "30279732", "url": "https://pubmed.ncbi.nlm.nih.gov/30279732" }, { "database": "PubMed", "id": "30384400", "url": "https://pubmed.ncbi.nlm.nih.gov/30384400" }, { "database": "PubMed", "id": "30391964", "url": "https://pubmed.ncbi.nlm.nih.gov/30391964" }, { "database": "PubMed", "id": "30413815", "url": "https://pubmed.ncbi.nlm.nih.gov/30413815" }, { "database": "PubMed", "id": "30429249", "url": "https://pubmed.ncbi.nlm.nih.gov/30429249" }, { "database": "PubMed", "id": "30442153", "url": "https://pubmed.ncbi.nlm.nih.gov/30442153" }, { "database": "PubMed", "id": "30578122", "url": "https://pubmed.ncbi.nlm.nih.gov/30578122" }, { "database": "PubMed", "id": "30635036", "url": "https://pubmed.ncbi.nlm.nih.gov/30635036" }, { "database": "PubMed", "id": "30696333", "url": "https://pubmed.ncbi.nlm.nih.gov/30696333" }, { "database": "PubMed", "id": "30823934", "url": "https://pubmed.ncbi.nlm.nih.gov/30823934" }, { "database": "PubMed", "id": "30988282", "url": "https://pubmed.ncbi.nlm.nih.gov/30988282" }, { "database": "PubMed", "id": "31112530", "url": "https://pubmed.ncbi.nlm.nih.gov/31112530" }, { "database": "PubMed", "id": "31141608", "url": "https://pubmed.ncbi.nlm.nih.gov/31141608" }, { "database": "PubMed", "id": "31182807", "url": "https://pubmed.ncbi.nlm.nih.gov/31182807" }, { "database": "PubMed", "id": "31246957", "url": "https://pubmed.ncbi.nlm.nih.gov/31246957" }, { "database": "PubMed", "id": "31307481", "url": "https://pubmed.ncbi.nlm.nih.gov/31307481" }, { "database": "PubMed", "id": "31337981", "url": "https://pubmed.ncbi.nlm.nih.gov/31337981" }, { "database": "PubMed", "id": "31398213", "url": "https://pubmed.ncbi.nlm.nih.gov/31398213" }, { "database": "PubMed", "id": "31399584", "url": "https://pubmed.ncbi.nlm.nih.gov/31399584" }, { "database": "PubMed", "id": "31420304", "url": "https://pubmed.ncbi.nlm.nih.gov/31420304" }, { "database": "PubMed", "id": "31470507", "url": "https://pubmed.ncbi.nlm.nih.gov/31470507" }, { "database": "PubMed", "id": "31474552", "url": "https://pubmed.ncbi.nlm.nih.gov/31474552" }, { "database": "PubMed", "id": "31534518", "url": "https://pubmed.ncbi.nlm.nih.gov/31534518" }, { "database": "PubMed", "id": "31570855", "url": "https://pubmed.ncbi.nlm.nih.gov/31570855" }, { "database": "PubMed", "id": "31614949", "url": "https://pubmed.ncbi.nlm.nih.gov/31614949" }, { "database": "PubMed", "id": "31652791", "url": "https://pubmed.ncbi.nlm.nih.gov/31652791" }, { "database": "PubMed", "id": "31767175", "url": "https://pubmed.ncbi.nlm.nih.gov/31767175" }, { "database": "PubMed", "id": "31767180", "url": "https://pubmed.ncbi.nlm.nih.gov/31767180" }, { "database": "PubMed", "id": "31918924", "url": "https://pubmed.ncbi.nlm.nih.gov/31918924" }, { "database": "PubMed", "id": "31924750", "url": "https://pubmed.ncbi.nlm.nih.gov/31924750" }, { "database": "PubMed", "id": "31949275", "url": "https://pubmed.ncbi.nlm.nih.gov/31949275" }, { "database": "PubMed", "id": "32046324", "url": "https://pubmed.ncbi.nlm.nih.gov/32046324" }, { "database": "PubMed", "id": "32075060", "url": "https://pubmed.ncbi.nlm.nih.gov/32075060" }, { "database": "PubMed", "id": "32101748", "url": "https://pubmed.ncbi.nlm.nih.gov/32101748" }, { "database": "PubMed", "id": "32153410", "url": "https://pubmed.ncbi.nlm.nih.gov/32153410" }, { "database": "PubMed", "id": "32163656", "url": "https://pubmed.ncbi.nlm.nih.gov/32163656" }, { "database": "PubMed", "id": "32194423", "url": "https://pubmed.ncbi.nlm.nih.gov/32194423" }, { "database": "PubMed", "id": "32312949", "url": "https://pubmed.ncbi.nlm.nih.gov/32312949" }, { "database": "PubMed", "id": "32366272", "url": "https://pubmed.ncbi.nlm.nih.gov/32366272" }, { "database": "PubMed", "id": "32373532", "url": "https://pubmed.ncbi.nlm.nih.gov/32373532" }, { "database": "PubMed", "id": "32422541", "url": "https://pubmed.ncbi.nlm.nih.gov/32422541" }, { "database": "PubMed", "id": "32483262", "url": "https://pubmed.ncbi.nlm.nih.gov/32483262" }, { "database": "PubMed", "id": "32493400", "url": "https://pubmed.ncbi.nlm.nih.gov/32493400" }, { "database": "PubMed", "id": "32518366", "url": "https://pubmed.ncbi.nlm.nih.gov/32518366" }, { "database": "PubMed", "id": "32566257", "url": "https://pubmed.ncbi.nlm.nih.gov/32566257" }, { "database": "PubMed", "id": "32641498", "url": "https://pubmed.ncbi.nlm.nih.gov/32641498" }, { "database": "PubMed", "id": "32728173", "url": "https://pubmed.ncbi.nlm.nih.gov/32728173" }, { "database": "PubMed", "id": "32783890", "url": "https://pubmed.ncbi.nlm.nih.gov/32783890" }, { "database": "PubMed", "id": "32796834", "url": "https://pubmed.ncbi.nlm.nih.gov/32796834" }, { "database": "PubMed", "id": "32859869", "url": "https://pubmed.ncbi.nlm.nih.gov/32859869" }, { "database": "PubMed", "id": "33012785", "url": "https://pubmed.ncbi.nlm.nih.gov/33012785" }, { "database": "PubMed", "id": "33038070", "url": "https://pubmed.ncbi.nlm.nih.gov/33038070" }, { "database": "PubMed", "id": "33071755", "url": "https://pubmed.ncbi.nlm.nih.gov/33071755" }, { "database": "PubMed", "id": "33177089", "url": "https://pubmed.ncbi.nlm.nih.gov/33177089" }, { "database": "PubMed", "id": "33184378", "url": "https://pubmed.ncbi.nlm.nih.gov/33184378" }, { "database": "PubMed", "id": "33184414", "url": "https://pubmed.ncbi.nlm.nih.gov/33184414" }, { "database": "PubMed", "id": "33210868", "url": "https://pubmed.ncbi.nlm.nih.gov/33210868" }, { "database": "PubMed", "id": "33214645", "url": "https://pubmed.ncbi.nlm.nih.gov/33214645" }, { "database": "PubMed", "id": "33226552", "url": "https://pubmed.ncbi.nlm.nih.gov/33226552" }, { "database": "PubMed", "id": "33275593", "url": "https://pubmed.ncbi.nlm.nih.gov/33275593" }, { "database": "PubMed", "id": "33348907", "url": "https://pubmed.ncbi.nlm.nih.gov/33348907" }, { "database": "PubMed", "id": "33413592", "url": "https://pubmed.ncbi.nlm.nih.gov/33413592" }, { "database": "PubMed", "id": "33414476", "url": "https://pubmed.ncbi.nlm.nih.gov/33414476" }, { "database": "PubMed", "id": "33435535", "url": "https://pubmed.ncbi.nlm.nih.gov/33435535" }, { "database": "PubMed", "id": "33486894", "url": "https://pubmed.ncbi.nlm.nih.gov/33486894" }, { "database": "PubMed", "id": "33500390", "url": "https://pubmed.ncbi.nlm.nih.gov/33500390" }, { "database": "PubMed", "id": "33595435", "url": "https://pubmed.ncbi.nlm.nih.gov/33595435" }, { "database": "PubMed", "id": "33629064", "url": "https://pubmed.ncbi.nlm.nih.gov/33629064" }, { "database": "PubMed", "id": "33633735", "url": "https://pubmed.ncbi.nlm.nih.gov/33633735" }, { "database": "PubMed", "id": "33649479", "url": "https://pubmed.ncbi.nlm.nih.gov/33649479" }, { "database": "PubMed", "id": "33669811", "url": "https://pubmed.ncbi.nlm.nih.gov/33669811" }, { "database": "PubMed", "id": "33869980", "url": "https://pubmed.ncbi.nlm.nih.gov/33869980" }, { "database": "PubMed", "id": "33897895", "url": "https://pubmed.ncbi.nlm.nih.gov/33897895" }, { "database": "PubMed", "id": "33931442", "url": "https://pubmed.ncbi.nlm.nih.gov/33931442" }, { "database": "PubMed", "id": "33941789", "url": "https://pubmed.ncbi.nlm.nih.gov/33941789" }, { "database": "PubMed", "id": "33993653", "url": "https://pubmed.ncbi.nlm.nih.gov/33993653" }, { "database": "PubMed", "id": "34366869", "url": "https://pubmed.ncbi.nlm.nih.gov/34366869" }, { "database": "PubMed", "id": "35122865", "url": "https://pubmed.ncbi.nlm.nih.gov/35122865" }, { "database": "PubMed", "id": "35224167", "url": "https://pubmed.ncbi.nlm.nih.gov/35224167" }, { "database": "PubMed", "id": "35477177", "url": "https://pubmed.ncbi.nlm.nih.gov/35477177" }, { "database": "PubMed", "id": "35748215", "url": "https://pubmed.ncbi.nlm.nih.gov/35748215" }, { "database": "PubMed", "id": "36148310", "url": "https://pubmed.ncbi.nlm.nih.gov/36148310" }, { "database": "PubMed", "id": "36198369", "url": "https://pubmed.ncbi.nlm.nih.gov/36198369" }, { "database": "PubMed", "id": "36297523", "url": "https://pubmed.ncbi.nlm.nih.gov/36297523" }, { "database": "PubMed", "id": "36405694", "url": "https://pubmed.ncbi.nlm.nih.gov/36405694" }, { "database": "PubMed", "id": "9927197", "url": "https://pubmed.ncbi.nlm.nih.gov/9927197" }, { "database": "PubMed", "id": "18288188", "url": "https://pubmed.ncbi.nlm.nih.gov/18288188" }, { "database": "PubMed", "id": "26359501", "url": "https://pubmed.ncbi.nlm.nih.gov/26359501" }, { "database": "PubMed", "id": "15753085", "url": "https://pubmed.ncbi.nlm.nih.gov/15753085" } ], "site_lbl": "Thr308", "uniprot_canonical_ac": "P31750-1" }, { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by IKKE, MTOR, PRKDC and TBK1; alternate", "evidence": [ { "database": "UniProtKB", "id": "P31750", "url": "https://www.uniprot.org/uniprotkb/P31750" }, { "database": "PRO", "id": "P31750", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P31750" }, { "database": "iPTMnet", "id": "P31750", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31750" }, { "database": "PubMed", "id": "27994061", "url": "https://pubmed.ncbi.nlm.nih.gov/27994061" }, { "database": "PubMed", "id": "31915252", "url": "https://pubmed.ncbi.nlm.nih.gov/31915252" }, { "database": "PubMed", "id": "10438924", "url": "https://pubmed.ncbi.nlm.nih.gov/10438924" }, { "database": "PubMed", "id": "10597260", "url": "https://pubmed.ncbi.nlm.nih.gov/10597260" }, { "database": "PubMed", "id": "10714768", "url": "https://pubmed.ncbi.nlm.nih.gov/10714768" }, { "database": "PubMed", "id": "10747954", "url": "https://pubmed.ncbi.nlm.nih.gov/10747954" }, { "database": "PubMed", "id": "10811865", "url": "https://pubmed.ncbi.nlm.nih.gov/10811865" }, { "database": "PubMed", "id": "10969078", "url": "https://pubmed.ncbi.nlm.nih.gov/10969078" }, { "database": "PubMed", "id": "10974038", "url": "https://pubmed.ncbi.nlm.nih.gov/10974038" }, { "database": "PubMed", "id": "11006271", "url": "https://pubmed.ncbi.nlm.nih.gov/11006271" }, { "database": "PubMed", "id": "11018758", "url": "https://pubmed.ncbi.nlm.nih.gov/11018758" }, { "database": "PubMed", "id": "11062251", "url": "https://pubmed.ncbi.nlm.nih.gov/11062251" }, { "database": "PubMed", "id": "11507090", "url": "https://pubmed.ncbi.nlm.nih.gov/11507090" }, { "database": "PubMed", "id": "11563975", "url": "https://pubmed.ncbi.nlm.nih.gov/11563975" }, { "database": "PubMed", "id": "11571285", "url": "https://pubmed.ncbi.nlm.nih.gov/11571285" }, { "database": "PubMed", "id": "11740206", "url": "https://pubmed.ncbi.nlm.nih.gov/11740206" }, { "database": "PubMed", "id": "11950275", "url": "https://pubmed.ncbi.nlm.nih.gov/11950275" }, { "database": "PubMed", "id": "12153489", "url": "https://pubmed.ncbi.nlm.nih.gov/12153489" }, { "database": "PubMed", "id": "12190109", "url": "https://pubmed.ncbi.nlm.nih.gov/12190109" }, { "database": "PubMed", "id": "12464394", "url": "https://pubmed.ncbi.nlm.nih.gov/12464394" }, { "database": "PubMed", "id": "12493740", "url": "https://pubmed.ncbi.nlm.nih.gov/12493740" }, { "database": "PubMed", "id": "12529330", "url": "https://pubmed.ncbi.nlm.nih.gov/12529330" }, { "database": "PubMed", "id": "12633505", "url": "https://pubmed.ncbi.nlm.nih.gov/12633505" }, { "database": "PubMed", "id": "12637511", "url": "https://pubmed.ncbi.nlm.nih.gov/12637511" }, { "database": "PubMed", "id": "12875741", "url": "https://pubmed.ncbi.nlm.nih.gov/12875741" }, { "database": "PubMed", "id": "12911789", "url": "https://pubmed.ncbi.nlm.nih.gov/12911789" }, { "database": "PubMed", "id": "12947100", "url": "https://pubmed.ncbi.nlm.nih.gov/12947100" }, { "database": "PubMed", "id": "14581607", "url": "https://pubmed.ncbi.nlm.nih.gov/14581607" }, { "database": "PubMed", "id": "14603261", "url": "https://pubmed.ncbi.nlm.nih.gov/14603261" }, { "database": "PubMed", "id": "14623889", "url": "https://pubmed.ncbi.nlm.nih.gov/14623889" }, { "database": "PubMed", "id": "14657000", "url": "https://pubmed.ncbi.nlm.nih.gov/14657000" }, { "database": "PubMed", "id": "14997210", "url": "https://pubmed.ncbi.nlm.nih.gov/14997210" }, { "database": "PubMed", "id": "15067018", "url": "https://pubmed.ncbi.nlm.nih.gov/15067018" }, { "database": "PubMed", "id": "15070431", "url": "https://pubmed.ncbi.nlm.nih.gov/15070431" }, { "database": "PubMed", "id": "15278907", "url": "https://pubmed.ncbi.nlm.nih.gov/15278907" }, { "database": "PubMed", "id": "15389876", "url": "https://pubmed.ncbi.nlm.nih.gov/15389876" }, { "database": "PubMed", "id": "15504738", "url": "https://pubmed.ncbi.nlm.nih.gov/15504738" }, { "database": "PubMed", "id": "15505117", "url": "https://pubmed.ncbi.nlm.nih.gov/15505117" }, { "database": "PubMed", "id": "15517884", "url": "https://pubmed.ncbi.nlm.nih.gov/15517884" }, { "database": "PubMed", "id": "15550174", "url": "https://pubmed.ncbi.nlm.nih.gov/15550174" }, { "database": "PubMed", "id": "15591229", "url": "https://pubmed.ncbi.nlm.nih.gov/15591229" }, { "database": "PubMed", "id": "15692086", "url": "https://pubmed.ncbi.nlm.nih.gov/15692086" }, { "database": "PubMed", "id": "15842198", "url": "https://pubmed.ncbi.nlm.nih.gov/15842198" }, { "database": "PubMed", "id": "15845623", "url": "https://pubmed.ncbi.nlm.nih.gov/15845623" }, { "database": "PubMed", "id": "15920762", "url": "https://pubmed.ncbi.nlm.nih.gov/15920762" }, { "database": "PubMed", "id": "15935620", "url": "https://pubmed.ncbi.nlm.nih.gov/15935620" }, { "database": "PubMed", "id": "15987432", "url": "https://pubmed.ncbi.nlm.nih.gov/15987432" }, { "database": "PubMed", "id": "16180585", "url": "https://pubmed.ncbi.nlm.nih.gov/16180585" }, { "database": "PubMed", "id": "16314534", "url": "https://pubmed.ncbi.nlm.nih.gov/16314534" }, { "database": "PubMed", "id": "16338928", "url": "https://pubmed.ncbi.nlm.nih.gov/16338928" }, { "database": "PubMed", "id": "16338957", "url": "https://pubmed.ncbi.nlm.nih.gov/16338957" }, { "database": "PubMed", "id": "16397046", "url": "https://pubmed.ncbi.nlm.nih.gov/16397046" }, { "database": "PubMed", "id": "16489037", "url": "https://pubmed.ncbi.nlm.nih.gov/16489037" }, { "database": "PubMed", "id": "16512910", "url": "https://pubmed.ncbi.nlm.nih.gov/16512910" }, { "database": "PubMed", "id": "16618793", "url": "https://pubmed.ncbi.nlm.nih.gov/16618793" }, { "database": "PubMed", "id": "16787946", "url": "https://pubmed.ncbi.nlm.nih.gov/16787946" }, { "database": "PubMed", "id": "16809629", "url": "https://pubmed.ncbi.nlm.nih.gov/16809629" }, { "database": "PubMed", "id": "16831409", "url": "https://pubmed.ncbi.nlm.nih.gov/16831409" }, { "database": "PubMed", "id": "16845229", "url": "https://pubmed.ncbi.nlm.nih.gov/16845229" }, { "database": "PubMed", "id": "16872509", "url": "https://pubmed.ncbi.nlm.nih.gov/16872509" }, { "database": "PubMed", "id": "17000928", "url": "https://pubmed.ncbi.nlm.nih.gov/17000928" }, { "database": "PubMed", "id": "17190838", "url": "https://pubmed.ncbi.nlm.nih.gov/17190838" }, { "database": "PubMed", "id": "17195063", "url": "https://pubmed.ncbi.nlm.nih.gov/17195063" }, { "database": "PubMed", "id": "17210832", "url": "https://pubmed.ncbi.nlm.nih.gov/17210832" }, { "database": "PubMed", "id": "17220321", "url": "https://pubmed.ncbi.nlm.nih.gov/17220321" }, { "database": "PubMed", "id": "17359956", "url": "https://pubmed.ncbi.nlm.nih.gov/17359956" }, { "database": "PubMed", "id": "17409645", "url": "https://pubmed.ncbi.nlm.nih.gov/17409645" }, { "database": "PubMed", "id": "17482757", "url": "https://pubmed.ncbi.nlm.nih.gov/17482757" }, { "database": "PubMed", "id": "17629407", "url": "https://pubmed.ncbi.nlm.nih.gov/17629407" }, { "database": "PubMed", "id": "17634444", "url": "https://pubmed.ncbi.nlm.nih.gov/17634444" }, { "database": "PubMed", "id": "17761767", "url": "https://pubmed.ncbi.nlm.nih.gov/17761767" }, { "database": "PubMed", "id": "17924178", "url": "https://pubmed.ncbi.nlm.nih.gov/17924178" }, { "database": "PubMed", "id": "17960162", "url": "https://pubmed.ncbi.nlm.nih.gov/17960162" }, { "database": "PubMed", "id": "17967879", "url": "https://pubmed.ncbi.nlm.nih.gov/17967879" }, { "database": "PubMed", "id": "17977562", "url": "https://pubmed.ncbi.nlm.nih.gov/17977562" }, { "database": "PubMed", "id": "17981597", "url": "https://pubmed.ncbi.nlm.nih.gov/17981597" }, { "database": "PubMed", "id": "18034303", "url": "https://pubmed.ncbi.nlm.nih.gov/18034303" }, { "database": "PubMed", "id": "18086904", "url": "https://pubmed.ncbi.nlm.nih.gov/18086904" }, { "database": "PubMed", "id": "18171481", "url": "https://pubmed.ncbi.nlm.nih.gov/18171481" }, { "database": "PubMed", "id": "18177853", "url": "https://pubmed.ncbi.nlm.nih.gov/18177853" }, { "database": "PubMed", "id": "18198353", "url": "https://pubmed.ncbi.nlm.nih.gov/18198353" }, { "database": "PubMed", "id": "18209096", "url": "https://pubmed.ncbi.nlm.nih.gov/18209096" }, { "database": "PubMed", "id": "18241357", "url": "https://pubmed.ncbi.nlm.nih.gov/18241357" }, { "database": "PubMed", "id": "18276828", "url": "https://pubmed.ncbi.nlm.nih.gov/18276828" }, { "database": "PubMed", "id": "18288891", "url": "https://pubmed.ncbi.nlm.nih.gov/18288891" }, { "database": "PubMed", "id": "18332223", "url": "https://pubmed.ncbi.nlm.nih.gov/18332223" }, { "database": "PubMed", "id": "18350159", "url": "https://pubmed.ncbi.nlm.nih.gov/18350159" }, { "database": "PubMed", "id": "18391484", "url": "https://pubmed.ncbi.nlm.nih.gov/18391484" }, { "database": "PubMed", "id": "18405384", "url": "https://pubmed.ncbi.nlm.nih.gov/18405384" }, { "database": "PubMed", "id": "18411306", "url": "https://pubmed.ncbi.nlm.nih.gov/18411306" }, { "database": "PubMed", "id": "18461163", "url": "https://pubmed.ncbi.nlm.nih.gov/18461163" }, { "database": "PubMed", "id": "18523362", "url": "https://pubmed.ncbi.nlm.nih.gov/18523362" }, { "database": "PubMed", "id": "18566543", "url": "https://pubmed.ncbi.nlm.nih.gov/18566543" }, { "database": "PubMed", "id": "18570920", "url": "https://pubmed.ncbi.nlm.nih.gov/18570920" }, { "database": "PubMed", "id": "18714386", "url": "https://pubmed.ncbi.nlm.nih.gov/18714386" }, { "database": "PubMed", "id": "18718531", "url": "https://pubmed.ncbi.nlm.nih.gov/18718531" }, { "database": "PubMed", "id": "18757368", "url": "https://pubmed.ncbi.nlm.nih.gov/18757368" }, { "database": "PubMed", "id": "18952837", "url": "https://pubmed.ncbi.nlm.nih.gov/18952837" }, { "database": "PubMed", "id": "19013131", "url": "https://pubmed.ncbi.nlm.nih.gov/19013131" }, { "database": "PubMed", "id": "19033447", "url": "https://pubmed.ncbi.nlm.nih.gov/19033447" }, { "database": "PubMed", "id": "19066318", "url": "https://pubmed.ncbi.nlm.nih.gov/19066318" }, { "database": "PubMed", "id": "19077278", "url": "https://pubmed.ncbi.nlm.nih.gov/19077278" }, { "database": "PubMed", "id": "19136654", "url": "https://pubmed.ncbi.nlm.nih.gov/19136654" }, { "database": "PubMed", "id": "19246681", "url": "https://pubmed.ncbi.nlm.nih.gov/19246681" }, { "database": "PubMed", "id": "19289601", "url": "https://pubmed.ncbi.nlm.nih.gov/19289601" }, { "database": "PubMed", "id": "19291319", "url": "https://pubmed.ncbi.nlm.nih.gov/19291319" }, { "database": "PubMed", "id": "19365570", "url": "https://pubmed.ncbi.nlm.nih.gov/19365570" }, { "database": "PubMed", "id": "19369943", "url": "https://pubmed.ncbi.nlm.nih.gov/19369943" }, { "database": "PubMed", "id": "19416348", "url": "https://pubmed.ncbi.nlm.nih.gov/19416348" }, { "database": "PubMed", "id": "19432987", "url": "https://pubmed.ncbi.nlm.nih.gov/19432987" }, { "database": "PubMed", "id": "19434632", "url": "https://pubmed.ncbi.nlm.nih.gov/19434632" }, { "database": "PubMed", "id": "19497867", "url": "https://pubmed.ncbi.nlm.nih.gov/19497867" }, { "database": "PubMed", "id": "19502418", "url": "https://pubmed.ncbi.nlm.nih.gov/19502418" }, { "database": "PubMed", "id": "19570880", "url": "https://pubmed.ncbi.nlm.nih.gov/19570880" }, { "database": "PubMed", "id": "19587782", "url": "https://pubmed.ncbi.nlm.nih.gov/19587782" }, { "database": "PubMed", "id": "19627269", "url": "https://pubmed.ncbi.nlm.nih.gov/19627269" }, { "database": "PubMed", "id": "19693287", "url": "https://pubmed.ncbi.nlm.nih.gov/19693287" }, { "database": "PubMed", "id": "19721331", "url": "https://pubmed.ncbi.nlm.nih.gov/19721331" }, { "database": "PubMed", "id": "19731018", "url": "https://pubmed.ncbi.nlm.nih.gov/19731018" }, { "database": "PubMed", "id": "19745829", "url": "https://pubmed.ncbi.nlm.nih.gov/19745829" }, { "database": "PubMed", "id": "19761830", "url": "https://pubmed.ncbi.nlm.nih.gov/19761830" }, { "database": "PubMed", "id": "19844585", "url": "https://pubmed.ncbi.nlm.nih.gov/19844585" }, { "database": "PubMed", "id": "19847197", "url": "https://pubmed.ncbi.nlm.nih.gov/19847197" }, { "database": "PubMed", "id": "19879746", "url": "https://pubmed.ncbi.nlm.nih.gov/19879746" }, { "database": "PubMed", "id": "20022531", "url": "https://pubmed.ncbi.nlm.nih.gov/20022531" }, { "database": "PubMed", "id": "20028942", "url": "https://pubmed.ncbi.nlm.nih.gov/20028942" }, { "database": "PubMed", "id": "20053680", "url": "https://pubmed.ncbi.nlm.nih.gov/20053680" }, { "database": "PubMed", "id": "20103705", "url": "https://pubmed.ncbi.nlm.nih.gov/20103705" }, { "database": "PubMed", "id": "20154728", "url": "https://pubmed.ncbi.nlm.nih.gov/20154728" }, { "database": "PubMed", "id": "20174568", "url": "https://pubmed.ncbi.nlm.nih.gov/20174568" }, { "database": "PubMed", "id": "20174572", "url": "https://pubmed.ncbi.nlm.nih.gov/20174572" }, { "database": "PubMed", "id": "20177806", "url": "https://pubmed.ncbi.nlm.nih.gov/20177806" }, { "database": "PubMed", "id": "20179101", "url": "https://pubmed.ncbi.nlm.nih.gov/20179101" }, { "database": "PubMed", "id": "20179753", "url": "https://pubmed.ncbi.nlm.nih.gov/20179753" }, { "database": "PubMed", "id": "20332342", "url": "https://pubmed.ncbi.nlm.nih.gov/20332342" }, { "database": "PubMed", "id": "20333297", "url": "https://pubmed.ncbi.nlm.nih.gov/20333297" }, { "database": "PubMed", "id": "20338882", "url": "https://pubmed.ncbi.nlm.nih.gov/20338882" }, { "database": "PubMed", "id": "20362052", "url": "https://pubmed.ncbi.nlm.nih.gov/20362052" }, { "database": "PubMed", "id": "20363892", "url": "https://pubmed.ncbi.nlm.nih.gov/20363892" }, { "database": "PubMed", "id": "20501873", "url": "https://pubmed.ncbi.nlm.nih.gov/20501873" }, { "database": "PubMed", "id": "20520761", "url": "https://pubmed.ncbi.nlm.nih.gov/20520761" }, { "database": "PubMed", "id": "20543991", "url": "https://pubmed.ncbi.nlm.nih.gov/20543991" }, { "database": "PubMed", "id": "20554973", "url": "https://pubmed.ncbi.nlm.nih.gov/20554973" }, { "database": "PubMed", "id": "20576936", "url": "https://pubmed.ncbi.nlm.nih.gov/20576936" }, { "database": "PubMed", "id": "20586915", "url": "https://pubmed.ncbi.nlm.nih.gov/20586915" }, { "database": "PubMed", "id": "20587420", "url": "https://pubmed.ncbi.nlm.nih.gov/20587420" }, { "database": "PubMed", "id": "20622167", "url": "https://pubmed.ncbi.nlm.nih.gov/20622167" }, { "database": "PubMed", "id": "20624888", "url": "https://pubmed.ncbi.nlm.nih.gov/20624888" }, { "database": "PubMed", "id": "20705918", "url": "https://pubmed.ncbi.nlm.nih.gov/20705918" }, { "database": "PubMed", "id": "20719961", "url": "https://pubmed.ncbi.nlm.nih.gov/20719961" }, { "database": "PubMed", "id": "20806112", "url": "https://pubmed.ncbi.nlm.nih.gov/20806112" }, { "database": "PubMed", "id": "20811625", "url": "https://pubmed.ncbi.nlm.nih.gov/20811625" }, { "database": "PubMed", "id": "20813836", "url": "https://pubmed.ncbi.nlm.nih.gov/20813836" }, { "database": "PubMed", "id": "20837912", "url": "https://pubmed.ncbi.nlm.nih.gov/20837912" }, { "database": "PubMed", "id": "20847051", "url": "https://pubmed.ncbi.nlm.nih.gov/20847051" }, { "database": "PubMed", "id": "20856813", "url": "https://pubmed.ncbi.nlm.nih.gov/20856813" }, { "database": "PubMed", "id": "20936097", "url": "https://pubmed.ncbi.nlm.nih.gov/20936097" }, { "database": "PubMed", "id": "20976192", "url": "https://pubmed.ncbi.nlm.nih.gov/20976192" }, { "database": "PubMed", "id": "21029370", "url": "https://pubmed.ncbi.nlm.nih.gov/21029370" }, { "database": "PubMed", "id": "21106850", "url": "https://pubmed.ncbi.nlm.nih.gov/21106850" }, { "database": "PubMed", "id": "21266327", "url": "https://pubmed.ncbi.nlm.nih.gov/21266327" }, { "database": "PubMed", "id": "21279323", "url": "https://pubmed.ncbi.nlm.nih.gov/21279323" }, { "database": "PubMed", "id": "21283589", "url": "https://pubmed.ncbi.nlm.nih.gov/21283589" }, { "database": "PubMed", "id": "21407213", "url": "https://pubmed.ncbi.nlm.nih.gov/21407213" }, { "database": "PubMed", "id": "21408125", "url": "https://pubmed.ncbi.nlm.nih.gov/21408125" }, { "database": "PubMed", "id": "21423211", "url": "https://pubmed.ncbi.nlm.nih.gov/21423211" }, { "database": "PubMed", "id": "21479224", "url": "https://pubmed.ncbi.nlm.nih.gov/21479224" }, { "database": "PubMed", "id": "21511697", "url": "https://pubmed.ncbi.nlm.nih.gov/21511697" }, { "database": "PubMed", "id": "21600784", "url": "https://pubmed.ncbi.nlm.nih.gov/21600784" }, { "database": "PubMed", "id": "21617181", "url": "https://pubmed.ncbi.nlm.nih.gov/21617181" }, { "database": "PubMed", "id": "21637761", "url": "https://pubmed.ncbi.nlm.nih.gov/21637761" }, { "database": "PubMed", "id": "21655268", "url": "https://pubmed.ncbi.nlm.nih.gov/21655268" }, { "database": "PubMed", "id": "21670491", "url": "https://pubmed.ncbi.nlm.nih.gov/21670491" }, { "database": "PubMed", "id": "21847101", "url": "https://pubmed.ncbi.nlm.nih.gov/21847101" }, { "database": "PubMed", "id": "21850156", "url": "https://pubmed.ncbi.nlm.nih.gov/21850156" }, { "database": "PubMed", "id": "21927580", "url": "https://pubmed.ncbi.nlm.nih.gov/21927580" }, { "database": "PubMed", "id": "21993375", "url": "https://pubmed.ncbi.nlm.nih.gov/21993375" }, { "database": "PubMed", "id": "22019461", "url": "https://pubmed.ncbi.nlm.nih.gov/22019461" }, { "database": "PubMed", "id": "22028912", "url": "https://pubmed.ncbi.nlm.nih.gov/22028912" }, { "database": "PubMed", "id": "22057724", "url": "https://pubmed.ncbi.nlm.nih.gov/22057724" }, { "database": "PubMed", "id": "22095470", "url": "https://pubmed.ncbi.nlm.nih.gov/22095470" }, { "database": "PubMed", "id": "22117619", "url": "https://pubmed.ncbi.nlm.nih.gov/22117619" }, { "database": "PubMed", "id": "22132131", "url": "https://pubmed.ncbi.nlm.nih.gov/22132131" }, { "database": "PubMed", "id": "22184110", "url": "https://pubmed.ncbi.nlm.nih.gov/22184110" }, { "database": "PubMed", "id": "22187375", "url": "https://pubmed.ncbi.nlm.nih.gov/22187375" }, { "database": "PubMed", "id": "22188815", "url": "https://pubmed.ncbi.nlm.nih.gov/22188815" }, { "database": "PubMed", "id": "22195016", "url": "https://pubmed.ncbi.nlm.nih.gov/22195016" }, { "database": "PubMed", "id": "22203870", "url": "https://pubmed.ncbi.nlm.nih.gov/22203870" }, { "database": "PubMed", "id": "22218715", "url": "https://pubmed.ncbi.nlm.nih.gov/22218715" }, { "database": "PubMed", "id": "22238573", "url": "https://pubmed.ncbi.nlm.nih.gov/22238573" }, { "database": "PubMed", "id": "22249311", "url": "https://pubmed.ncbi.nlm.nih.gov/22249311" }, { "database": "PubMed", "id": "22253608", "url": "https://pubmed.ncbi.nlm.nih.gov/22253608" }, { "database": "PubMed", "id": "22344295", "url": "https://pubmed.ncbi.nlm.nih.gov/22344295" }, { "database": "PubMed", "id": "22363451", "url": "https://pubmed.ncbi.nlm.nih.gov/22363451" }, { "database": "PubMed", "id": "22382990", "url": "https://pubmed.ncbi.nlm.nih.gov/22382990" }, { "database": "PubMed", "id": "22412835", "url": "https://pubmed.ncbi.nlm.nih.gov/22412835" }, { "database": "PubMed", "id": "22412882", "url": "https://pubmed.ncbi.nlm.nih.gov/22412882" }, { "database": "PubMed", "id": "22469977", "url": "https://pubmed.ncbi.nlm.nih.gov/22469977" }, { "database": "PubMed", "id": "22471389", "url": "https://pubmed.ncbi.nlm.nih.gov/22471389" }, { "database": "PubMed", "id": "22496778", "url": "https://pubmed.ncbi.nlm.nih.gov/22496778" }, { "database": "PubMed", "id": "22516386", "url": "https://pubmed.ncbi.nlm.nih.gov/22516386" }, { "database": "PubMed", "id": "22521878", "url": "https://pubmed.ncbi.nlm.nih.gov/22521878" }, { "database": "PubMed", "id": "22532369", "url": "https://pubmed.ncbi.nlm.nih.gov/22532369" }, { "database": "PubMed", "id": "22559167", "url": "https://pubmed.ncbi.nlm.nih.gov/22559167" }, { "database": "PubMed", "id": "22563011", "url": "https://pubmed.ncbi.nlm.nih.gov/22563011" }, { "database": "PubMed", "id": "22563417", "url": "https://pubmed.ncbi.nlm.nih.gov/22563417" }, { "database": "PubMed", "id": "22581458", "url": "https://pubmed.ncbi.nlm.nih.gov/22581458" }, { "database": "PubMed", "id": "22586587", "url": "https://pubmed.ncbi.nlm.nih.gov/22586587" }, { "database": "PubMed", "id": "22590527", "url": "https://pubmed.ncbi.nlm.nih.gov/22590527" }, { "database": "PubMed", "id": "22606274", "url": "https://pubmed.ncbi.nlm.nih.gov/22606274" }, { "database": "PubMed", "id": "22622501", "url": "https://pubmed.ncbi.nlm.nih.gov/22622501" }, { "database": "PubMed", "id": "22652602", "url": "https://pubmed.ncbi.nlm.nih.gov/22652602" }, { "database": "PubMed", "id": "22681587", "url": "https://pubmed.ncbi.nlm.nih.gov/22681587" }, { "database": "PubMed", "id": "22693641", "url": "https://pubmed.ncbi.nlm.nih.gov/22693641" }, { "database": "PubMed", "id": "22733590", "url": "https://pubmed.ncbi.nlm.nih.gov/22733590" }, { "database": "PubMed", "id": "22734004", "url": "https://pubmed.ncbi.nlm.nih.gov/22734004" }, { "database": "PubMed", "id": "22768110", "url": "https://pubmed.ncbi.nlm.nih.gov/22768110" }, { "database": "PubMed", "id": "22773877", "url": "https://pubmed.ncbi.nlm.nih.gov/22773877" }, { "database": "PubMed", "id": "22792172", "url": "https://pubmed.ncbi.nlm.nih.gov/22792172" }, { "database": "PubMed", "id": "22832498", "url": "https://pubmed.ncbi.nlm.nih.gov/22832498" }, { "database": "PubMed", "id": "22850125", "url": "https://pubmed.ncbi.nlm.nih.gov/22850125" }, { "database": "PubMed", "id": "22859500", "url": "https://pubmed.ncbi.nlm.nih.gov/22859500" }, { "database": "PubMed", "id": "22869525", "url": "https://pubmed.ncbi.nlm.nih.gov/22869525" }, { "database": "PubMed", "id": "22900024", "url": "https://pubmed.ncbi.nlm.nih.gov/22900024" }, { "database": "PubMed", "id": "22910893", "url": "https://pubmed.ncbi.nlm.nih.gov/22910893" }, { "database": "PubMed", "id": "22933110", "url": "https://pubmed.ncbi.nlm.nih.gov/22933110" }, { "database": "PubMed", "id": "22934083", "url": "https://pubmed.ncbi.nlm.nih.gov/22934083" }, { "database": "PubMed", "id": "22936801", "url": "https://pubmed.ncbi.nlm.nih.gov/22936801" }, { "database": "PubMed", "id": "22941977", "url": "https://pubmed.ncbi.nlm.nih.gov/22941977" }, { "database": "PubMed", "id": "22952890", "url": "https://pubmed.ncbi.nlm.nih.gov/22952890" }, { "database": "PubMed", "id": "23029230", "url": "https://pubmed.ncbi.nlm.nih.gov/23029230" }, { "database": "PubMed", "id": "23049865", "url": "https://pubmed.ncbi.nlm.nih.gov/23049865" }, { "database": "PubMed", "id": "23071621", "url": "https://pubmed.ncbi.nlm.nih.gov/23071621" }, { "database": "PubMed", "id": "23082110", "url": "https://pubmed.ncbi.nlm.nih.gov/23082110" }, { "database": "PubMed", "id": "23100026", "url": "https://pubmed.ncbi.nlm.nih.gov/23100026" }, { "database": "PubMed", "id": "23133640", "url": "https://pubmed.ncbi.nlm.nih.gov/23133640" }, { "database": "PubMed", "id": "23188702", "url": "https://pubmed.ncbi.nlm.nih.gov/23188702" }, { "database": "PubMed", "id": "23227273", "url": "https://pubmed.ncbi.nlm.nih.gov/23227273" }, { "database": "PubMed", "id": "23236519", "url": "https://pubmed.ncbi.nlm.nih.gov/23236519" }, { "database": "PubMed", "id": "23239877", "url": "https://pubmed.ncbi.nlm.nih.gov/23239877" }, { "database": "PubMed", "id": "23251389", "url": "https://pubmed.ncbi.nlm.nih.gov/23251389" }, { "database": "PubMed", "id": "23251519", "url": "https://pubmed.ncbi.nlm.nih.gov/23251519" }, { "database": "PubMed", "id": "23300339", "url": "https://pubmed.ncbi.nlm.nih.gov/23300339" }, { "database": "PubMed", "id": "23311350", "url": "https://pubmed.ncbi.nlm.nih.gov/23311350" }, { "database": "PubMed", "id": "23369342", "url": "https://pubmed.ncbi.nlm.nih.gov/23369342" }, { "database": "PubMed", "id": "23382716", "url": "https://pubmed.ncbi.nlm.nih.gov/23382716" }, { "database": "PubMed", "id": "23386984", "url": "https://pubmed.ncbi.nlm.nih.gov/23386984" }, { "database": "PubMed", "id": "23390495", "url": "https://pubmed.ncbi.nlm.nih.gov/23390495" }, { "database": "PubMed", "id": "23393595", "url": "https://pubmed.ncbi.nlm.nih.gov/23393595" }, { "database": "PubMed", "id": "23409704", "url": "https://pubmed.ncbi.nlm.nih.gov/23409704" }, { "database": "PubMed", "id": "23443503", "url": "https://pubmed.ncbi.nlm.nih.gov/23443503" }, { "database": "PubMed", "id": "23444402", "url": "https://pubmed.ncbi.nlm.nih.gov/23444402" }, { "database": "PubMed", "id": "23451056", "url": "https://pubmed.ncbi.nlm.nih.gov/23451056" }, { "database": "PubMed", "id": "23469174", "url": "https://pubmed.ncbi.nlm.nih.gov/23469174" }, { "database": "PubMed", "id": "23469261", "url": "https://pubmed.ncbi.nlm.nih.gov/23469261" }, { "database": "PubMed", "id": "23478138", "url": "https://pubmed.ncbi.nlm.nih.gov/23478138" }, { "database": "PubMed", "id": "23489026", "url": "https://pubmed.ncbi.nlm.nih.gov/23489026" }, { "database": "PubMed", "id": "23493568", "url": "https://pubmed.ncbi.nlm.nih.gov/23493568" }, { "database": "PubMed", "id": "23504323", "url": "https://pubmed.ncbi.nlm.nih.gov/23504323" }, { "database": "PubMed", "id": "23519033", "url": "https://pubmed.ncbi.nlm.nih.gov/23519033" }, { "database": "PubMed", "id": "23520131", "url": "https://pubmed.ncbi.nlm.nih.gov/23520131" }, { "database": "PubMed", "id": "23554947", "url": "https://pubmed.ncbi.nlm.nih.gov/23554947" }, { "database": "PubMed", "id": "23584725", "url": "https://pubmed.ncbi.nlm.nih.gov/23584725" }, { "database": "PubMed", "id": "23593332", "url": "https://pubmed.ncbi.nlm.nih.gov/23593332" }, { "database": "PubMed", "id": "23596176", "url": "https://pubmed.ncbi.nlm.nih.gov/23596176" }, { "database": "PubMed", "id": "23598407", "url": "https://pubmed.ncbi.nlm.nih.gov/23598407" }, { "database": "PubMed", "id": "23649820", "url": "https://pubmed.ncbi.nlm.nih.gov/23649820" }, { "database": "PubMed", "id": "23671593", "url": "https://pubmed.ncbi.nlm.nih.gov/23671593" }, { "database": "PubMed", "id": "23702782", "url": "https://pubmed.ncbi.nlm.nih.gov/23702782" }, { "database": "PubMed", "id": "23713790", "url": "https://pubmed.ncbi.nlm.nih.gov/23713790" }, { "database": "PubMed", "id": "23716717", "url": "https://pubmed.ncbi.nlm.nih.gov/23716717" }, { "database": "PubMed", "id": "23734002", "url": "https://pubmed.ncbi.nlm.nih.gov/23734002" }, { "database": "PubMed", "id": "23748360", "url": "https://pubmed.ncbi.nlm.nih.gov/23748360" }, { "database": "PubMed", "id": "23805205", "url": "https://pubmed.ncbi.nlm.nih.gov/23805205" }, { "database": "PubMed", "id": "23818862", "url": "https://pubmed.ncbi.nlm.nih.gov/23818862" }, { "database": "PubMed", "id": "23826249", "url": "https://pubmed.ncbi.nlm.nih.gov/23826249" }, { "database": "PubMed", "id": "23868942", "url": "https://pubmed.ncbi.nlm.nih.gov/23868942" }, { "database": "PubMed", "id": "23874604", "url": "https://pubmed.ncbi.nlm.nih.gov/23874604" }, { "database": "PubMed", "id": "23907468", "url": "https://pubmed.ncbi.nlm.nih.gov/23907468" }, { "database": "PubMed", "id": "23935891", "url": "https://pubmed.ncbi.nlm.nih.gov/23935891" }, { "database": "PubMed", "id": "23964069", "url": "https://pubmed.ncbi.nlm.nih.gov/23964069" }, { "database": "PubMed", "id": "23965299", "url": "https://pubmed.ncbi.nlm.nih.gov/23965299" }, { "database": "PubMed", "id": "24008733", "url": "https://pubmed.ncbi.nlm.nih.gov/24008733" }, { "database": "PubMed", "id": "24052072", "url": "https://pubmed.ncbi.nlm.nih.gov/24052072" }, { "database": "PubMed", "id": "24052499", "url": "https://pubmed.ncbi.nlm.nih.gov/24052499" }, { "database": "PubMed", "id": "24067903", "url": "https://pubmed.ncbi.nlm.nih.gov/24067903" }, { "database": "PubMed", "id": "24068327", "url": "https://pubmed.ncbi.nlm.nih.gov/24068327" }, { "database": "PubMed", "id": "24068707", "url": "https://pubmed.ncbi.nlm.nih.gov/24068707" }, { "database": "PubMed", "id": "24090638", "url": "https://pubmed.ncbi.nlm.nih.gov/24090638" }, { "database": "PubMed", "id": "24101676", "url": "https://pubmed.ncbi.nlm.nih.gov/24101676" }, { "database": "PubMed", "id": "24116102", "url": "https://pubmed.ncbi.nlm.nih.gov/24116102" }, { "database": "PubMed", "id": "24142192", "url": "https://pubmed.ncbi.nlm.nih.gov/24142192" }, { "database": "PubMed", "id": "24149114", "url": "https://pubmed.ncbi.nlm.nih.gov/24149114" }, { "database": "PubMed", "id": "24150605", "url": "https://pubmed.ncbi.nlm.nih.gov/24150605" }, { "database": "PubMed", "id": "24156551", "url": "https://pubmed.ncbi.nlm.nih.gov/24156551" }, { "database": "PubMed", "id": "24223757", "url": "https://pubmed.ncbi.nlm.nih.gov/24223757" }, { "database": "PubMed", "id": "24260338", "url": "https://pubmed.ncbi.nlm.nih.gov/24260338" }, { "database": "PubMed", "id": "24280377", "url": "https://pubmed.ncbi.nlm.nih.gov/24280377" }, { "database": "PubMed", "id": "24280772", "url": "https://pubmed.ncbi.nlm.nih.gov/24280772" }, { "database": "PubMed", "id": "24286194", "url": "https://pubmed.ncbi.nlm.nih.gov/24286194" }, { "database": "PubMed", "id": "24296537", "url": "https://pubmed.ncbi.nlm.nih.gov/24296537" }, { "database": "PubMed", "id": "24334165", "url": "https://pubmed.ncbi.nlm.nih.gov/24334165" }, { "database": "PubMed", "id": "24340073", "url": "https://pubmed.ncbi.nlm.nih.gov/24340073" }, { "database": "PubMed", "id": "24347831", "url": "https://pubmed.ncbi.nlm.nih.gov/24347831" }, { "database": "PubMed", "id": "24349514", "url": "https://pubmed.ncbi.nlm.nih.gov/24349514" }, { "database": "PubMed", "id": "24351823", "url": "https://pubmed.ncbi.nlm.nih.gov/24351823" }, { "database": "PubMed", "id": "24367658", "url": "https://pubmed.ncbi.nlm.nih.gov/24367658" }, { "database": "PubMed", "id": "24387036", "url": "https://pubmed.ncbi.nlm.nih.gov/24387036" }, { "database": "PubMed", "id": "24412630", "url": "https://pubmed.ncbi.nlm.nih.gov/24412630" }, { "database": "PubMed", "id": "24427143", "url": "https://pubmed.ncbi.nlm.nih.gov/24427143" }, { "database": "PubMed", "id": "24434432", "url": "https://pubmed.ncbi.nlm.nih.gov/24434432" }, { "database": "PubMed", "id": "24435134", "url": "https://pubmed.ncbi.nlm.nih.gov/24435134" }, { "database": "PubMed", "id": "24505362", "url": "https://pubmed.ncbi.nlm.nih.gov/24505362" }, { "database": "PubMed", "id": "24516630", "url": "https://pubmed.ncbi.nlm.nih.gov/24516630" }, { "database": "PubMed", "id": "24551245", "url": "https://pubmed.ncbi.nlm.nih.gov/24551245" }, { "database": "PubMed", "id": "24557881", "url": "https://pubmed.ncbi.nlm.nih.gov/24557881" }, { "database": "PubMed", "id": "24621388", "url": "https://pubmed.ncbi.nlm.nih.gov/24621388" }, { "database": "PubMed", "id": "24629015", "url": "https://pubmed.ncbi.nlm.nih.gov/24629015" }, { "database": "PubMed", "id": "24632620", "url": "https://pubmed.ncbi.nlm.nih.gov/24632620" }, { "database": "PubMed", "id": "24647338", "url": "https://pubmed.ncbi.nlm.nih.gov/24647338" }, { "database": "PubMed", "id": "24649407", "url": "https://pubmed.ncbi.nlm.nih.gov/24649407" }, { "database": "PubMed", "id": "24662050", "url": "https://pubmed.ncbi.nlm.nih.gov/24662050" }, { "database": "PubMed", "id": "24670654", "url": "https://pubmed.ncbi.nlm.nih.gov/24670654" }, { "database": "PubMed", "id": "24675832", "url": "https://pubmed.ncbi.nlm.nih.gov/24675832" }, { "database": "PubMed", "id": "24708830", "url": "https://pubmed.ncbi.nlm.nih.gov/24708830" }, { "database": "PubMed", "id": "24722238", "url": "https://pubmed.ncbi.nlm.nih.gov/24722238" }, { "database": "PubMed", "id": "24734904", "url": "https://pubmed.ncbi.nlm.nih.gov/24734904" }, { "database": "PubMed", "id": "24740015", "url": "https://pubmed.ncbi.nlm.nih.gov/24740015" }, { "database": "PubMed", "id": "24742286", "url": "https://pubmed.ncbi.nlm.nih.gov/24742286" }, { "database": "PubMed", "id": "24746698", "url": "https://pubmed.ncbi.nlm.nih.gov/24746698" }, { "database": "PubMed", "id": "24757676", "url": "https://pubmed.ncbi.nlm.nih.gov/24757676" }, { "database": "PubMed", "id": "24760979", "url": "https://pubmed.ncbi.nlm.nih.gov/24760979" }, { "database": "PubMed", "id": "24763529", "url": "https://pubmed.ncbi.nlm.nih.gov/24763529" }, { "database": "PubMed", "id": "24769205", "url": "https://pubmed.ncbi.nlm.nih.gov/24769205" }, { "database": "PubMed", "id": "24809512", "url": "https://pubmed.ncbi.nlm.nih.gov/24809512" }, { "database": "PubMed", "id": "24810050", "url": "https://pubmed.ncbi.nlm.nih.gov/24810050" }, { "database": "PubMed", "id": "24832603", "url": "https://pubmed.ncbi.nlm.nih.gov/24832603" }, { "database": "PubMed", "id": "24944899", "url": "https://pubmed.ncbi.nlm.nih.gov/24944899" }, { "database": "PubMed", "id": "24945834", "url": "https://pubmed.ncbi.nlm.nih.gov/24945834" }, { "database": "PubMed", "id": "24945938", "url": "https://pubmed.ncbi.nlm.nih.gov/24945938" }, { "database": "PubMed", "id": "24967341", "url": "https://pubmed.ncbi.nlm.nih.gov/24967341" }, { "database": "PubMed", "id": "24985103", "url": "https://pubmed.ncbi.nlm.nih.gov/24985103" }, { "database": "PubMed", "id": "24987368", "url": "https://pubmed.ncbi.nlm.nih.gov/24987368" }, { "database": "PubMed", "id": "25004182", "url": "https://pubmed.ncbi.nlm.nih.gov/25004182" }, { "database": "PubMed", "id": "25004403", "url": "https://pubmed.ncbi.nlm.nih.gov/25004403" }, { "database": "PubMed", "id": "25013446", "url": "https://pubmed.ncbi.nlm.nih.gov/25013446" }, { "database": "PubMed", "id": "25092872", "url": "https://pubmed.ncbi.nlm.nih.gov/25092872" }, { "database": "PubMed", "id": "25132272", "url": "https://pubmed.ncbi.nlm.nih.gov/25132272" }, { "database": "PubMed", "id": "25136373", "url": "https://pubmed.ncbi.nlm.nih.gov/25136373" }, { "database": "PubMed", "id": "25141786", "url": "https://pubmed.ncbi.nlm.nih.gov/25141786" }, { "database": "PubMed", "id": "25162417", "url": "https://pubmed.ncbi.nlm.nih.gov/25162417" }, { "database": "PubMed", "id": "25168244", "url": "https://pubmed.ncbi.nlm.nih.gov/25168244" }, { "database": "PubMed", "id": "25201756", "url": "https://pubmed.ncbi.nlm.nih.gov/25201756" }, { "database": "PubMed", "id": "25214523", "url": "https://pubmed.ncbi.nlm.nih.gov/25214523" }, { "database": "PubMed", "id": "25221930", "url": "https://pubmed.ncbi.nlm.nih.gov/25221930" }, { "database": "PubMed", "id": "25240598", "url": "https://pubmed.ncbi.nlm.nih.gov/25240598" }, { "database": "PubMed", "id": "25258031", "url": "https://pubmed.ncbi.nlm.nih.gov/25258031" }, { "database": "PubMed", "id": "25264192", "url": "https://pubmed.ncbi.nlm.nih.gov/25264192" }, { "database": "PubMed", "id": "25279552", "url": "https://pubmed.ncbi.nlm.nih.gov/25279552" }, { "database": "PubMed", "id": "25280966", "url": "https://pubmed.ncbi.nlm.nih.gov/25280966" }, { "database": "PubMed", "id": "25332884", "url": "https://pubmed.ncbi.nlm.nih.gov/25332884" }, { "database": "PubMed", "id": "25336920", "url": "https://pubmed.ncbi.nlm.nih.gov/25336920" }, { "database": "PubMed", "id": "25347392", "url": "https://pubmed.ncbi.nlm.nih.gov/25347392" }, { "database": "PubMed", "id": "25355398", "url": "https://pubmed.ncbi.nlm.nih.gov/25355398" }, { "database": "PubMed", "id": "25377878", "url": "https://pubmed.ncbi.nlm.nih.gov/25377878" }, { "database": "PubMed", "id": "25379771", "url": "https://pubmed.ncbi.nlm.nih.gov/25379771" }, { "database": "PubMed", "id": "25398386", "url": "https://pubmed.ncbi.nlm.nih.gov/25398386" }, { "database": "PubMed", "id": "25415296", "url": "https://pubmed.ncbi.nlm.nih.gov/25415296" }, { "database": "PubMed", "id": "25416469", "url": "https://pubmed.ncbi.nlm.nih.gov/25416469" }, { "database": "PubMed", "id": "25460003", "url": "https://pubmed.ncbi.nlm.nih.gov/25460003" }, { "database": "PubMed", "id": "25460735", "url": "https://pubmed.ncbi.nlm.nih.gov/25460735" }, { "database": "PubMed", "id": "25466188", "url": "https://pubmed.ncbi.nlm.nih.gov/25466188" }, { "database": "PubMed", "id": "25531328", "url": "https://pubmed.ncbi.nlm.nih.gov/25531328" }, { "database": "PubMed", "id": "25546475", "url": "https://pubmed.ncbi.nlm.nih.gov/25546475" }, { "database": "PubMed", "id": "25564616", "url": "https://pubmed.ncbi.nlm.nih.gov/25564616" }, { "database": "PubMed", "id": "25568666", "url": "https://pubmed.ncbi.nlm.nih.gov/25568666" }, { "database": "PubMed", "id": "25594415", "url": "https://pubmed.ncbi.nlm.nih.gov/25594415" }, { "database": "PubMed", "id": "25635326", "url": "https://pubmed.ncbi.nlm.nih.gov/25635326" }, { "database": "PubMed", "id": "25646773", "url": "https://pubmed.ncbi.nlm.nih.gov/25646773" }, { "database": "PubMed", "id": "25672620", "url": "https://pubmed.ncbi.nlm.nih.gov/25672620" }, { "database": "PubMed", "id": "25714556", "url": "https://pubmed.ncbi.nlm.nih.gov/25714556" }, { "database": "PubMed", "id": "25752217", "url": "https://pubmed.ncbi.nlm.nih.gov/25752217" }, { "database": "PubMed", "id": "25754411", "url": "https://pubmed.ncbi.nlm.nih.gov/25754411" }, { "database": "PubMed", "id": "25775433", "url": "https://pubmed.ncbi.nlm.nih.gov/25775433" }, { "database": "PubMed", "id": "25790465", "url": "https://pubmed.ncbi.nlm.nih.gov/25790465" }, { "database": "PubMed", "id": "25799367", "url": "https://pubmed.ncbi.nlm.nih.gov/25799367" }, { "database": "PubMed", "id": "25808491", "url": "https://pubmed.ncbi.nlm.nih.gov/25808491" }, { "database": "PubMed", "id": "25826740", "url": "https://pubmed.ncbi.nlm.nih.gov/25826740" }, { "database": "PubMed", "id": "25839650", "url": "https://pubmed.ncbi.nlm.nih.gov/25839650" }, { "database": "PubMed", "id": "25853295", "url": "https://pubmed.ncbi.nlm.nih.gov/25853295" }, { "database": "PubMed", "id": "25880554", "url": "https://pubmed.ncbi.nlm.nih.gov/25880554" }, { "database": "PubMed", "id": "25888638", "url": "https://pubmed.ncbi.nlm.nih.gov/25888638" }, { "database": "PubMed", "id": "25889002", "url": "https://pubmed.ncbi.nlm.nih.gov/25889002" }, { "database": "PubMed", "id": "25902782", "url": "https://pubmed.ncbi.nlm.nih.gov/25902782" }, { "database": "PubMed", "id": "25960827", "url": "https://pubmed.ncbi.nlm.nih.gov/25960827" }, { "database": "PubMed", "id": "25965336", "url": "https://pubmed.ncbi.nlm.nih.gov/25965336" }, { "database": "PubMed", "id": "25965947", "url": "https://pubmed.ncbi.nlm.nih.gov/25965947" }, { "database": "PubMed", "id": "25968579", "url": "https://pubmed.ncbi.nlm.nih.gov/25968579" }, { "database": "PubMed", "id": "25991723", "url": "https://pubmed.ncbi.nlm.nih.gov/25991723" }, { "database": "PubMed", "id": "26000908", "url": "https://pubmed.ncbi.nlm.nih.gov/26000908" }, { "database": "PubMed", "id": "26023930", "url": "https://pubmed.ncbi.nlm.nih.gov/26023930" }, { "database": "PubMed", "id": "26026051", "url": "https://pubmed.ncbi.nlm.nih.gov/26026051" }, { "database": "PubMed", "id": "26070664", "url": "https://pubmed.ncbi.nlm.nih.gov/26070664" }, { "database": "PubMed", "id": "26100075", "url": "https://pubmed.ncbi.nlm.nih.gov/26100075" }, { "database": "PubMed", "id": "26118757", "url": "https://pubmed.ncbi.nlm.nih.gov/26118757" }, { "database": "PubMed", "id": "26121028", "url": "https://pubmed.ncbi.nlm.nih.gov/26121028" }, { "database": "PubMed", "id": "26132202", "url": "https://pubmed.ncbi.nlm.nih.gov/26132202" }, { "database": "PubMed", "id": "26135741", "url": "https://pubmed.ncbi.nlm.nih.gov/26135741" }, { "database": "PubMed", "id": "26249804", "url": "https://pubmed.ncbi.nlm.nih.gov/26249804" }, { "database": "PubMed", "id": "26254337", "url": "https://pubmed.ncbi.nlm.nih.gov/26254337" }, { "database": "PubMed", "id": "26263164", "url": "https://pubmed.ncbi.nlm.nih.gov/26263164" }, { "database": "PubMed", "id": "26278110", "url": "https://pubmed.ncbi.nlm.nih.gov/26278110" }, { "database": "PubMed", "id": "26287667", "url": "https://pubmed.ncbi.nlm.nih.gov/26287667" }, { "database": "PubMed", "id": "26299806", "url": "https://pubmed.ncbi.nlm.nih.gov/26299806" }, { "database": "PubMed", "id": "26325184", "url": "https://pubmed.ncbi.nlm.nih.gov/26325184" }, { "database": "PubMed", "id": "26340932", "url": "https://pubmed.ncbi.nlm.nih.gov/26340932" }, { "database": "PubMed", "id": "26383267", "url": "https://pubmed.ncbi.nlm.nih.gov/26383267" }, { "database": "PubMed", "id": "26407610", "url": "https://pubmed.ncbi.nlm.nih.gov/26407610" }, { "database": "PubMed", "id": "26412745", "url": "https://pubmed.ncbi.nlm.nih.gov/26412745" }, { "database": "PubMed", "id": "26454089", "url": "https://pubmed.ncbi.nlm.nih.gov/26454089" }, { "database": "PubMed", "id": "26459601", "url": "https://pubmed.ncbi.nlm.nih.gov/26459601" }, { "database": "PubMed", "id": "26512452", "url": "https://pubmed.ncbi.nlm.nih.gov/26512452" }, { "database": "PubMed", "id": "26523428", "url": "https://pubmed.ncbi.nlm.nih.gov/26523428" }, { "database": "PubMed", "id": "26539824", "url": "https://pubmed.ncbi.nlm.nih.gov/26539824" }, { "database": "PubMed", "id": "26553931", "url": "https://pubmed.ncbi.nlm.nih.gov/26553931" }, { "database": "PubMed", "id": "26597054", "url": "https://pubmed.ncbi.nlm.nih.gov/26597054" }, { "database": "PubMed", "id": "26720454", "url": "https://pubmed.ncbi.nlm.nih.gov/26720454" }, { "database": "PubMed", "id": "26723251", "url": "https://pubmed.ncbi.nlm.nih.gov/26723251" }, { "database": "PubMed", "id": "26728896", "url": "https://pubmed.ncbi.nlm.nih.gov/26728896" }, { "database": "PubMed", "id": "26743335", "url": "https://pubmed.ncbi.nlm.nih.gov/26743335" }, { "database": "PubMed", "id": "26801880", "url": "https://pubmed.ncbi.nlm.nih.gov/26801880" }, { "database": "PubMed", "id": "26809587", "url": "https://pubmed.ncbi.nlm.nih.gov/26809587" }, { "database": "PubMed", "id": "26822343", "url": "https://pubmed.ncbi.nlm.nih.gov/26822343" }, { "database": "PubMed", "id": "26830849", "url": "https://pubmed.ncbi.nlm.nih.gov/26830849" }, { "database": "PubMed", "id": "26836389", "url": "https://pubmed.ncbi.nlm.nih.gov/26836389" }, { "database": "PubMed", "id": "26844697", "url": "https://pubmed.ncbi.nlm.nih.gov/26844697" }, { "database": "PubMed", "id": "26876212", "url": "https://pubmed.ncbi.nlm.nih.gov/26876212" }, { "database": "PubMed", "id": "26880110", "url": "https://pubmed.ncbi.nlm.nih.gov/26880110" }, { "database": "PubMed", "id": "26907332", "url": "https://pubmed.ncbi.nlm.nih.gov/26907332" }, { "database": "PubMed", "id": "26909311", "url": "https://pubmed.ncbi.nlm.nih.gov/26909311" }, { "database": "PubMed", "id": "26928911", "url": "https://pubmed.ncbi.nlm.nih.gov/26928911" }, { "database": "PubMed", "id": "26933812", "url": "https://pubmed.ncbi.nlm.nih.gov/26933812" }, { "database": "PubMed", "id": "26936863", "url": "https://pubmed.ncbi.nlm.nih.gov/26936863" }, { "database": "PubMed", "id": "26959121", "url": "https://pubmed.ncbi.nlm.nih.gov/26959121" }, { "database": "PubMed", "id": "26984741", "url": "https://pubmed.ncbi.nlm.nih.gov/26984741" }, { "database": "PubMed", "id": "27000529", "url": "https://pubmed.ncbi.nlm.nih.gov/27000529" }, { "database": "PubMed", "id": "27001940", "url": "https://pubmed.ncbi.nlm.nih.gov/27001940" }, { "database": "PubMed", "id": "27009084", "url": "https://pubmed.ncbi.nlm.nih.gov/27009084" }, { "database": "PubMed", "id": "27019366", "url": "https://pubmed.ncbi.nlm.nih.gov/27019366" }, { "database": "PubMed", "id": "27050278", "url": "https://pubmed.ncbi.nlm.nih.gov/27050278" }, { "database": "PubMed", "id": "27050422", "url": "https://pubmed.ncbi.nlm.nih.gov/27050422" }, { "database": "PubMed", "id": "27070899", "url": "https://pubmed.ncbi.nlm.nih.gov/27070899" }, { "database": "PubMed", "id": "27099352", "url": "https://pubmed.ncbi.nlm.nih.gov/27099352" }, { "database": "PubMed", "id": "27106789", "url": "https://pubmed.ncbi.nlm.nih.gov/27106789" }, { "database": "PubMed", "id": "27126782", "url": "https://pubmed.ncbi.nlm.nih.gov/27126782" }, { "database": "PubMed", "id": "27166156", "url": "https://pubmed.ncbi.nlm.nih.gov/27166156" }, { "database": "PubMed", "id": "27167344", "url": "https://pubmed.ncbi.nlm.nih.gov/27167344" }, { "database": "PubMed", "id": "27176481", "url": "https://pubmed.ncbi.nlm.nih.gov/27176481" }, { "database": "PubMed", "id": "27191957", "url": "https://pubmed.ncbi.nlm.nih.gov/27191957" }, { "database": "PubMed", "id": "27197158", "url": "https://pubmed.ncbi.nlm.nih.gov/27197158" }, { "database": "PubMed", "id": "27207782", "url": "https://pubmed.ncbi.nlm.nih.gov/27207782" }, { "database": "PubMed", "id": "27213961", "url": "https://pubmed.ncbi.nlm.nih.gov/27213961" }, { "database": "PubMed", "id": "27226588", "url": "https://pubmed.ncbi.nlm.nih.gov/27226588" }, { "database": "PubMed", "id": "27248324", "url": "https://pubmed.ncbi.nlm.nih.gov/27248324" }, { "database": "PubMed", "id": "27253992", "url": "https://pubmed.ncbi.nlm.nih.gov/27253992" }, { "database": "PubMed", "id": "27257474", "url": "https://pubmed.ncbi.nlm.nih.gov/27257474" }, { "database": "PubMed", "id": "27281705", "url": "https://pubmed.ncbi.nlm.nih.gov/27281705" }, { "database": "PubMed", "id": "27329844", "url": "https://pubmed.ncbi.nlm.nih.gov/27329844" }, { "database": "PubMed", "id": "27335054", "url": "https://pubmed.ncbi.nlm.nih.gov/27335054" }, { "database": "PubMed", "id": "27344443", "url": "https://pubmed.ncbi.nlm.nih.gov/27344443" }, { "database": "PubMed", "id": "27384491", "url": "https://pubmed.ncbi.nlm.nih.gov/27384491" }, { "database": "PubMed", "id": "27412013", "url": "https://pubmed.ncbi.nlm.nih.gov/27412013" }, { "database": "PubMed", "id": "27416746", "url": "https://pubmed.ncbi.nlm.nih.gov/27416746" }, { "database": "PubMed", "id": "27435826", "url": "https://pubmed.ncbi.nlm.nih.gov/27435826" }, { "database": "PubMed", "id": "27457910", "url": "https://pubmed.ncbi.nlm.nih.gov/27457910" }, { "database": "PubMed", "id": "27477105", "url": "https://pubmed.ncbi.nlm.nih.gov/27477105" }, { "database": "PubMed", "id": "27485212", "url": "https://pubmed.ncbi.nlm.nih.gov/27485212" }, { "database": "PubMed", "id": "27518433", "url": "https://pubmed.ncbi.nlm.nih.gov/27518433" }, { "database": "PubMed", "id": "27542970", "url": "https://pubmed.ncbi.nlm.nih.gov/27542970" }, { "database": "PubMed", "id": "27549161", "url": "https://pubmed.ncbi.nlm.nih.gov/27549161" }, { "database": "PubMed", "id": "27562094", "url": "https://pubmed.ncbi.nlm.nih.gov/27562094" }, { "database": "PubMed", "id": "27568979", "url": "https://pubmed.ncbi.nlm.nih.gov/27568979" }, { "database": "PubMed", "id": "27634219", "url": "https://pubmed.ncbi.nlm.nih.gov/27634219" }, { "database": "PubMed", "id": "27689988", "url": "https://pubmed.ncbi.nlm.nih.gov/27689988" }, { "database": "PubMed", "id": "27702567", "url": "https://pubmed.ncbi.nlm.nih.gov/27702567" }, { "database": "PubMed", "id": "27734117", "url": "https://pubmed.ncbi.nlm.nih.gov/27734117" }, { "database": "PubMed", "id": "27765055", "url": "https://pubmed.ncbi.nlm.nih.gov/27765055" }, { "database": "PubMed", "id": "27778132", "url": "https://pubmed.ncbi.nlm.nih.gov/27778132" }, { "database": "PubMed", "id": "27799485", "url": "https://pubmed.ncbi.nlm.nih.gov/27799485" }, { "database": "PubMed", "id": "27849007", "url": "https://pubmed.ncbi.nlm.nih.gov/27849007" }, { "database": "PubMed", "id": "27861634", "url": "https://pubmed.ncbi.nlm.nih.gov/27861634" }, { "database": "PubMed", "id": "27876711", "url": "https://pubmed.ncbi.nlm.nih.gov/27876711" }, { "database": "PubMed", "id": "27876874", "url": "https://pubmed.ncbi.nlm.nih.gov/27876874" }, { "database": "PubMed", "id": "27893783", "url": "https://pubmed.ncbi.nlm.nih.gov/27893783" }, { "database": "PubMed", "id": "27897192", "url": "https://pubmed.ncbi.nlm.nih.gov/27897192" }, { "database": "PubMed", "id": "27897407", "url": "https://pubmed.ncbi.nlm.nih.gov/27897407" }, { "database": "PubMed", "id": "27922594", "url": "https://pubmed.ncbi.nlm.nih.gov/27922594" }, { "database": "PubMed", "id": "27930667", "url": "https://pubmed.ncbi.nlm.nih.gov/27930667" }, { "database": "PubMed", "id": "27935220", "url": "https://pubmed.ncbi.nlm.nih.gov/27935220" }, { "database": "PubMed", "id": "27940127", "url": "https://pubmed.ncbi.nlm.nih.gov/27940127" }, { "database": "PubMed", "id": "27966074", "url": "https://pubmed.ncbi.nlm.nih.gov/27966074" }, { "database": "PubMed", "id": "27980227", "url": "https://pubmed.ncbi.nlm.nih.gov/27980227" }, { "database": "PubMed", "id": "28005008", "url": "https://pubmed.ncbi.nlm.nih.gov/28005008" }, { "database": "PubMed", "id": "28050125", "url": "https://pubmed.ncbi.nlm.nih.gov/28050125" }, { "database": "PubMed", "id": "28107427", "url": "https://pubmed.ncbi.nlm.nih.gov/28107427" }, { "database": "PubMed", "id": "28123341", "url": "https://pubmed.ncbi.nlm.nih.gov/28123341" }, { "database": "PubMed", "id": "28123351", "url": "https://pubmed.ncbi.nlm.nih.gov/28123351" }, { "database": "PubMed", "id": "28123943", "url": "https://pubmed.ncbi.nlm.nih.gov/28123943" }, { "database": "PubMed", "id": "28152035", "url": "https://pubmed.ncbi.nlm.nih.gov/28152035" }, { "database": "PubMed", "id": "28186492", "url": "https://pubmed.ncbi.nlm.nih.gov/28186492" }, { "database": "PubMed", "id": "28209725", "url": "https://pubmed.ncbi.nlm.nih.gov/28209725" }, { "database": "PubMed", "id": "28212537", "url": "https://pubmed.ncbi.nlm.nih.gov/28212537" }, { "database": "PubMed", "id": "28225038", "url": "https://pubmed.ncbi.nlm.nih.gov/28225038" }, { "database": "PubMed", "id": "28230282", "url": "https://pubmed.ncbi.nlm.nih.gov/28230282" }, { "database": "PubMed", "id": "28230856", "url": "https://pubmed.ncbi.nlm.nih.gov/28230856" }, { "database": "PubMed", "id": "28243164", "url": "https://pubmed.ncbi.nlm.nih.gov/28243164" }, { "database": "PubMed", "id": "28264587", "url": "https://pubmed.ncbi.nlm.nih.gov/28264587" }, { "database": "PubMed", "id": "28285180", "url": "https://pubmed.ncbi.nlm.nih.gov/28285180" }, { "database": "PubMed", "id": "28294959", "url": "https://pubmed.ncbi.nlm.nih.gov/28294959" }, { "database": "PubMed", "id": "28298211", "url": "https://pubmed.ncbi.nlm.nih.gov/28298211" }, { "database": "PubMed", "id": "28319140", "url": "https://pubmed.ncbi.nlm.nih.gov/28319140" }, { "database": "PubMed", "id": "28329851", "url": "https://pubmed.ncbi.nlm.nih.gov/28329851" }, { "database": "PubMed", "id": "28331616", "url": "https://pubmed.ncbi.nlm.nih.gov/28331616" }, { "database": "PubMed", "id": "28333124", "url": "https://pubmed.ncbi.nlm.nih.gov/28333124" }, { "database": "PubMed", "id": "28346493", "url": "https://pubmed.ncbi.nlm.nih.gov/28346493" }, { "database": "PubMed", "id": "28350865", "url": "https://pubmed.ncbi.nlm.nih.gov/28350865" }, { "database": "PubMed", "id": "28364027", "url": "https://pubmed.ncbi.nlm.nih.gov/28364027" }, { "database": "PubMed", "id": "28368423", "url": "https://pubmed.ncbi.nlm.nih.gov/28368423" }, { "database": "PubMed", "id": "28373901", "url": "https://pubmed.ncbi.nlm.nih.gov/28373901" }, { "database": "PubMed", "id": "28386126", "url": "https://pubmed.ncbi.nlm.nih.gov/28386126" }, { "database": "PubMed", "id": "28395173", "url": "https://pubmed.ncbi.nlm.nih.gov/28395173" }, { "database": "PubMed", "id": "28424421", "url": "https://pubmed.ncbi.nlm.nih.gov/28424421" }, { "database": "PubMed", "id": "28425986", "url": "https://pubmed.ncbi.nlm.nih.gov/28425986" }, { "database": "PubMed", "id": "28426713", "url": "https://pubmed.ncbi.nlm.nih.gov/28426713" }, { "database": "PubMed", "id": "28440748", "url": "https://pubmed.ncbi.nlm.nih.gov/28440748" }, { "database": "PubMed", "id": "28461774", "url": "https://pubmed.ncbi.nlm.nih.gov/28461774" }, { "database": "PubMed", "id": "28489892", "url": "https://pubmed.ncbi.nlm.nih.gov/28489892" }, { "database": "PubMed", "id": "28490443", "url": "https://pubmed.ncbi.nlm.nih.gov/28490443" }, { "database": "PubMed", "id": "28526415", "url": "https://pubmed.ncbi.nlm.nih.gov/28526415" }, { "database": "PubMed", "id": "28529539", "url": "https://pubmed.ncbi.nlm.nih.gov/28529539" }, { "database": "PubMed", "id": "28539257", "url": "https://pubmed.ncbi.nlm.nih.gov/28539257" }, { "database": "PubMed", "id": "28542434", "url": "https://pubmed.ncbi.nlm.nih.gov/28542434" }, { "database": "PubMed", "id": "28560349", "url": "https://pubmed.ncbi.nlm.nih.gov/28560349" }, { "database": "PubMed", "id": "28591208", "url": "https://pubmed.ncbi.nlm.nih.gov/28591208" }, { "database": "PubMed", "id": "28632169", "url": "https://pubmed.ncbi.nlm.nih.gov/28632169" }, { "database": "PubMed", "id": "28665395", "url": "https://pubmed.ncbi.nlm.nih.gov/28665395" }, { "database": "PubMed", "id": "28675664", "url": "https://pubmed.ncbi.nlm.nih.gov/28675664" }, { "database": "PubMed", "id": "28700632", "url": "https://pubmed.ncbi.nlm.nih.gov/28700632" }, { "database": "PubMed", "id": "28710412", "url": "https://pubmed.ncbi.nlm.nih.gov/28710412" }, { "database": "PubMed", "id": "28745831", "url": "https://pubmed.ncbi.nlm.nih.gov/28745831" }, { "database": "PubMed", "id": "28752031", "url": "https://pubmed.ncbi.nlm.nih.gov/28752031" }, { "database": "PubMed", "id": "28759639", "url": "https://pubmed.ncbi.nlm.nih.gov/28759639" }, { "database": "PubMed", "id": "28783756", "url": "https://pubmed.ncbi.nlm.nih.gov/28783756" }, { "database": "PubMed", "id": "28821740", "url": "https://pubmed.ncbi.nlm.nih.gov/28821740" }, { "database": "PubMed", "id": "28834262", "url": "https://pubmed.ncbi.nlm.nih.gov/28834262" }, { "database": "PubMed", "id": "28835690", "url": "https://pubmed.ncbi.nlm.nih.gov/28835690" }, { "database": "PubMed", "id": "28859155", "url": "https://pubmed.ncbi.nlm.nih.gov/28859155" }, { "database": "PubMed", "id": "28870245", "url": "https://pubmed.ncbi.nlm.nih.gov/28870245" }, { "database": "PubMed", "id": "28874678", "url": "https://pubmed.ncbi.nlm.nih.gov/28874678" }, { "database": "PubMed", "id": "28875936", "url": "https://pubmed.ncbi.nlm.nih.gov/28875936" }, { "database": "PubMed", "id": "28878342", "url": "https://pubmed.ncbi.nlm.nih.gov/28878342" }, { "database": "PubMed", "id": "28883493", "url": "https://pubmed.ncbi.nlm.nih.gov/28883493" }, { "database": "PubMed", "id": "28883758", "url": "https://pubmed.ncbi.nlm.nih.gov/28883758" }, { "database": "PubMed", "id": "28933316", "url": "https://pubmed.ncbi.nlm.nih.gov/28933316" }, { "database": "PubMed", "id": "28962394", "url": "https://pubmed.ncbi.nlm.nih.gov/28962394" }, { "database": "PubMed", "id": "28978011", "url": "https://pubmed.ncbi.nlm.nih.gov/28978011" }, { "database": "PubMed", "id": "28979184", "url": "https://pubmed.ncbi.nlm.nih.gov/28979184" }, { "database": "PubMed", "id": "29035165", "url": "https://pubmed.ncbi.nlm.nih.gov/29035165" }, { "database": "PubMed", "id": "29038536", "url": "https://pubmed.ncbi.nlm.nih.gov/29038536" }, { "database": "PubMed", "id": "29057818", "url": "https://pubmed.ncbi.nlm.nih.gov/29057818" }, { "database": "PubMed", "id": "29085990", "url": "https://pubmed.ncbi.nlm.nih.gov/29085990" }, { "database": "PubMed", "id": "29104499", "url": "https://pubmed.ncbi.nlm.nih.gov/29104499" }, { "database": "PubMed", "id": "29109794", "url": "https://pubmed.ncbi.nlm.nih.gov/29109794" }, { "database": "PubMed", "id": "29118722", "url": "https://pubmed.ncbi.nlm.nih.gov/29118722" }, { "database": "PubMed", "id": "29121094", "url": "https://pubmed.ncbi.nlm.nih.gov/29121094" }, { "database": "PubMed", "id": "29123170", "url": "https://pubmed.ncbi.nlm.nih.gov/29123170" }, { "database": "PubMed", "id": "29133930", "url": "https://pubmed.ncbi.nlm.nih.gov/29133930" }, { "database": "PubMed", "id": "29159980", "url": "https://pubmed.ncbi.nlm.nih.gov/29159980" }, { "database": "PubMed", "id": "29163149", "url": "https://pubmed.ncbi.nlm.nih.gov/29163149" }, { "database": "PubMed", "id": "29170374", "url": "https://pubmed.ncbi.nlm.nih.gov/29170374" }, { "database": "PubMed", "id": "29180704", "url": "https://pubmed.ncbi.nlm.nih.gov/29180704" }, { "database": "PubMed", "id": "29184057", "url": "https://pubmed.ncbi.nlm.nih.gov/29184057" }, { "database": "PubMed", "id": "29223528", "url": "https://pubmed.ncbi.nlm.nih.gov/29223528" }, { "database": "PubMed", "id": "29239329", "url": "https://pubmed.ncbi.nlm.nih.gov/29239329" }, { "database": "PubMed", "id": "29244772", "url": "https://pubmed.ncbi.nlm.nih.gov/29244772" }, { "database": "PubMed", "id": "29247431", "url": "https://pubmed.ncbi.nlm.nih.gov/29247431" }, { "database": "PubMed", "id": "29304075", "url": "https://pubmed.ncbi.nlm.nih.gov/29304075" }, { "database": "PubMed", "id": "29311937", "url": "https://pubmed.ncbi.nlm.nih.gov/29311937" }, { "database": "PubMed", "id": "29364220", "url": "https://pubmed.ncbi.nlm.nih.gov/29364220" }, { "database": "PubMed", "id": "29379062", "url": "https://pubmed.ncbi.nlm.nih.gov/29379062" }, { "database": "PubMed", "id": "29384221", "url": "https://pubmed.ncbi.nlm.nih.gov/29384221" }, { "database": "PubMed", "id": "29402989", "url": "https://pubmed.ncbi.nlm.nih.gov/29402989" }, { "database": "PubMed", "id": "29410630", "url": "https://pubmed.ncbi.nlm.nih.gov/29410630" }, { "database": "PubMed", "id": "29433422", "url": "https://pubmed.ncbi.nlm.nih.gov/29433422" }, { "database": "PubMed", "id": "29453154", "url": "https://pubmed.ncbi.nlm.nih.gov/29453154" }, { "database": "PubMed", "id": "29464929", "url": "https://pubmed.ncbi.nlm.nih.gov/29464929" }, { "database": "PubMed", "id": "29472543", "url": "https://pubmed.ncbi.nlm.nih.gov/29472543" }, { "database": "PubMed", "id": "29486284", "url": "https://pubmed.ncbi.nlm.nih.gov/29486284" }, { "database": "PubMed", "id": "29487597", "url": "https://pubmed.ncbi.nlm.nih.gov/29487597" }, { "database": "PubMed", "id": "29494346", "url": "https://pubmed.ncbi.nlm.nih.gov/29494346" }, { "database": "PubMed", "id": "29495962", "url": "https://pubmed.ncbi.nlm.nih.gov/29495962" }, { "database": "PubMed", "id": "29530069", "url": "https://pubmed.ncbi.nlm.nih.gov/29530069" }, { "database": "PubMed", "id": "29535623", "url": "https://pubmed.ncbi.nlm.nih.gov/29535623" }, { "database": "PubMed", "id": "29535720", "url": "https://pubmed.ncbi.nlm.nih.gov/29535720" }, { "database": "PubMed", "id": "29560100", "url": "https://pubmed.ncbi.nlm.nih.gov/29560100" }, { "database": "PubMed", "id": "29615924", "url": "https://pubmed.ncbi.nlm.nih.gov/29615924" }, { "database": "PubMed", "id": "29657993", "url": "https://pubmed.ncbi.nlm.nih.gov/29657993" }, { "database": "PubMed", "id": "29662189", "url": "https://pubmed.ncbi.nlm.nih.gov/29662189" }, { "database": "PubMed", "id": "29700562", "url": "https://pubmed.ncbi.nlm.nih.gov/29700562" }, { "database": "PubMed", "id": "29720580", "url": "https://pubmed.ncbi.nlm.nih.gov/29720580" }, { "database": "PubMed", "id": "29725001", "url": "https://pubmed.ncbi.nlm.nih.gov/29725001" }, { "database": "PubMed", "id": "29748608", "url": "https://pubmed.ncbi.nlm.nih.gov/29748608" }, { "database": "PubMed", "id": "29763645", "url": "https://pubmed.ncbi.nlm.nih.gov/29763645" }, { "database": "PubMed", "id": "29769144", "url": "https://pubmed.ncbi.nlm.nih.gov/29769144" }, { "database": "PubMed", "id": "29775456", "url": "https://pubmed.ncbi.nlm.nih.gov/29775456" }, { "database": "PubMed", "id": "29853881", "url": "https://pubmed.ncbi.nlm.nih.gov/29853881" }, { "database": "PubMed", "id": "29855474", "url": "https://pubmed.ncbi.nlm.nih.gov/29855474" }, { "database": "PubMed", "id": "29860106", "url": "https://pubmed.ncbi.nlm.nih.gov/29860106" }, { "database": "PubMed", "id": "29867489", "url": "https://pubmed.ncbi.nlm.nih.gov/29867489" }, { "database": "PubMed", "id": "29872253", "url": "https://pubmed.ncbi.nlm.nih.gov/29872253" }, { "database": "PubMed", "id": "29920520", "url": "https://pubmed.ncbi.nlm.nih.gov/29920520" }, { "database": "PubMed", "id": "29930536", "url": "https://pubmed.ncbi.nlm.nih.gov/29930536" }, { "database": "PubMed", "id": "29962852", "url": "https://pubmed.ncbi.nlm.nih.gov/29962852" }, { "database": "PubMed", "id": "30005372", "url": "https://pubmed.ncbi.nlm.nih.gov/30005372" }, { "database": "PubMed", "id": "30014636", "url": "https://pubmed.ncbi.nlm.nih.gov/30014636" }, { "database": "PubMed", "id": "30018139", "url": "https://pubmed.ncbi.nlm.nih.gov/30018139" }, { "database": "PubMed", "id": "30022023", "url": "https://pubmed.ncbi.nlm.nih.gov/30022023" }, { "database": "PubMed", "id": "30065170", "url": "https://pubmed.ncbi.nlm.nih.gov/30065170" }, { "database": "PubMed", "id": "30078230", "url": "https://pubmed.ncbi.nlm.nih.gov/30078230" }, { "database": "PubMed", "id": "30103648", "url": "https://pubmed.ncbi.nlm.nih.gov/30103648" }, { "database": "PubMed", "id": "30150922", "url": "https://pubmed.ncbi.nlm.nih.gov/30150922" }, { "database": "PubMed", "id": "30156060", "url": "https://pubmed.ncbi.nlm.nih.gov/30156060" }, { "database": "PubMed", "id": "30186439", "url": "https://pubmed.ncbi.nlm.nih.gov/30186439" }, { "database": "PubMed", "id": "30211334", "url": "https://pubmed.ncbi.nlm.nih.gov/30211334" }, { "database": "PubMed", "id": "30231545", "url": "https://pubmed.ncbi.nlm.nih.gov/30231545" }, { "database": "PubMed", "id": "30237867", "url": "https://pubmed.ncbi.nlm.nih.gov/30237867" }, { "database": "PubMed", "id": "30250638", "url": "https://pubmed.ncbi.nlm.nih.gov/30250638" }, { "database": "PubMed", "id": "30279732", "url": "https://pubmed.ncbi.nlm.nih.gov/30279732" }, { "database": "PubMed", "id": "30378754", "url": "https://pubmed.ncbi.nlm.nih.gov/30378754" }, { "database": "PubMed", "id": "30384400", "url": "https://pubmed.ncbi.nlm.nih.gov/30384400" }, { "database": "PubMed", "id": "30391477", "url": "https://pubmed.ncbi.nlm.nih.gov/30391477" }, { "database": "PubMed", "id": "30391964", "url": "https://pubmed.ncbi.nlm.nih.gov/30391964" }, { "database": "PubMed", "id": "30402124", "url": "https://pubmed.ncbi.nlm.nih.gov/30402124" }, { "database": "PubMed", "id": "30409162", "url": "https://pubmed.ncbi.nlm.nih.gov/30409162" }, { "database": "PubMed", "id": "30409503", "url": "https://pubmed.ncbi.nlm.nih.gov/30409503" }, { "database": "PubMed", "id": "30410062", "url": "https://pubmed.ncbi.nlm.nih.gov/30410062" }, { "database": "PubMed", "id": "30414960", "url": "https://pubmed.ncbi.nlm.nih.gov/30414960" }, { "database": "PubMed", "id": "30429249", "url": "https://pubmed.ncbi.nlm.nih.gov/30429249" }, { "database": "PubMed", "id": "30450767", "url": "https://pubmed.ncbi.nlm.nih.gov/30450767" }, { "database": "PubMed", "id": "30509210", "url": "https://pubmed.ncbi.nlm.nih.gov/30509210" }, { "database": "PubMed", "id": "30515090", "url": "https://pubmed.ncbi.nlm.nih.gov/30515090" }, { "database": "PubMed", "id": "30554658", "url": "https://pubmed.ncbi.nlm.nih.gov/30554658" }, { "database": "PubMed", "id": "30556043", "url": "https://pubmed.ncbi.nlm.nih.gov/30556043" }, { "database": "PubMed", "id": "30578122", "url": "https://pubmed.ncbi.nlm.nih.gov/30578122" }, { "database": "PubMed", "id": "30626204", "url": "https://pubmed.ncbi.nlm.nih.gov/30626204" }, { "database": "PubMed", "id": "30635036", "url": "https://pubmed.ncbi.nlm.nih.gov/30635036" }, { "database": "PubMed", "id": "30696333", "url": "https://pubmed.ncbi.nlm.nih.gov/30696333" }, { "database": "PubMed", "id": "30717198", "url": "https://pubmed.ncbi.nlm.nih.gov/30717198" }, { "database": "PubMed", "id": "30806987", "url": "https://pubmed.ncbi.nlm.nih.gov/30806987" }, { "database": "PubMed", "id": "30816216", "url": "https://pubmed.ncbi.nlm.nih.gov/30816216" }, { "database": "PubMed", "id": "30823934", "url": "https://pubmed.ncbi.nlm.nih.gov/30823934" }, { "database": "PubMed", "id": "30862120", "url": "https://pubmed.ncbi.nlm.nih.gov/30862120" }, { "database": "PubMed", "id": "30936879", "url": "https://pubmed.ncbi.nlm.nih.gov/30936879" }, { "database": "PubMed", "id": "30972066", "url": "https://pubmed.ncbi.nlm.nih.gov/30972066" }, { "database": "PubMed", "id": "30988282", "url": "https://pubmed.ncbi.nlm.nih.gov/30988282" }, { "database": "PubMed", "id": "31112530", "url": "https://pubmed.ncbi.nlm.nih.gov/31112530" }, { "database": "PubMed", "id": "31115790", "url": "https://pubmed.ncbi.nlm.nih.gov/31115790" }, { "database": "PubMed", "id": "31125414", "url": "https://pubmed.ncbi.nlm.nih.gov/31125414" }, { "database": "PubMed", "id": "31155593", "url": "https://pubmed.ncbi.nlm.nih.gov/31155593" }, { "database": "PubMed", "id": "31159888", "url": "https://pubmed.ncbi.nlm.nih.gov/31159888" }, { "database": "PubMed", "id": "31161862", "url": "https://pubmed.ncbi.nlm.nih.gov/31161862" }, { "database": "PubMed", "id": "31167373", "url": "https://pubmed.ncbi.nlm.nih.gov/31167373" }, { "database": "PubMed", "id": "31182807", "url": "https://pubmed.ncbi.nlm.nih.gov/31182807" }, { "database": "PubMed", "id": "31182914", "url": "https://pubmed.ncbi.nlm.nih.gov/31182914" }, { "database": "PubMed", "id": "31205503", "url": "https://pubmed.ncbi.nlm.nih.gov/31205503" }, { "database": "PubMed", "id": "31213670", "url": "https://pubmed.ncbi.nlm.nih.gov/31213670" }, { "database": "PubMed", "id": "31215459", "url": "https://pubmed.ncbi.nlm.nih.gov/31215459" }, { "database": "PubMed", "id": "31233346", "url": "https://pubmed.ncbi.nlm.nih.gov/31233346" }, { "database": "PubMed", "id": "31279779", "url": "https://pubmed.ncbi.nlm.nih.gov/31279779" }, { "database": "PubMed", "id": "31307481", "url": "https://pubmed.ncbi.nlm.nih.gov/31307481" }, { "database": "PubMed", "id": "31337981", "url": "https://pubmed.ncbi.nlm.nih.gov/31337981" }, { "database": "PubMed", "id": "31345225", "url": "https://pubmed.ncbi.nlm.nih.gov/31345225" }, { "database": "PubMed", "id": "31366324", "url": "https://pubmed.ncbi.nlm.nih.gov/31366324" }, { "database": "PubMed", "id": "31372175", "url": "https://pubmed.ncbi.nlm.nih.gov/31372175" }, { "database": "PubMed", "id": "31391499", "url": "https://pubmed.ncbi.nlm.nih.gov/31391499" }, { "database": "PubMed", "id": "31398213", "url": "https://pubmed.ncbi.nlm.nih.gov/31398213" }, { "database": "PubMed", "id": "31399584", "url": "https://pubmed.ncbi.nlm.nih.gov/31399584" }, { "database": "PubMed", "id": "31420304", "url": "https://pubmed.ncbi.nlm.nih.gov/31420304" }, { "database": "PubMed", "id": "31447681", "url": "https://pubmed.ncbi.nlm.nih.gov/31447681" }, { "database": "PubMed", "id": "31462256", "url": "https://pubmed.ncbi.nlm.nih.gov/31462256" }, { "database": "PubMed", "id": "31470507", "url": "https://pubmed.ncbi.nlm.nih.gov/31470507" }, { "database": "PubMed", "id": "31519159", "url": "https://pubmed.ncbi.nlm.nih.gov/31519159" }, { "database": "PubMed", "id": "31551760", "url": "https://pubmed.ncbi.nlm.nih.gov/31551760" }, { "database": "PubMed", "id": "31570855", "url": "https://pubmed.ncbi.nlm.nih.gov/31570855" }, { "database": "PubMed", "id": "31572367", "url": "https://pubmed.ncbi.nlm.nih.gov/31572367" }, { "database": "PubMed", "id": "31614949", "url": "https://pubmed.ncbi.nlm.nih.gov/31614949" }, { "database": "PubMed", "id": "31624287", "url": "https://pubmed.ncbi.nlm.nih.gov/31624287" }, { "database": "PubMed", "id": "31652791", "url": "https://pubmed.ncbi.nlm.nih.gov/31652791" }, { "database": "PubMed", "id": "31767175", "url": "https://pubmed.ncbi.nlm.nih.gov/31767175" }, { "database": "PubMed", "id": "31767180", "url": "https://pubmed.ncbi.nlm.nih.gov/31767180" }, { "database": "PubMed", "id": "31771622", "url": "https://pubmed.ncbi.nlm.nih.gov/31771622" }, { "database": "PubMed", "id": "31783835", "url": "https://pubmed.ncbi.nlm.nih.gov/31783835" }, { "database": "PubMed", "id": "31821410", "url": "https://pubmed.ncbi.nlm.nih.gov/31821410" }, { "database": "PubMed", "id": "31827703", "url": "https://pubmed.ncbi.nlm.nih.gov/31827703" }, { "database": "PubMed", "id": "31850494", "url": "https://pubmed.ncbi.nlm.nih.gov/31850494" }, { "database": "PubMed", "id": "31857853", "url": "https://pubmed.ncbi.nlm.nih.gov/31857853" }, { "database": "PubMed", "id": "31903103", "url": "https://pubmed.ncbi.nlm.nih.gov/31903103" }, { "database": "PubMed", "id": "31918917", "url": "https://pubmed.ncbi.nlm.nih.gov/31918917" }, { "database": "PubMed", "id": "31918924", "url": "https://pubmed.ncbi.nlm.nih.gov/31918924" }, { "database": "PubMed", "id": "31924750", "url": "https://pubmed.ncbi.nlm.nih.gov/31924750" }, { "database": "PubMed", "id": "31929511", "url": "https://pubmed.ncbi.nlm.nih.gov/31929511" }, { "database": "PubMed", "id": "31931851", "url": "https://pubmed.ncbi.nlm.nih.gov/31931851" }, { "database": "PubMed", "id": "31959776", "url": "https://pubmed.ncbi.nlm.nih.gov/31959776" }, { "database": "PubMed", "id": "31970200", "url": "https://pubmed.ncbi.nlm.nih.gov/31970200" }, { "database": "PubMed", "id": "31980707", "url": "https://pubmed.ncbi.nlm.nih.gov/31980707" }, { "database": "PubMed", "id": "32038161", "url": "https://pubmed.ncbi.nlm.nih.gov/32038161" }, { "database": "PubMed", "id": "32046324", "url": "https://pubmed.ncbi.nlm.nih.gov/32046324" }, { "database": "PubMed", "id": "32075060", "url": "https://pubmed.ncbi.nlm.nih.gov/32075060" }, { "database": "PubMed", "id": "32079307", "url": "https://pubmed.ncbi.nlm.nih.gov/32079307" }, { "database": "PubMed", "id": "32085796", "url": "https://pubmed.ncbi.nlm.nih.gov/32085796" }, { "database": "PubMed", "id": "32086008", "url": "https://pubmed.ncbi.nlm.nih.gov/32086008" }, { "database": "PubMed", "id": "32101748", "url": "https://pubmed.ncbi.nlm.nih.gov/32101748" }, { "database": "PubMed", "id": "32127592", "url": "https://pubmed.ncbi.nlm.nih.gov/32127592" }, { "database": "PubMed", "id": "32131762", "url": "https://pubmed.ncbi.nlm.nih.gov/32131762" }, { "database": "PubMed", "id": "32153410", "url": "https://pubmed.ncbi.nlm.nih.gov/32153410" }, { "database": "PubMed", "id": "32163656", "url": "https://pubmed.ncbi.nlm.nih.gov/32163656" }, { "database": "PubMed", "id": "32173345", "url": "https://pubmed.ncbi.nlm.nih.gov/32173345" }, { "database": "PubMed", "id": "32194423", "url": "https://pubmed.ncbi.nlm.nih.gov/32194423" }, { "database": "PubMed", "id": "32198214", "url": "https://pubmed.ncbi.nlm.nih.gov/32198214" }, { "database": "PubMed", "id": "32275682", "url": "https://pubmed.ncbi.nlm.nih.gov/32275682" }, { "database": "PubMed", "id": "32276588", "url": "https://pubmed.ncbi.nlm.nih.gov/32276588" }, { "database": "PubMed", "id": "32312949", "url": "https://pubmed.ncbi.nlm.nih.gov/32312949" }, { "database": "PubMed", "id": "32316601", "url": "https://pubmed.ncbi.nlm.nih.gov/32316601" }, { "database": "PubMed", "id": "32341362", "url": "https://pubmed.ncbi.nlm.nih.gov/32341362" }, { "database": "PubMed", "id": "32354153", "url": "https://pubmed.ncbi.nlm.nih.gov/32354153" }, { "database": "PubMed", "id": "32366272", "url": "https://pubmed.ncbi.nlm.nih.gov/32366272" }, { "database": "PubMed", "id": "32373532", "url": "https://pubmed.ncbi.nlm.nih.gov/32373532" }, { "database": "PubMed", "id": "32379706", "url": "https://pubmed.ncbi.nlm.nih.gov/32379706" }, { "database": "PubMed", "id": "32427102", "url": "https://pubmed.ncbi.nlm.nih.gov/32427102" }, { "database": "PubMed", "id": "32483262", "url": "https://pubmed.ncbi.nlm.nih.gov/32483262" }, { "database": "PubMed", "id": "32493400", "url": "https://pubmed.ncbi.nlm.nih.gov/32493400" }, { "database": "PubMed", "id": "32531473", "url": "https://pubmed.ncbi.nlm.nih.gov/32531473" }, { "database": "PubMed", "id": "32555370", "url": "https://pubmed.ncbi.nlm.nih.gov/32555370" }, { "database": "PubMed", "id": "32566257", "url": "https://pubmed.ncbi.nlm.nih.gov/32566257" }, { "database": "PubMed", "id": "32581790", "url": "https://pubmed.ncbi.nlm.nih.gov/32581790" }, { "database": "PubMed", "id": "32596245", "url": "https://pubmed.ncbi.nlm.nih.gov/32596245" }, { "database": "PubMed", "id": "32615737", "url": "https://pubmed.ncbi.nlm.nih.gov/32615737" }, { "database": "PubMed", "id": "32616893", "url": "https://pubmed.ncbi.nlm.nih.gov/32616893" }, { "database": "PubMed", "id": "32636842", "url": "https://pubmed.ncbi.nlm.nih.gov/32636842" }, { "database": "PubMed", "id": "32641498", "url": "https://pubmed.ncbi.nlm.nih.gov/32641498" }, { "database": "PubMed", "id": "32659127", "url": "https://pubmed.ncbi.nlm.nih.gov/32659127" }, { "database": "PubMed", "id": "32699356", "url": "https://pubmed.ncbi.nlm.nih.gov/32699356" }, { "database": "PubMed", "id": "32716920", "url": "https://pubmed.ncbi.nlm.nih.gov/32716920" }, { "database": "PubMed", "id": "32719388", "url": "https://pubmed.ncbi.nlm.nih.gov/32719388" }, { "database": "PubMed", "id": "32728173", "url": "https://pubmed.ncbi.nlm.nih.gov/32728173" }, { "database": "PubMed", "id": "32742256", "url": "https://pubmed.ncbi.nlm.nih.gov/32742256" }, { "database": "PubMed", "id": "32783890", "url": "https://pubmed.ncbi.nlm.nih.gov/32783890" }, { "database": "PubMed", "id": "32792672", "url": "https://pubmed.ncbi.nlm.nih.gov/32792672" }, { "database": "PubMed", "id": "32796688", "url": "https://pubmed.ncbi.nlm.nih.gov/32796688" }, { "database": "PubMed", "id": "32796834", "url": "https://pubmed.ncbi.nlm.nih.gov/32796834" }, { "database": "PubMed", "id": "32849638", "url": "https://pubmed.ncbi.nlm.nih.gov/32849638" }, { "database": "PubMed", "id": "32859869", "url": "https://pubmed.ncbi.nlm.nih.gov/32859869" }, { "database": "PubMed", "id": "32863210", "url": "https://pubmed.ncbi.nlm.nih.gov/32863210" }, { "database": "PubMed", "id": "32873626", "url": "https://pubmed.ncbi.nlm.nih.gov/32873626" }, { "database": "PubMed", "id": "32891670", "url": "https://pubmed.ncbi.nlm.nih.gov/32891670" }, { "database": "PubMed", "id": "32899862", "url": "https://pubmed.ncbi.nlm.nih.gov/32899862" }, { "database": "PubMed", "id": "32911704", "url": "https://pubmed.ncbi.nlm.nih.gov/32911704" }, { "database": "PubMed", "id": "32937140", "url": "https://pubmed.ncbi.nlm.nih.gov/32937140" }, { "database": "PubMed", "id": "32940423", "url": "https://pubmed.ncbi.nlm.nih.gov/32940423" }, { "database": "PubMed", "id": "32943626", "url": "https://pubmed.ncbi.nlm.nih.gov/32943626" }, { "database": "PubMed", "id": "32953932", "url": "https://pubmed.ncbi.nlm.nih.gov/32953932" }, { "database": "PubMed", "id": "32956848", "url": "https://pubmed.ncbi.nlm.nih.gov/32956848" }, { "database": "PubMed", "id": "32983109", "url": "https://pubmed.ncbi.nlm.nih.gov/32983109" }, { "database": "PubMed", "id": "32983159", "url": "https://pubmed.ncbi.nlm.nih.gov/32983159" }, { "database": "PubMed", "id": "33005011", "url": "https://pubmed.ncbi.nlm.nih.gov/33005011" }, { "database": "PubMed", "id": "33012785", "url": "https://pubmed.ncbi.nlm.nih.gov/33012785" }, { "database": "PubMed", "id": "33033766", "url": "https://pubmed.ncbi.nlm.nih.gov/33033766" }, { "database": "PubMed", "id": "33038070", "url": "https://pubmed.ncbi.nlm.nih.gov/33038070" }, { "database": "PubMed", "id": "33062046", "url": "https://pubmed.ncbi.nlm.nih.gov/33062046" }, { "database": "PubMed", "id": "33071755", "url": "https://pubmed.ncbi.nlm.nih.gov/33071755" }, { "database": "PubMed", "id": "33114361", "url": "https://pubmed.ncbi.nlm.nih.gov/33114361" }, { "database": "PubMed", "id": "33130679", "url": "https://pubmed.ncbi.nlm.nih.gov/33130679" }, { "database": "PubMed", "id": "33165366", "url": "https://pubmed.ncbi.nlm.nih.gov/33165366" }, { "database": "PubMed", "id": "33184378", "url": "https://pubmed.ncbi.nlm.nih.gov/33184378" }, { "database": "PubMed", "id": "33184414", "url": "https://pubmed.ncbi.nlm.nih.gov/33184414" }, { "database": "PubMed", "id": "33193405", "url": "https://pubmed.ncbi.nlm.nih.gov/33193405" }, { "database": "PubMed", "id": "33210462", "url": "https://pubmed.ncbi.nlm.nih.gov/33210462" }, { "database": "PubMed", "id": "33226552", "url": "https://pubmed.ncbi.nlm.nih.gov/33226552" }, { "database": "PubMed", "id": "33250856", "url": "https://pubmed.ncbi.nlm.nih.gov/33250856" }, { "database": "PubMed", "id": "33275593", "url": "https://pubmed.ncbi.nlm.nih.gov/33275593" }, { "database": "PubMed", "id": "33287820", "url": "https://pubmed.ncbi.nlm.nih.gov/33287820" }, { "database": "PubMed", "id": "33294856", "url": "https://pubmed.ncbi.nlm.nih.gov/33294856" }, { "database": "PubMed", "id": "33320884", "url": "https://pubmed.ncbi.nlm.nih.gov/33320884" }, { "database": "PubMed", "id": "33348907", "url": "https://pubmed.ncbi.nlm.nih.gov/33348907" }, { "database": "PubMed", "id": "33362773", "url": "https://pubmed.ncbi.nlm.nih.gov/33362773" }, { "database": "PubMed", "id": "33413592", "url": "https://pubmed.ncbi.nlm.nih.gov/33413592" }, { "database": "PubMed", "id": "33414476", "url": "https://pubmed.ncbi.nlm.nih.gov/33414476" }, { "database": "PubMed", "id": "33419082", "url": "https://pubmed.ncbi.nlm.nih.gov/33419082" }, { "database": "PubMed", "id": "33435535", "url": "https://pubmed.ncbi.nlm.nih.gov/33435535" }, { "database": "PubMed", "id": "33500390", "url": "https://pubmed.ncbi.nlm.nih.gov/33500390" }, { "database": "PubMed", "id": "33520717", "url": "https://pubmed.ncbi.nlm.nih.gov/33520717" }, { "database": "PubMed", "id": "33532181", "url": "https://pubmed.ncbi.nlm.nih.gov/33532181" }, { "database": "PubMed", "id": "33547321", "url": "https://pubmed.ncbi.nlm.nih.gov/33547321" }, { "database": "PubMed", "id": "33567340", "url": "https://pubmed.ncbi.nlm.nih.gov/33567340" }, { "database": "PubMed", "id": "33595435", "url": "https://pubmed.ncbi.nlm.nih.gov/33595435" }, { "database": "PubMed", "id": "33603781", "url": "https://pubmed.ncbi.nlm.nih.gov/33603781" }, { "database": "PubMed", "id": "33613308", "url": "https://pubmed.ncbi.nlm.nih.gov/33613308" }, { "database": "PubMed", "id": "33633735", "url": "https://pubmed.ncbi.nlm.nih.gov/33633735" }, { "database": "PubMed", "id": "33649479", "url": "https://pubmed.ncbi.nlm.nih.gov/33649479" }, { "database": "PubMed", "id": "33658993", "url": "https://pubmed.ncbi.nlm.nih.gov/33658993" }, { "database": "PubMed", "id": "33659884", "url": "https://pubmed.ncbi.nlm.nih.gov/33659884" }, { "database": "PubMed", "id": "33669811", "url": "https://pubmed.ncbi.nlm.nih.gov/33669811" }, { "database": "PubMed", "id": "33672385", "url": "https://pubmed.ncbi.nlm.nih.gov/33672385" }, { "database": "PubMed", "id": "33677938", "url": "https://pubmed.ncbi.nlm.nih.gov/33677938" }, { "database": "PubMed", "id": "33688389", "url": "https://pubmed.ncbi.nlm.nih.gov/33688389" }, { "database": "PubMed", "id": "33754024", "url": "https://pubmed.ncbi.nlm.nih.gov/33754024" }, { "database": "PubMed", "id": "33758172", "url": "https://pubmed.ncbi.nlm.nih.gov/33758172" }, { "database": "PubMed", "id": "33758188", "url": "https://pubmed.ncbi.nlm.nih.gov/33758188" }, { "database": "PubMed", "id": "33804171", "url": "https://pubmed.ncbi.nlm.nih.gov/33804171" }, { "database": "PubMed", "id": "33807180", "url": "https://pubmed.ncbi.nlm.nih.gov/33807180" }, { "database": "PubMed", "id": "33846776", "url": "https://pubmed.ncbi.nlm.nih.gov/33846776" }, { "database": "PubMed", "id": "33849555", "url": "https://pubmed.ncbi.nlm.nih.gov/33849555" }, { "database": "PubMed", "id": "33869980", "url": "https://pubmed.ncbi.nlm.nih.gov/33869980" }, { "database": "PubMed", "id": "33884100", "url": "https://pubmed.ncbi.nlm.nih.gov/33884100" }, { "database": "PubMed", "id": "33931442", "url": "https://pubmed.ncbi.nlm.nih.gov/33931442" }, { "database": "PubMed", "id": "33941789", "url": "https://pubmed.ncbi.nlm.nih.gov/33941789" }, { "database": "PubMed", "id": "33971888", "url": "https://pubmed.ncbi.nlm.nih.gov/33971888" }, { "database": "PubMed", "id": "34082428", "url": "https://pubmed.ncbi.nlm.nih.gov/34082428" }, { "database": "PubMed", "id": "34208786", "url": "https://pubmed.ncbi.nlm.nih.gov/34208786" }, { "database": "PubMed", "id": "34366869", "url": "https://pubmed.ncbi.nlm.nih.gov/34366869" }, { "database": "PubMed", "id": "34465724", "url": "https://pubmed.ncbi.nlm.nih.gov/34465724" }, { "database": "PubMed", "id": "34988938", "url": "https://pubmed.ncbi.nlm.nih.gov/34988938" }, { "database": "PubMed", "id": "35023763", "url": "https://pubmed.ncbi.nlm.nih.gov/35023763" }, { "database": "PubMed", "id": "35201262", "url": "https://pubmed.ncbi.nlm.nih.gov/35201262" }, { "database": "PubMed", "id": "35224167", "url": "https://pubmed.ncbi.nlm.nih.gov/35224167" }, { "database": "PubMed", "id": "35452152", "url": "https://pubmed.ncbi.nlm.nih.gov/35452152" }, { "database": "PubMed", "id": "35477177", "url": "https://pubmed.ncbi.nlm.nih.gov/35477177" }, { "database": "PubMed", "id": "35748215", "url": "https://pubmed.ncbi.nlm.nih.gov/35748215" }, { "database": "PubMed", "id": "35766003", "url": "https://pubmed.ncbi.nlm.nih.gov/35766003" }, { "database": "PubMed", "id": "35907465", "url": "https://pubmed.ncbi.nlm.nih.gov/35907465" }, { "database": "PubMed", "id": "35964410", "url": "https://pubmed.ncbi.nlm.nih.gov/35964410" }, { "database": "PubMed", "id": "36065437", "url": "https://pubmed.ncbi.nlm.nih.gov/36065437" }, { "database": "PubMed", "id": "36148310", "url": "https://pubmed.ncbi.nlm.nih.gov/36148310" }, { "database": "PubMed", "id": "36198369", "url": "https://pubmed.ncbi.nlm.nih.gov/36198369" }, { "database": "PubMed", "id": "36215790", "url": "https://pubmed.ncbi.nlm.nih.gov/36215790" }, { "database": "PubMed", "id": "36297523", "url": "https://pubmed.ncbi.nlm.nih.gov/36297523" }, { "database": "PubMed", "id": "36325883", "url": "https://pubmed.ncbi.nlm.nih.gov/36325883" }, { "database": "PubMed", "id": "9927197", "url": "https://pubmed.ncbi.nlm.nih.gov/9927197" }, { "database": "PubMed", "id": "27430312", "url": "https://pubmed.ncbi.nlm.nih.gov/27430312" }, { "database": "PubMed", "id": "15753085", "url": "https://pubmed.ncbi.nlm.nih.gov/15753085" }, { "database": "PubMed", "id": "26095253", "url": "https://pubmed.ncbi.nlm.nih.gov/26095253" }, { "database": "PubMed", "id": "26107252", "url": "https://pubmed.ncbi.nlm.nih.gov/26107252" }, { "database": "PubMed", "id": "26359501", "url": "https://pubmed.ncbi.nlm.nih.gov/26359501" }, { "database": "PubMed", "id": "32350463", "url": "https://pubmed.ncbi.nlm.nih.gov/32350463" }, { "database": "PubMed", "id": "12783884", "url": "https://pubmed.ncbi.nlm.nih.gov/12783884" } ], "site_lbl": "Ser473", "uniprot_canonical_ac": "P31750-1" } ], "record_id": "pubmed.24156551", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PI3K-C2gamma is a Rab5 effector selectively controlling endosomal Akt2 activation downstream of insulin signalling.", "journal": "Nature communications", "date": "2015", "authors": "Braccini L, Ciraolo E, Campa CC, Perino A, Longo DL, Tibolla G, Pregnolato M, Cao Y, Tassone B, Damilano F, Laffargue M, Calautti E, Falasca M, Norata GD, Backer JM, Hirsch E", "reference": { "type": "PubMed", "id": "26100075", "url": "https://pubmed.ncbi.nlm.nih.gov/26100075" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P31750-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "Akt1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 309, "end_pos": 309, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PDPK1", "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" }, { "database": "iPTMnet", "id": "Q60823", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q60823" }, { "database": "PubMed", "id": "26100075", "url": "https://pubmed.ncbi.nlm.nih.gov/26100075" }, { "database": "PubMed", "id": "27251941", "url": "https://pubmed.ncbi.nlm.nih.gov/27251941" } ], "site_lbl": "Thr309", "uniprot_canonical_ac": "Q60823-1" }, { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by IKKE, MTOR, PRKDC and TBK1; alternate", "evidence": [ { "database": "UniProtKB", "id": "P31750", "url": "https://www.uniprot.org/uniprotkb/P31750" }, { "database": "PRO", "id": "P31750", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P31750" }, { "database": "iPTMnet", "id": "P31750", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31750" }, { "database": "PubMed", "id": "27994061", "url": "https://pubmed.ncbi.nlm.nih.gov/27994061" }, { "database": "PubMed", "id": "31915252", "url": "https://pubmed.ncbi.nlm.nih.gov/31915252" }, { "database": "PubMed", "id": "10438924", "url": "https://pubmed.ncbi.nlm.nih.gov/10438924" }, { "database": "PubMed", "id": "10597260", "url": "https://pubmed.ncbi.nlm.nih.gov/10597260" }, { "database": "PubMed", "id": "10714768", "url": "https://pubmed.ncbi.nlm.nih.gov/10714768" }, { "database": "PubMed", "id": "10747954", "url": "https://pubmed.ncbi.nlm.nih.gov/10747954" }, { "database": "PubMed", "id": "10811865", "url": "https://pubmed.ncbi.nlm.nih.gov/10811865" }, { "database": "PubMed", "id": "10969078", "url": "https://pubmed.ncbi.nlm.nih.gov/10969078" }, { "database": "PubMed", "id": "10974038", "url": "https://pubmed.ncbi.nlm.nih.gov/10974038" }, { "database": "PubMed", "id": "11006271", "url": "https://pubmed.ncbi.nlm.nih.gov/11006271" }, { "database": "PubMed", "id": "11018758", "url": "https://pubmed.ncbi.nlm.nih.gov/11018758" }, { "database": "PubMed", "id": "11062251", "url": "https://pubmed.ncbi.nlm.nih.gov/11062251" }, { "database": "PubMed", "id": "11507090", "url": "https://pubmed.ncbi.nlm.nih.gov/11507090" }, { "database": "PubMed", "id": "11563975", "url": "https://pubmed.ncbi.nlm.nih.gov/11563975" }, { "database": "PubMed", "id": "11571285", "url": "https://pubmed.ncbi.nlm.nih.gov/11571285" }, { "database": "PubMed", "id": "11740206", "url": "https://pubmed.ncbi.nlm.nih.gov/11740206" }, { "database": "PubMed", "id": "11950275", "url": "https://pubmed.ncbi.nlm.nih.gov/11950275" }, { "database": "PubMed", "id": "12153489", "url": "https://pubmed.ncbi.nlm.nih.gov/12153489" }, { "database": "PubMed", "id": "12190109", "url": "https://pubmed.ncbi.nlm.nih.gov/12190109" }, { "database": "PubMed", "id": "12464394", "url": "https://pubmed.ncbi.nlm.nih.gov/12464394" }, { "database": "PubMed", "id": "12493740", "url": "https://pubmed.ncbi.nlm.nih.gov/12493740" }, { "database": "PubMed", "id": "12529330", "url": "https://pubmed.ncbi.nlm.nih.gov/12529330" }, { "database": "PubMed", "id": "12633505", "url": "https://pubmed.ncbi.nlm.nih.gov/12633505" }, { "database": "PubMed", "id": "12637511", "url": "https://pubmed.ncbi.nlm.nih.gov/12637511" }, { "database": "PubMed", "id": "12875741", "url": "https://pubmed.ncbi.nlm.nih.gov/12875741" }, { "database": "PubMed", "id": "12911789", "url": "https://pubmed.ncbi.nlm.nih.gov/12911789" }, { "database": "PubMed", "id": "12947100", "url": "https://pubmed.ncbi.nlm.nih.gov/12947100" }, { "database": "PubMed", "id": "14581607", "url": "https://pubmed.ncbi.nlm.nih.gov/14581607" }, { "database": "PubMed", "id": "14603261", "url": "https://pubmed.ncbi.nlm.nih.gov/14603261" }, { "database": "PubMed", "id": "14623889", "url": "https://pubmed.ncbi.nlm.nih.gov/14623889" }, { "database": "PubMed", "id": "14657000", "url": "https://pubmed.ncbi.nlm.nih.gov/14657000" }, { "database": "PubMed", "id": "14997210", "url": "https://pubmed.ncbi.nlm.nih.gov/14997210" }, { "database": "PubMed", "id": "15067018", "url": "https://pubmed.ncbi.nlm.nih.gov/15067018" }, { "database": "PubMed", "id": "15070431", "url": "https://pubmed.ncbi.nlm.nih.gov/15070431" }, { "database": "PubMed", "id": "15278907", "url": "https://pubmed.ncbi.nlm.nih.gov/15278907" }, { "database": "PubMed", "id": "15389876", "url": "https://pubmed.ncbi.nlm.nih.gov/15389876" }, { "database": "PubMed", "id": "15504738", "url": "https://pubmed.ncbi.nlm.nih.gov/15504738" }, { "database": "PubMed", "id": "15505117", "url": "https://pubmed.ncbi.nlm.nih.gov/15505117" }, { "database": "PubMed", "id": "15517884", "url": "https://pubmed.ncbi.nlm.nih.gov/15517884" }, { "database": "PubMed", "id": "15550174", "url": "https://pubmed.ncbi.nlm.nih.gov/15550174" }, { "database": "PubMed", "id": "15591229", "url": "https://pubmed.ncbi.nlm.nih.gov/15591229" }, { "database": "PubMed", "id": "15692086", "url": "https://pubmed.ncbi.nlm.nih.gov/15692086" }, { "database": "PubMed", "id": "15842198", "url": "https://pubmed.ncbi.nlm.nih.gov/15842198" }, { "database": "PubMed", "id": "15845623", "url": "https://pubmed.ncbi.nlm.nih.gov/15845623" }, { "database": "PubMed", "id": "15920762", "url": "https://pubmed.ncbi.nlm.nih.gov/15920762" }, { "database": "PubMed", "id": "15935620", "url": "https://pubmed.ncbi.nlm.nih.gov/15935620" }, { "database": "PubMed", "id": "15987432", "url": "https://pubmed.ncbi.nlm.nih.gov/15987432" }, { "database": "PubMed", "id": "16180585", "url": "https://pubmed.ncbi.nlm.nih.gov/16180585" }, { "database": "PubMed", "id": "16314534", "url": "https://pubmed.ncbi.nlm.nih.gov/16314534" }, { "database": "PubMed", "id": "16338928", "url": "https://pubmed.ncbi.nlm.nih.gov/16338928" }, { "database": "PubMed", "id": "16338957", "url": "https://pubmed.ncbi.nlm.nih.gov/16338957" }, { "database": "PubMed", "id": "16397046", "url": "https://pubmed.ncbi.nlm.nih.gov/16397046" }, { "database": "PubMed", "id": "16489037", "url": "https://pubmed.ncbi.nlm.nih.gov/16489037" }, { "database": "PubMed", "id": "16512910", "url": "https://pubmed.ncbi.nlm.nih.gov/16512910" }, { "database": "PubMed", "id": "16618793", "url": "https://pubmed.ncbi.nlm.nih.gov/16618793" }, { "database": "PubMed", "id": "16787946", "url": "https://pubmed.ncbi.nlm.nih.gov/16787946" }, { "database": "PubMed", "id": "16809629", "url": "https://pubmed.ncbi.nlm.nih.gov/16809629" }, { "database": "PubMed", "id": "16831409", "url": "https://pubmed.ncbi.nlm.nih.gov/16831409" }, { "database": "PubMed", "id": "16845229", "url": "https://pubmed.ncbi.nlm.nih.gov/16845229" }, { "database": "PubMed", "id": "16872509", "url": "https://pubmed.ncbi.nlm.nih.gov/16872509" }, { "database": "PubMed", "id": "17000928", "url": "https://pubmed.ncbi.nlm.nih.gov/17000928" }, { "database": "PubMed", "id": "17190838", "url": "https://pubmed.ncbi.nlm.nih.gov/17190838" }, { "database": "PubMed", "id": "17195063", "url": "https://pubmed.ncbi.nlm.nih.gov/17195063" }, { "database": "PubMed", "id": "17210832", "url": "https://pubmed.ncbi.nlm.nih.gov/17210832" }, { "database": "PubMed", "id": "17220321", "url": "https://pubmed.ncbi.nlm.nih.gov/17220321" }, { "database": "PubMed", "id": "17359956", "url": "https://pubmed.ncbi.nlm.nih.gov/17359956" }, { "database": "PubMed", "id": "17409645", "url": "https://pubmed.ncbi.nlm.nih.gov/17409645" }, { "database": "PubMed", "id": "17482757", "url": "https://pubmed.ncbi.nlm.nih.gov/17482757" }, { "database": "PubMed", "id": "17629407", "url": "https://pubmed.ncbi.nlm.nih.gov/17629407" }, { "database": "PubMed", "id": "17634444", "url": "https://pubmed.ncbi.nlm.nih.gov/17634444" }, { "database": "PubMed", "id": "17761767", "url": "https://pubmed.ncbi.nlm.nih.gov/17761767" }, { "database": "PubMed", "id": "17924178", "url": "https://pubmed.ncbi.nlm.nih.gov/17924178" }, { "database": "PubMed", "id": "17960162", "url": "https://pubmed.ncbi.nlm.nih.gov/17960162" }, { "database": "PubMed", "id": "17967879", "url": "https://pubmed.ncbi.nlm.nih.gov/17967879" }, { "database": "PubMed", "id": "17977562", "url": "https://pubmed.ncbi.nlm.nih.gov/17977562" }, { "database": "PubMed", "id": "17981597", "url": "https://pubmed.ncbi.nlm.nih.gov/17981597" }, { "database": "PubMed", "id": "18034303", "url": "https://pubmed.ncbi.nlm.nih.gov/18034303" }, { "database": "PubMed", "id": "18086904", "url": "https://pubmed.ncbi.nlm.nih.gov/18086904" }, { "database": "PubMed", "id": "18171481", "url": "https://pubmed.ncbi.nlm.nih.gov/18171481" }, { "database": "PubMed", "id": "18177853", "url": "https://pubmed.ncbi.nlm.nih.gov/18177853" }, { "database": "PubMed", "id": "18198353", "url": "https://pubmed.ncbi.nlm.nih.gov/18198353" }, { "database": "PubMed", "id": "18209096", "url": "https://pubmed.ncbi.nlm.nih.gov/18209096" }, { "database": "PubMed", "id": "18241357", "url": "https://pubmed.ncbi.nlm.nih.gov/18241357" }, { "database": "PubMed", "id": "18276828", "url": "https://pubmed.ncbi.nlm.nih.gov/18276828" }, { "database": "PubMed", "id": "18288891", "url": "https://pubmed.ncbi.nlm.nih.gov/18288891" }, { "database": "PubMed", "id": "18332223", "url": "https://pubmed.ncbi.nlm.nih.gov/18332223" }, { "database": "PubMed", "id": "18350159", "url": "https://pubmed.ncbi.nlm.nih.gov/18350159" }, { "database": "PubMed", "id": "18391484", "url": "https://pubmed.ncbi.nlm.nih.gov/18391484" }, { "database": "PubMed", "id": "18405384", "url": "https://pubmed.ncbi.nlm.nih.gov/18405384" }, { "database": "PubMed", "id": "18411306", "url": "https://pubmed.ncbi.nlm.nih.gov/18411306" }, { "database": "PubMed", "id": "18461163", "url": "https://pubmed.ncbi.nlm.nih.gov/18461163" }, { "database": "PubMed", "id": "18523362", "url": "https://pubmed.ncbi.nlm.nih.gov/18523362" }, { "database": "PubMed", "id": "18566543", "url": "https://pubmed.ncbi.nlm.nih.gov/18566543" }, { "database": "PubMed", "id": "18570920", "url": "https://pubmed.ncbi.nlm.nih.gov/18570920" }, { "database": "PubMed", "id": "18714386", "url": "https://pubmed.ncbi.nlm.nih.gov/18714386" }, { "database": "PubMed", "id": "18718531", "url": "https://pubmed.ncbi.nlm.nih.gov/18718531" }, { "database": "PubMed", "id": "18757368", "url": "https://pubmed.ncbi.nlm.nih.gov/18757368" }, { "database": "PubMed", "id": "18952837", "url": "https://pubmed.ncbi.nlm.nih.gov/18952837" }, { "database": "PubMed", "id": "19013131", "url": "https://pubmed.ncbi.nlm.nih.gov/19013131" }, { "database": "PubMed", "id": "19033447", "url": "https://pubmed.ncbi.nlm.nih.gov/19033447" }, { "database": "PubMed", "id": "19066318", "url": "https://pubmed.ncbi.nlm.nih.gov/19066318" }, { "database": "PubMed", "id": "19077278", "url": "https://pubmed.ncbi.nlm.nih.gov/19077278" }, { "database": "PubMed", "id": "19136654", "url": "https://pubmed.ncbi.nlm.nih.gov/19136654" }, { "database": "PubMed", "id": "19246681", "url": "https://pubmed.ncbi.nlm.nih.gov/19246681" }, { "database": "PubMed", "id": "19289601", "url": "https://pubmed.ncbi.nlm.nih.gov/19289601" }, { "database": "PubMed", "id": "19291319", "url": "https://pubmed.ncbi.nlm.nih.gov/19291319" }, { "database": "PubMed", "id": "19365570", "url": "https://pubmed.ncbi.nlm.nih.gov/19365570" }, { "database": "PubMed", "id": "19369943", "url": "https://pubmed.ncbi.nlm.nih.gov/19369943" }, { "database": "PubMed", "id": "19416348", "url": "https://pubmed.ncbi.nlm.nih.gov/19416348" }, { "database": "PubMed", "id": "19432987", "url": "https://pubmed.ncbi.nlm.nih.gov/19432987" }, { "database": "PubMed", "id": "19434632", "url": "https://pubmed.ncbi.nlm.nih.gov/19434632" }, { "database": "PubMed", "id": "19497867", "url": "https://pubmed.ncbi.nlm.nih.gov/19497867" }, { "database": "PubMed", "id": "19502418", "url": "https://pubmed.ncbi.nlm.nih.gov/19502418" }, { "database": "PubMed", "id": "19570880", "url": "https://pubmed.ncbi.nlm.nih.gov/19570880" }, { "database": "PubMed", "id": "19587782", "url": "https://pubmed.ncbi.nlm.nih.gov/19587782" }, { "database": "PubMed", "id": "19627269", "url": "https://pubmed.ncbi.nlm.nih.gov/19627269" }, { "database": "PubMed", "id": "19693287", "url": "https://pubmed.ncbi.nlm.nih.gov/19693287" }, { "database": "PubMed", "id": "19721331", "url": "https://pubmed.ncbi.nlm.nih.gov/19721331" }, { "database": "PubMed", "id": "19731018", "url": "https://pubmed.ncbi.nlm.nih.gov/19731018" }, { "database": "PubMed", "id": "19745829", "url": "https://pubmed.ncbi.nlm.nih.gov/19745829" }, { "database": "PubMed", "id": "19761830", "url": "https://pubmed.ncbi.nlm.nih.gov/19761830" }, { "database": "PubMed", "id": "19844585", "url": "https://pubmed.ncbi.nlm.nih.gov/19844585" }, { "database": "PubMed", "id": "19847197", "url": "https://pubmed.ncbi.nlm.nih.gov/19847197" }, { "database": "PubMed", "id": "19879746", "url": "https://pubmed.ncbi.nlm.nih.gov/19879746" }, { "database": "PubMed", "id": "20022531", "url": "https://pubmed.ncbi.nlm.nih.gov/20022531" }, { "database": "PubMed", "id": "20028942", "url": "https://pubmed.ncbi.nlm.nih.gov/20028942" }, { "database": "PubMed", "id": "20053680", "url": "https://pubmed.ncbi.nlm.nih.gov/20053680" }, { "database": "PubMed", "id": "20103705", "url": "https://pubmed.ncbi.nlm.nih.gov/20103705" }, { "database": "PubMed", "id": "20154728", "url": "https://pubmed.ncbi.nlm.nih.gov/20154728" }, { "database": "PubMed", "id": "20174568", "url": "https://pubmed.ncbi.nlm.nih.gov/20174568" }, { "database": "PubMed", "id": "20174572", "url": "https://pubmed.ncbi.nlm.nih.gov/20174572" }, { "database": "PubMed", "id": "20177806", "url": "https://pubmed.ncbi.nlm.nih.gov/20177806" }, { "database": "PubMed", "id": "20179101", "url": "https://pubmed.ncbi.nlm.nih.gov/20179101" }, { "database": "PubMed", "id": "20179753", "url": "https://pubmed.ncbi.nlm.nih.gov/20179753" }, { "database": "PubMed", "id": "20332342", "url": "https://pubmed.ncbi.nlm.nih.gov/20332342" }, { "database": "PubMed", "id": "20333297", "url": "https://pubmed.ncbi.nlm.nih.gov/20333297" }, { "database": "PubMed", "id": "20338882", "url": "https://pubmed.ncbi.nlm.nih.gov/20338882" }, { "database": "PubMed", "id": "20362052", "url": "https://pubmed.ncbi.nlm.nih.gov/20362052" }, { "database": "PubMed", "id": "20363892", "url": "https://pubmed.ncbi.nlm.nih.gov/20363892" }, { "database": "PubMed", "id": "20501873", "url": "https://pubmed.ncbi.nlm.nih.gov/20501873" }, { "database": "PubMed", "id": "20520761", "url": "https://pubmed.ncbi.nlm.nih.gov/20520761" }, { "database": "PubMed", "id": "20543991", "url": "https://pubmed.ncbi.nlm.nih.gov/20543991" }, { "database": "PubMed", "id": "20554973", "url": "https://pubmed.ncbi.nlm.nih.gov/20554973" }, { "database": "PubMed", "id": "20576936", "url": "https://pubmed.ncbi.nlm.nih.gov/20576936" }, { "database": "PubMed", "id": "20586915", "url": "https://pubmed.ncbi.nlm.nih.gov/20586915" }, { "database": "PubMed", "id": "20587420", "url": "https://pubmed.ncbi.nlm.nih.gov/20587420" }, { "database": "PubMed", "id": "20622167", "url": "https://pubmed.ncbi.nlm.nih.gov/20622167" }, { "database": "PubMed", "id": "20624888", "url": "https://pubmed.ncbi.nlm.nih.gov/20624888" }, { "database": "PubMed", "id": "20705918", "url": "https://pubmed.ncbi.nlm.nih.gov/20705918" }, { "database": "PubMed", "id": "20719961", "url": "https://pubmed.ncbi.nlm.nih.gov/20719961" }, { "database": "PubMed", "id": "20806112", "url": "https://pubmed.ncbi.nlm.nih.gov/20806112" }, { "database": "PubMed", "id": "20811625", "url": "https://pubmed.ncbi.nlm.nih.gov/20811625" }, { "database": "PubMed", "id": "20813836", "url": "https://pubmed.ncbi.nlm.nih.gov/20813836" }, { "database": "PubMed", "id": "20837912", "url": "https://pubmed.ncbi.nlm.nih.gov/20837912" }, { "database": "PubMed", "id": "20847051", "url": "https://pubmed.ncbi.nlm.nih.gov/20847051" }, { "database": "PubMed", "id": "20856813", "url": "https://pubmed.ncbi.nlm.nih.gov/20856813" }, { "database": "PubMed", "id": "20936097", "url": "https://pubmed.ncbi.nlm.nih.gov/20936097" }, { "database": "PubMed", "id": "20976192", "url": "https://pubmed.ncbi.nlm.nih.gov/20976192" }, { "database": "PubMed", "id": "21029370", "url": "https://pubmed.ncbi.nlm.nih.gov/21029370" }, { "database": "PubMed", "id": "21106850", "url": "https://pubmed.ncbi.nlm.nih.gov/21106850" }, { "database": "PubMed", "id": "21266327", "url": "https://pubmed.ncbi.nlm.nih.gov/21266327" }, { "database": "PubMed", "id": "21279323", "url": "https://pubmed.ncbi.nlm.nih.gov/21279323" }, { "database": "PubMed", "id": "21283589", "url": "https://pubmed.ncbi.nlm.nih.gov/21283589" }, { "database": "PubMed", "id": "21407213", "url": "https://pubmed.ncbi.nlm.nih.gov/21407213" }, { "database": "PubMed", "id": "21408125", "url": "https://pubmed.ncbi.nlm.nih.gov/21408125" }, { "database": "PubMed", "id": "21423211", "url": "https://pubmed.ncbi.nlm.nih.gov/21423211" }, { "database": "PubMed", "id": "21479224", "url": "https://pubmed.ncbi.nlm.nih.gov/21479224" }, { "database": "PubMed", "id": "21511697", "url": "https://pubmed.ncbi.nlm.nih.gov/21511697" }, { "database": "PubMed", "id": "21600784", "url": "https://pubmed.ncbi.nlm.nih.gov/21600784" }, { "database": "PubMed", "id": "21617181", "url": "https://pubmed.ncbi.nlm.nih.gov/21617181" }, { "database": "PubMed", "id": "21637761", "url": "https://pubmed.ncbi.nlm.nih.gov/21637761" }, { "database": "PubMed", "id": "21655268", "url": "https://pubmed.ncbi.nlm.nih.gov/21655268" }, { "database": "PubMed", "id": "21670491", "url": "https://pubmed.ncbi.nlm.nih.gov/21670491" }, { "database": "PubMed", "id": "21847101", "url": "https://pubmed.ncbi.nlm.nih.gov/21847101" }, { "database": "PubMed", "id": "21850156", "url": "https://pubmed.ncbi.nlm.nih.gov/21850156" }, { "database": "PubMed", "id": "21927580", "url": "https://pubmed.ncbi.nlm.nih.gov/21927580" }, { "database": "PubMed", "id": "21993375", "url": "https://pubmed.ncbi.nlm.nih.gov/21993375" }, { "database": "PubMed", "id": "22019461", "url": "https://pubmed.ncbi.nlm.nih.gov/22019461" }, { "database": "PubMed", "id": "22028912", "url": "https://pubmed.ncbi.nlm.nih.gov/22028912" }, { "database": "PubMed", "id": "22057724", "url": "https://pubmed.ncbi.nlm.nih.gov/22057724" }, { "database": "PubMed", "id": "22095470", "url": "https://pubmed.ncbi.nlm.nih.gov/22095470" }, { "database": "PubMed", "id": "22117619", "url": "https://pubmed.ncbi.nlm.nih.gov/22117619" }, { "database": "PubMed", "id": "22132131", "url": "https://pubmed.ncbi.nlm.nih.gov/22132131" }, { "database": "PubMed", "id": "22184110", "url": "https://pubmed.ncbi.nlm.nih.gov/22184110" }, { "database": "PubMed", "id": "22187375", "url": "https://pubmed.ncbi.nlm.nih.gov/22187375" }, { "database": "PubMed", "id": "22188815", "url": "https://pubmed.ncbi.nlm.nih.gov/22188815" }, { "database": "PubMed", "id": "22195016", "url": "https://pubmed.ncbi.nlm.nih.gov/22195016" }, { "database": "PubMed", "id": "22203870", "url": "https://pubmed.ncbi.nlm.nih.gov/22203870" }, { "database": "PubMed", "id": "22218715", "url": "https://pubmed.ncbi.nlm.nih.gov/22218715" }, { "database": "PubMed", "id": "22238573", "url": "https://pubmed.ncbi.nlm.nih.gov/22238573" }, { "database": "PubMed", "id": "22249311", "url": "https://pubmed.ncbi.nlm.nih.gov/22249311" }, { "database": "PubMed", "id": "22253608", "url": "https://pubmed.ncbi.nlm.nih.gov/22253608" }, { "database": "PubMed", "id": "22344295", "url": "https://pubmed.ncbi.nlm.nih.gov/22344295" }, { "database": "PubMed", "id": "22363451", "url": "https://pubmed.ncbi.nlm.nih.gov/22363451" }, { "database": "PubMed", "id": "22382990", "url": "https://pubmed.ncbi.nlm.nih.gov/22382990" }, { "database": "PubMed", "id": "22412835", "url": "https://pubmed.ncbi.nlm.nih.gov/22412835" }, { "database": "PubMed", "id": "22412882", "url": "https://pubmed.ncbi.nlm.nih.gov/22412882" }, { "database": "PubMed", "id": "22469977", "url": "https://pubmed.ncbi.nlm.nih.gov/22469977" }, { "database": "PubMed", "id": "22471389", "url": "https://pubmed.ncbi.nlm.nih.gov/22471389" }, { "database": "PubMed", "id": "22496778", "url": "https://pubmed.ncbi.nlm.nih.gov/22496778" }, { "database": "PubMed", "id": "22516386", "url": "https://pubmed.ncbi.nlm.nih.gov/22516386" }, { "database": "PubMed", "id": "22521878", "url": "https://pubmed.ncbi.nlm.nih.gov/22521878" }, { "database": "PubMed", "id": "22532369", "url": "https://pubmed.ncbi.nlm.nih.gov/22532369" }, { "database": "PubMed", "id": "22559167", "url": "https://pubmed.ncbi.nlm.nih.gov/22559167" }, { "database": "PubMed", "id": "22563011", "url": "https://pubmed.ncbi.nlm.nih.gov/22563011" }, { "database": "PubMed", "id": "22563417", "url": "https://pubmed.ncbi.nlm.nih.gov/22563417" }, { "database": "PubMed", "id": "22581458", "url": "https://pubmed.ncbi.nlm.nih.gov/22581458" }, { "database": "PubMed", "id": "22586587", "url": "https://pubmed.ncbi.nlm.nih.gov/22586587" }, { "database": "PubMed", "id": "22590527", "url": "https://pubmed.ncbi.nlm.nih.gov/22590527" }, { "database": "PubMed", "id": "22606274", "url": "https://pubmed.ncbi.nlm.nih.gov/22606274" }, { "database": "PubMed", "id": "22622501", "url": "https://pubmed.ncbi.nlm.nih.gov/22622501" }, { "database": "PubMed", "id": "22652602", "url": "https://pubmed.ncbi.nlm.nih.gov/22652602" }, { "database": "PubMed", "id": "22681587", "url": "https://pubmed.ncbi.nlm.nih.gov/22681587" }, { "database": "PubMed", "id": "22693641", "url": "https://pubmed.ncbi.nlm.nih.gov/22693641" }, { "database": "PubMed", "id": "22733590", "url": "https://pubmed.ncbi.nlm.nih.gov/22733590" }, { "database": "PubMed", "id": "22734004", "url": "https://pubmed.ncbi.nlm.nih.gov/22734004" }, { "database": "PubMed", "id": "22768110", "url": "https://pubmed.ncbi.nlm.nih.gov/22768110" }, { "database": "PubMed", "id": "22773877", "url": "https://pubmed.ncbi.nlm.nih.gov/22773877" }, { "database": "PubMed", "id": "22792172", "url": "https://pubmed.ncbi.nlm.nih.gov/22792172" }, { "database": "PubMed", "id": "22832498", "url": "https://pubmed.ncbi.nlm.nih.gov/22832498" }, { "database": "PubMed", "id": "22850125", "url": "https://pubmed.ncbi.nlm.nih.gov/22850125" }, { "database": "PubMed", "id": "22859500", "url": "https://pubmed.ncbi.nlm.nih.gov/22859500" }, { "database": "PubMed", "id": "22869525", "url": "https://pubmed.ncbi.nlm.nih.gov/22869525" }, { "database": "PubMed", "id": "22900024", "url": "https://pubmed.ncbi.nlm.nih.gov/22900024" }, { "database": "PubMed", "id": "22910893", "url": "https://pubmed.ncbi.nlm.nih.gov/22910893" }, { "database": "PubMed", "id": "22933110", "url": "https://pubmed.ncbi.nlm.nih.gov/22933110" }, { "database": "PubMed", "id": "22934083", "url": "https://pubmed.ncbi.nlm.nih.gov/22934083" }, { "database": "PubMed", "id": "22936801", "url": "https://pubmed.ncbi.nlm.nih.gov/22936801" }, { "database": "PubMed", "id": "22941977", "url": "https://pubmed.ncbi.nlm.nih.gov/22941977" }, { "database": "PubMed", "id": "22952890", "url": "https://pubmed.ncbi.nlm.nih.gov/22952890" }, { "database": "PubMed", "id": "23029230", "url": "https://pubmed.ncbi.nlm.nih.gov/23029230" }, { "database": "PubMed", "id": "23049865", "url": "https://pubmed.ncbi.nlm.nih.gov/23049865" }, { "database": "PubMed", "id": "23071621", "url": "https://pubmed.ncbi.nlm.nih.gov/23071621" }, { "database": "PubMed", "id": "23082110", "url": "https://pubmed.ncbi.nlm.nih.gov/23082110" }, { "database": "PubMed", "id": "23100026", "url": "https://pubmed.ncbi.nlm.nih.gov/23100026" }, { "database": "PubMed", "id": "23133640", "url": "https://pubmed.ncbi.nlm.nih.gov/23133640" }, { "database": "PubMed", "id": "23188702", "url": "https://pubmed.ncbi.nlm.nih.gov/23188702" }, { "database": "PubMed", "id": "23227273", "url": "https://pubmed.ncbi.nlm.nih.gov/23227273" }, { "database": "PubMed", "id": "23236519", "url": "https://pubmed.ncbi.nlm.nih.gov/23236519" }, { "database": "PubMed", "id": "23239877", "url": "https://pubmed.ncbi.nlm.nih.gov/23239877" }, { "database": "PubMed", "id": "23251389", "url": "https://pubmed.ncbi.nlm.nih.gov/23251389" }, { "database": "PubMed", "id": "23251519", "url": "https://pubmed.ncbi.nlm.nih.gov/23251519" }, { "database": "PubMed", "id": "23300339", "url": "https://pubmed.ncbi.nlm.nih.gov/23300339" }, { "database": "PubMed", "id": "23311350", "url": "https://pubmed.ncbi.nlm.nih.gov/23311350" }, { "database": "PubMed", "id": "23369342", "url": "https://pubmed.ncbi.nlm.nih.gov/23369342" }, { "database": "PubMed", "id": "23382716", "url": "https://pubmed.ncbi.nlm.nih.gov/23382716" }, { "database": "PubMed", "id": "23386984", "url": "https://pubmed.ncbi.nlm.nih.gov/23386984" }, { "database": "PubMed", "id": "23390495", "url": "https://pubmed.ncbi.nlm.nih.gov/23390495" }, { "database": "PubMed", "id": "23393595", "url": "https://pubmed.ncbi.nlm.nih.gov/23393595" }, { "database": "PubMed", "id": "23409704", "url": "https://pubmed.ncbi.nlm.nih.gov/23409704" }, { "database": "PubMed", "id": "23443503", "url": "https://pubmed.ncbi.nlm.nih.gov/23443503" }, { "database": "PubMed", "id": "23444402", "url": "https://pubmed.ncbi.nlm.nih.gov/23444402" }, { "database": "PubMed", "id": "23451056", "url": "https://pubmed.ncbi.nlm.nih.gov/23451056" }, { "database": "PubMed", "id": "23469174", "url": "https://pubmed.ncbi.nlm.nih.gov/23469174" }, { "database": "PubMed", "id": "23469261", "url": "https://pubmed.ncbi.nlm.nih.gov/23469261" }, { "database": "PubMed", "id": "23478138", "url": "https://pubmed.ncbi.nlm.nih.gov/23478138" }, { "database": "PubMed", "id": "23489026", "url": "https://pubmed.ncbi.nlm.nih.gov/23489026" }, { "database": "PubMed", "id": "23493568", "url": "https://pubmed.ncbi.nlm.nih.gov/23493568" }, { "database": "PubMed", "id": "23504323", "url": "https://pubmed.ncbi.nlm.nih.gov/23504323" }, { "database": "PubMed", "id": "23519033", "url": "https://pubmed.ncbi.nlm.nih.gov/23519033" }, { "database": "PubMed", "id": "23520131", "url": "https://pubmed.ncbi.nlm.nih.gov/23520131" }, { "database": "PubMed", "id": "23554947", "url": "https://pubmed.ncbi.nlm.nih.gov/23554947" }, { "database": "PubMed", "id": "23584725", "url": "https://pubmed.ncbi.nlm.nih.gov/23584725" }, { "database": "PubMed", "id": "23593332", "url": "https://pubmed.ncbi.nlm.nih.gov/23593332" }, { "database": "PubMed", "id": "23596176", "url": "https://pubmed.ncbi.nlm.nih.gov/23596176" }, { "database": "PubMed", "id": "23598407", "url": "https://pubmed.ncbi.nlm.nih.gov/23598407" }, { "database": "PubMed", "id": "23649820", "url": "https://pubmed.ncbi.nlm.nih.gov/23649820" }, { "database": "PubMed", "id": "23671593", "url": "https://pubmed.ncbi.nlm.nih.gov/23671593" }, { "database": "PubMed", "id": "23702782", "url": "https://pubmed.ncbi.nlm.nih.gov/23702782" }, { "database": "PubMed", "id": "23713790", "url": "https://pubmed.ncbi.nlm.nih.gov/23713790" }, { "database": "PubMed", "id": "23716717", "url": "https://pubmed.ncbi.nlm.nih.gov/23716717" }, { "database": "PubMed", "id": "23734002", "url": "https://pubmed.ncbi.nlm.nih.gov/23734002" }, { "database": "PubMed", "id": "23748360", "url": "https://pubmed.ncbi.nlm.nih.gov/23748360" }, { "database": "PubMed", "id": "23805205", "url": "https://pubmed.ncbi.nlm.nih.gov/23805205" }, { "database": "PubMed", "id": "23818862", "url": "https://pubmed.ncbi.nlm.nih.gov/23818862" }, { "database": "PubMed", "id": "23826249", "url": "https://pubmed.ncbi.nlm.nih.gov/23826249" }, { "database": "PubMed", "id": "23868942", "url": "https://pubmed.ncbi.nlm.nih.gov/23868942" }, { "database": "PubMed", "id": "23874604", "url": "https://pubmed.ncbi.nlm.nih.gov/23874604" }, { "database": "PubMed", "id": "23907468", "url": "https://pubmed.ncbi.nlm.nih.gov/23907468" }, { "database": "PubMed", "id": "23935891", "url": "https://pubmed.ncbi.nlm.nih.gov/23935891" }, { "database": "PubMed", "id": "23964069", "url": "https://pubmed.ncbi.nlm.nih.gov/23964069" }, { "database": "PubMed", "id": "23965299", "url": "https://pubmed.ncbi.nlm.nih.gov/23965299" }, { "database": "PubMed", "id": "24008733", "url": "https://pubmed.ncbi.nlm.nih.gov/24008733" }, { "database": "PubMed", "id": "24052072", "url": "https://pubmed.ncbi.nlm.nih.gov/24052072" }, { "database": "PubMed", "id": "24052499", "url": "https://pubmed.ncbi.nlm.nih.gov/24052499" }, { "database": "PubMed", "id": "24067903", "url": "https://pubmed.ncbi.nlm.nih.gov/24067903" }, { "database": "PubMed", "id": "24068327", "url": "https://pubmed.ncbi.nlm.nih.gov/24068327" }, { "database": "PubMed", "id": "24068707", "url": "https://pubmed.ncbi.nlm.nih.gov/24068707" }, { "database": "PubMed", "id": "24090638", "url": "https://pubmed.ncbi.nlm.nih.gov/24090638" }, { "database": "PubMed", "id": "24101676", "url": "https://pubmed.ncbi.nlm.nih.gov/24101676" }, { "database": "PubMed", "id": "24116102", "url": "https://pubmed.ncbi.nlm.nih.gov/24116102" }, { "database": "PubMed", "id": "24142192", "url": "https://pubmed.ncbi.nlm.nih.gov/24142192" }, { "database": "PubMed", "id": "24149114", "url": "https://pubmed.ncbi.nlm.nih.gov/24149114" }, { "database": "PubMed", "id": "24150605", "url": "https://pubmed.ncbi.nlm.nih.gov/24150605" }, { "database": "PubMed", "id": "24156551", "url": "https://pubmed.ncbi.nlm.nih.gov/24156551" }, { "database": "PubMed", "id": "24223757", "url": "https://pubmed.ncbi.nlm.nih.gov/24223757" }, { "database": "PubMed", "id": "24260338", "url": "https://pubmed.ncbi.nlm.nih.gov/24260338" }, { "database": "PubMed", "id": "24280377", "url": "https://pubmed.ncbi.nlm.nih.gov/24280377" }, { "database": "PubMed", "id": "24280772", "url": "https://pubmed.ncbi.nlm.nih.gov/24280772" }, { "database": "PubMed", "id": "24286194", "url": "https://pubmed.ncbi.nlm.nih.gov/24286194" }, { "database": "PubMed", "id": "24296537", "url": "https://pubmed.ncbi.nlm.nih.gov/24296537" }, { "database": "PubMed", "id": "24334165", "url": "https://pubmed.ncbi.nlm.nih.gov/24334165" }, { "database": "PubMed", "id": "24340073", "url": "https://pubmed.ncbi.nlm.nih.gov/24340073" }, { "database": "PubMed", "id": "24347831", "url": "https://pubmed.ncbi.nlm.nih.gov/24347831" }, { "database": "PubMed", "id": "24349514", "url": "https://pubmed.ncbi.nlm.nih.gov/24349514" }, { "database": "PubMed", "id": "24351823", "url": "https://pubmed.ncbi.nlm.nih.gov/24351823" }, { "database": "PubMed", "id": "24367658", "url": "https://pubmed.ncbi.nlm.nih.gov/24367658" }, { "database": "PubMed", "id": "24387036", "url": "https://pubmed.ncbi.nlm.nih.gov/24387036" }, { "database": "PubMed", "id": "24412630", "url": "https://pubmed.ncbi.nlm.nih.gov/24412630" }, { "database": "PubMed", "id": "24427143", "url": "https://pubmed.ncbi.nlm.nih.gov/24427143" }, { "database": "PubMed", "id": "24434432", "url": "https://pubmed.ncbi.nlm.nih.gov/24434432" }, { "database": "PubMed", "id": "24435134", "url": "https://pubmed.ncbi.nlm.nih.gov/24435134" }, { "database": "PubMed", "id": "24505362", "url": "https://pubmed.ncbi.nlm.nih.gov/24505362" }, { "database": "PubMed", "id": "24516630", "url": "https://pubmed.ncbi.nlm.nih.gov/24516630" }, { "database": "PubMed", "id": "24551245", "url": "https://pubmed.ncbi.nlm.nih.gov/24551245" }, { "database": "PubMed", "id": "24557881", "url": "https://pubmed.ncbi.nlm.nih.gov/24557881" }, { "database": "PubMed", "id": "24621388", "url": "https://pubmed.ncbi.nlm.nih.gov/24621388" }, { "database": "PubMed", "id": "24629015", "url": "https://pubmed.ncbi.nlm.nih.gov/24629015" }, { "database": "PubMed", "id": "24632620", "url": "https://pubmed.ncbi.nlm.nih.gov/24632620" }, { "database": "PubMed", "id": "24647338", "url": "https://pubmed.ncbi.nlm.nih.gov/24647338" }, { "database": "PubMed", "id": "24649407", "url": "https://pubmed.ncbi.nlm.nih.gov/24649407" }, { "database": "PubMed", "id": "24662050", "url": "https://pubmed.ncbi.nlm.nih.gov/24662050" }, { "database": "PubMed", "id": "24670654", "url": "https://pubmed.ncbi.nlm.nih.gov/24670654" }, { "database": "PubMed", "id": "24675832", "url": "https://pubmed.ncbi.nlm.nih.gov/24675832" }, { "database": "PubMed", "id": "24708830", "url": "https://pubmed.ncbi.nlm.nih.gov/24708830" }, { "database": "PubMed", "id": "24722238", "url": "https://pubmed.ncbi.nlm.nih.gov/24722238" }, { "database": "PubMed", "id": "24734904", "url": "https://pubmed.ncbi.nlm.nih.gov/24734904" }, { "database": "PubMed", "id": "24740015", "url": "https://pubmed.ncbi.nlm.nih.gov/24740015" }, { "database": "PubMed", "id": "24742286", "url": "https://pubmed.ncbi.nlm.nih.gov/24742286" }, { "database": "PubMed", "id": "24746698", "url": "https://pubmed.ncbi.nlm.nih.gov/24746698" }, { "database": "PubMed", "id": "24757676", "url": "https://pubmed.ncbi.nlm.nih.gov/24757676" }, { "database": "PubMed", "id": "24760979", "url": "https://pubmed.ncbi.nlm.nih.gov/24760979" }, { "database": "PubMed", "id": "24763529", "url": "https://pubmed.ncbi.nlm.nih.gov/24763529" }, { "database": "PubMed", "id": "24769205", "url": "https://pubmed.ncbi.nlm.nih.gov/24769205" }, { "database": "PubMed", "id": "24809512", "url": "https://pubmed.ncbi.nlm.nih.gov/24809512" }, { "database": "PubMed", "id": "24810050", "url": "https://pubmed.ncbi.nlm.nih.gov/24810050" }, { "database": "PubMed", "id": "24832603", "url": "https://pubmed.ncbi.nlm.nih.gov/24832603" }, { "database": "PubMed", "id": "24944899", "url": "https://pubmed.ncbi.nlm.nih.gov/24944899" }, { "database": "PubMed", "id": "24945834", "url": "https://pubmed.ncbi.nlm.nih.gov/24945834" }, { "database": "PubMed", "id": "24945938", "url": "https://pubmed.ncbi.nlm.nih.gov/24945938" }, { "database": "PubMed", "id": "24967341", "url": "https://pubmed.ncbi.nlm.nih.gov/24967341" }, { "database": "PubMed", "id": "24985103", "url": "https://pubmed.ncbi.nlm.nih.gov/24985103" }, { "database": "PubMed", "id": "24987368", "url": "https://pubmed.ncbi.nlm.nih.gov/24987368" }, { "database": "PubMed", "id": "25004182", "url": "https://pubmed.ncbi.nlm.nih.gov/25004182" }, { "database": "PubMed", "id": "25004403", "url": "https://pubmed.ncbi.nlm.nih.gov/25004403" }, { "database": "PubMed", "id": "25013446", "url": "https://pubmed.ncbi.nlm.nih.gov/25013446" }, { "database": "PubMed", "id": "25092872", "url": "https://pubmed.ncbi.nlm.nih.gov/25092872" }, { "database": "PubMed", "id": "25132272", "url": "https://pubmed.ncbi.nlm.nih.gov/25132272" }, { "database": "PubMed", "id": "25136373", "url": "https://pubmed.ncbi.nlm.nih.gov/25136373" }, { "database": "PubMed", "id": "25141786", "url": "https://pubmed.ncbi.nlm.nih.gov/25141786" }, { "database": "PubMed", "id": "25162417", "url": "https://pubmed.ncbi.nlm.nih.gov/25162417" }, { "database": "PubMed", "id": "25168244", "url": "https://pubmed.ncbi.nlm.nih.gov/25168244" }, { "database": "PubMed", "id": "25201756", "url": "https://pubmed.ncbi.nlm.nih.gov/25201756" }, { "database": "PubMed", "id": "25214523", "url": "https://pubmed.ncbi.nlm.nih.gov/25214523" }, { "database": "PubMed", "id": "25221930", "url": "https://pubmed.ncbi.nlm.nih.gov/25221930" }, { "database": "PubMed", "id": "25240598", "url": "https://pubmed.ncbi.nlm.nih.gov/25240598" }, { "database": "PubMed", "id": "25258031", "url": "https://pubmed.ncbi.nlm.nih.gov/25258031" }, { "database": "PubMed", "id": "25264192", "url": "https://pubmed.ncbi.nlm.nih.gov/25264192" }, { "database": "PubMed", "id": "25279552", "url": "https://pubmed.ncbi.nlm.nih.gov/25279552" }, { "database": "PubMed", "id": "25280966", "url": "https://pubmed.ncbi.nlm.nih.gov/25280966" }, { "database": "PubMed", "id": "25332884", "url": "https://pubmed.ncbi.nlm.nih.gov/25332884" }, { "database": "PubMed", "id": "25336920", "url": "https://pubmed.ncbi.nlm.nih.gov/25336920" }, { "database": "PubMed", "id": "25347392", "url": "https://pubmed.ncbi.nlm.nih.gov/25347392" }, { "database": "PubMed", "id": "25355398", "url": "https://pubmed.ncbi.nlm.nih.gov/25355398" }, { "database": "PubMed", "id": "25377878", "url": "https://pubmed.ncbi.nlm.nih.gov/25377878" }, { "database": "PubMed", "id": "25379771", "url": "https://pubmed.ncbi.nlm.nih.gov/25379771" }, { "database": "PubMed", "id": "25398386", "url": "https://pubmed.ncbi.nlm.nih.gov/25398386" }, { "database": "PubMed", "id": "25415296", "url": "https://pubmed.ncbi.nlm.nih.gov/25415296" }, { "database": "PubMed", "id": "25416469", "url": "https://pubmed.ncbi.nlm.nih.gov/25416469" }, { "database": "PubMed", "id": "25460003", "url": "https://pubmed.ncbi.nlm.nih.gov/25460003" }, { "database": "PubMed", "id": "25460735", "url": "https://pubmed.ncbi.nlm.nih.gov/25460735" }, { "database": "PubMed", "id": "25466188", "url": "https://pubmed.ncbi.nlm.nih.gov/25466188" }, { "database": "PubMed", "id": "25531328", "url": "https://pubmed.ncbi.nlm.nih.gov/25531328" }, { "database": "PubMed", "id": "25546475", "url": "https://pubmed.ncbi.nlm.nih.gov/25546475" }, { "database": "PubMed", "id": "25564616", "url": "https://pubmed.ncbi.nlm.nih.gov/25564616" }, { "database": "PubMed", "id": "25568666", "url": "https://pubmed.ncbi.nlm.nih.gov/25568666" }, { "database": "PubMed", "id": "25594415", "url": "https://pubmed.ncbi.nlm.nih.gov/25594415" }, { "database": "PubMed", "id": "25635326", "url": "https://pubmed.ncbi.nlm.nih.gov/25635326" }, { "database": "PubMed", "id": "25646773", "url": "https://pubmed.ncbi.nlm.nih.gov/25646773" }, { "database": "PubMed", "id": "25672620", "url": "https://pubmed.ncbi.nlm.nih.gov/25672620" }, { "database": "PubMed", "id": "25714556", "url": "https://pubmed.ncbi.nlm.nih.gov/25714556" }, { "database": "PubMed", "id": "25752217", "url": "https://pubmed.ncbi.nlm.nih.gov/25752217" }, { "database": "PubMed", "id": "25754411", "url": "https://pubmed.ncbi.nlm.nih.gov/25754411" }, { "database": "PubMed", "id": "25775433", "url": "https://pubmed.ncbi.nlm.nih.gov/25775433" }, { "database": "PubMed", "id": "25790465", "url": "https://pubmed.ncbi.nlm.nih.gov/25790465" }, { "database": "PubMed", "id": "25799367", "url": "https://pubmed.ncbi.nlm.nih.gov/25799367" }, { "database": "PubMed", "id": "25808491", "url": "https://pubmed.ncbi.nlm.nih.gov/25808491" }, { "database": "PubMed", "id": "25826740", "url": "https://pubmed.ncbi.nlm.nih.gov/25826740" }, { "database": "PubMed", "id": "25839650", "url": "https://pubmed.ncbi.nlm.nih.gov/25839650" }, { "database": "PubMed", "id": "25853295", "url": "https://pubmed.ncbi.nlm.nih.gov/25853295" }, { "database": "PubMed", "id": "25880554", "url": "https://pubmed.ncbi.nlm.nih.gov/25880554" }, { "database": "PubMed", "id": "25888638", "url": "https://pubmed.ncbi.nlm.nih.gov/25888638" }, { "database": "PubMed", "id": "25889002", "url": "https://pubmed.ncbi.nlm.nih.gov/25889002" }, { "database": "PubMed", "id": "25902782", "url": "https://pubmed.ncbi.nlm.nih.gov/25902782" }, { "database": "PubMed", "id": "25960827", "url": "https://pubmed.ncbi.nlm.nih.gov/25960827" }, { "database": "PubMed", "id": "25965336", "url": "https://pubmed.ncbi.nlm.nih.gov/25965336" }, { "database": "PubMed", "id": "25965947", "url": "https://pubmed.ncbi.nlm.nih.gov/25965947" }, { "database": "PubMed", "id": "25968579", "url": "https://pubmed.ncbi.nlm.nih.gov/25968579" }, { "database": "PubMed", "id": "25991723", "url": "https://pubmed.ncbi.nlm.nih.gov/25991723" }, { "database": "PubMed", "id": "26000908", "url": "https://pubmed.ncbi.nlm.nih.gov/26000908" }, { "database": "PubMed", "id": "26023930", "url": "https://pubmed.ncbi.nlm.nih.gov/26023930" }, { "database": "PubMed", "id": "26026051", "url": "https://pubmed.ncbi.nlm.nih.gov/26026051" }, { "database": "PubMed", "id": "26070664", "url": "https://pubmed.ncbi.nlm.nih.gov/26070664" }, { "database": "PubMed", "id": "26100075", "url": "https://pubmed.ncbi.nlm.nih.gov/26100075" }, { "database": "PubMed", "id": "26118757", "url": "https://pubmed.ncbi.nlm.nih.gov/26118757" }, { "database": "PubMed", "id": "26121028", "url": "https://pubmed.ncbi.nlm.nih.gov/26121028" }, { "database": "PubMed", "id": "26132202", "url": "https://pubmed.ncbi.nlm.nih.gov/26132202" }, { "database": "PubMed", "id": "26135741", "url": "https://pubmed.ncbi.nlm.nih.gov/26135741" }, { "database": "PubMed", "id": "26249804", "url": "https://pubmed.ncbi.nlm.nih.gov/26249804" }, { "database": "PubMed", "id": "26254337", "url": "https://pubmed.ncbi.nlm.nih.gov/26254337" }, { "database": "PubMed", "id": "26263164", "url": "https://pubmed.ncbi.nlm.nih.gov/26263164" }, { "database": "PubMed", "id": "26278110", "url": "https://pubmed.ncbi.nlm.nih.gov/26278110" }, { "database": "PubMed", "id": "26287667", "url": "https://pubmed.ncbi.nlm.nih.gov/26287667" }, { "database": "PubMed", "id": "26299806", "url": "https://pubmed.ncbi.nlm.nih.gov/26299806" }, { "database": "PubMed", "id": "26325184", "url": "https://pubmed.ncbi.nlm.nih.gov/26325184" }, { "database": "PubMed", "id": "26340932", "url": "https://pubmed.ncbi.nlm.nih.gov/26340932" }, { "database": "PubMed", "id": "26383267", "url": "https://pubmed.ncbi.nlm.nih.gov/26383267" }, { "database": "PubMed", "id": "26407610", "url": "https://pubmed.ncbi.nlm.nih.gov/26407610" }, { "database": "PubMed", "id": "26412745", "url": "https://pubmed.ncbi.nlm.nih.gov/26412745" }, { "database": "PubMed", "id": "26454089", "url": "https://pubmed.ncbi.nlm.nih.gov/26454089" }, { "database": "PubMed", "id": "26459601", "url": "https://pubmed.ncbi.nlm.nih.gov/26459601" }, { "database": "PubMed", "id": "26512452", "url": "https://pubmed.ncbi.nlm.nih.gov/26512452" }, { "database": "PubMed", "id": "26523428", "url": "https://pubmed.ncbi.nlm.nih.gov/26523428" }, { "database": "PubMed", "id": "26539824", "url": "https://pubmed.ncbi.nlm.nih.gov/26539824" }, { "database": "PubMed", "id": "26553931", "url": "https://pubmed.ncbi.nlm.nih.gov/26553931" }, { "database": "PubMed", "id": "26597054", "url": "https://pubmed.ncbi.nlm.nih.gov/26597054" }, { "database": "PubMed", "id": "26720454", "url": "https://pubmed.ncbi.nlm.nih.gov/26720454" }, { "database": "PubMed", "id": "26723251", "url": "https://pubmed.ncbi.nlm.nih.gov/26723251" }, { "database": "PubMed", "id": "26728896", "url": "https://pubmed.ncbi.nlm.nih.gov/26728896" }, { "database": "PubMed", "id": "26743335", "url": "https://pubmed.ncbi.nlm.nih.gov/26743335" }, { "database": "PubMed", "id": "26801880", "url": "https://pubmed.ncbi.nlm.nih.gov/26801880" }, { "database": "PubMed", "id": "26809587", "url": "https://pubmed.ncbi.nlm.nih.gov/26809587" }, { "database": "PubMed", "id": "26822343", "url": "https://pubmed.ncbi.nlm.nih.gov/26822343" }, { "database": "PubMed", "id": "26830849", "url": "https://pubmed.ncbi.nlm.nih.gov/26830849" }, { "database": "PubMed", "id": "26836389", "url": "https://pubmed.ncbi.nlm.nih.gov/26836389" }, { "database": "PubMed", "id": "26844697", "url": "https://pubmed.ncbi.nlm.nih.gov/26844697" }, { "database": "PubMed", "id": "26876212", "url": "https://pubmed.ncbi.nlm.nih.gov/26876212" }, { "database": "PubMed", "id": "26880110", "url": "https://pubmed.ncbi.nlm.nih.gov/26880110" }, { "database": "PubMed", "id": "26907332", "url": "https://pubmed.ncbi.nlm.nih.gov/26907332" }, { "database": "PubMed", "id": "26909311", "url": "https://pubmed.ncbi.nlm.nih.gov/26909311" }, { "database": "PubMed", "id": "26928911", "url": "https://pubmed.ncbi.nlm.nih.gov/26928911" }, { "database": "PubMed", "id": "26933812", "url": "https://pubmed.ncbi.nlm.nih.gov/26933812" }, { "database": "PubMed", "id": "26936863", "url": "https://pubmed.ncbi.nlm.nih.gov/26936863" }, { "database": "PubMed", "id": "26959121", "url": "https://pubmed.ncbi.nlm.nih.gov/26959121" }, { "database": "PubMed", "id": "26984741", "url": "https://pubmed.ncbi.nlm.nih.gov/26984741" }, { "database": "PubMed", "id": "27000529", "url": "https://pubmed.ncbi.nlm.nih.gov/27000529" }, { "database": "PubMed", "id": "27001940", "url": "https://pubmed.ncbi.nlm.nih.gov/27001940" }, { "database": "PubMed", "id": "27009084", "url": "https://pubmed.ncbi.nlm.nih.gov/27009084" }, { "database": "PubMed", "id": "27019366", "url": "https://pubmed.ncbi.nlm.nih.gov/27019366" }, { "database": "PubMed", "id": "27050278", "url": "https://pubmed.ncbi.nlm.nih.gov/27050278" }, { "database": "PubMed", "id": "27050422", "url": "https://pubmed.ncbi.nlm.nih.gov/27050422" }, { "database": "PubMed", "id": "27070899", "url": "https://pubmed.ncbi.nlm.nih.gov/27070899" }, { "database": "PubMed", "id": "27099352", "url": "https://pubmed.ncbi.nlm.nih.gov/27099352" }, { "database": "PubMed", "id": "27106789", "url": "https://pubmed.ncbi.nlm.nih.gov/27106789" }, { "database": "PubMed", "id": "27126782", "url": "https://pubmed.ncbi.nlm.nih.gov/27126782" }, { "database": "PubMed", "id": "27166156", "url": "https://pubmed.ncbi.nlm.nih.gov/27166156" }, { "database": "PubMed", "id": "27167344", "url": "https://pubmed.ncbi.nlm.nih.gov/27167344" }, { "database": "PubMed", "id": "27176481", "url": "https://pubmed.ncbi.nlm.nih.gov/27176481" }, { "database": "PubMed", "id": "27191957", "url": "https://pubmed.ncbi.nlm.nih.gov/27191957" }, { "database": "PubMed", "id": "27197158", "url": "https://pubmed.ncbi.nlm.nih.gov/27197158" }, { "database": "PubMed", "id": "27207782", "url": "https://pubmed.ncbi.nlm.nih.gov/27207782" }, { "database": "PubMed", "id": "27213961", "url": "https://pubmed.ncbi.nlm.nih.gov/27213961" }, { "database": "PubMed", "id": "27226588", "url": "https://pubmed.ncbi.nlm.nih.gov/27226588" }, { "database": "PubMed", "id": "27248324", "url": "https://pubmed.ncbi.nlm.nih.gov/27248324" }, { "database": "PubMed", "id": "27253992", "url": "https://pubmed.ncbi.nlm.nih.gov/27253992" }, { "database": "PubMed", "id": "27257474", "url": "https://pubmed.ncbi.nlm.nih.gov/27257474" }, { "database": "PubMed", "id": "27281705", "url": "https://pubmed.ncbi.nlm.nih.gov/27281705" }, { "database": "PubMed", "id": "27329844", "url": "https://pubmed.ncbi.nlm.nih.gov/27329844" }, { "database": "PubMed", "id": "27335054", "url": "https://pubmed.ncbi.nlm.nih.gov/27335054" }, { "database": "PubMed", "id": "27344443", "url": "https://pubmed.ncbi.nlm.nih.gov/27344443" }, { "database": "PubMed", "id": "27384491", "url": "https://pubmed.ncbi.nlm.nih.gov/27384491" }, { "database": "PubMed", "id": "27412013", "url": "https://pubmed.ncbi.nlm.nih.gov/27412013" }, { "database": "PubMed", "id": "27416746", "url": "https://pubmed.ncbi.nlm.nih.gov/27416746" }, { "database": "PubMed", "id": "27435826", "url": "https://pubmed.ncbi.nlm.nih.gov/27435826" }, { "database": "PubMed", "id": "27457910", "url": "https://pubmed.ncbi.nlm.nih.gov/27457910" }, { "database": "PubMed", "id": "27477105", "url": "https://pubmed.ncbi.nlm.nih.gov/27477105" }, { "database": "PubMed", "id": "27485212", "url": "https://pubmed.ncbi.nlm.nih.gov/27485212" }, { "database": "PubMed", "id": "27518433", "url": "https://pubmed.ncbi.nlm.nih.gov/27518433" }, { "database": "PubMed", "id": "27542970", "url": "https://pubmed.ncbi.nlm.nih.gov/27542970" }, { "database": "PubMed", "id": "27549161", "url": "https://pubmed.ncbi.nlm.nih.gov/27549161" }, { "database": "PubMed", "id": "27562094", "url": "https://pubmed.ncbi.nlm.nih.gov/27562094" }, { "database": "PubMed", "id": "27568979", "url": "https://pubmed.ncbi.nlm.nih.gov/27568979" }, { "database": "PubMed", "id": "27634219", "url": "https://pubmed.ncbi.nlm.nih.gov/27634219" }, { "database": "PubMed", "id": "27689988", "url": "https://pubmed.ncbi.nlm.nih.gov/27689988" }, { "database": "PubMed", "id": "27702567", "url": "https://pubmed.ncbi.nlm.nih.gov/27702567" }, { "database": "PubMed", "id": "27734117", "url": "https://pubmed.ncbi.nlm.nih.gov/27734117" }, { "database": "PubMed", "id": "27765055", "url": "https://pubmed.ncbi.nlm.nih.gov/27765055" }, { "database": "PubMed", "id": "27778132", "url": "https://pubmed.ncbi.nlm.nih.gov/27778132" }, { "database": "PubMed", "id": "27799485", "url": "https://pubmed.ncbi.nlm.nih.gov/27799485" }, { "database": "PubMed", "id": "27849007", "url": "https://pubmed.ncbi.nlm.nih.gov/27849007" }, { "database": "PubMed", "id": "27861634", "url": "https://pubmed.ncbi.nlm.nih.gov/27861634" }, { "database": "PubMed", "id": "27876711", "url": "https://pubmed.ncbi.nlm.nih.gov/27876711" }, { "database": "PubMed", "id": "27876874", "url": "https://pubmed.ncbi.nlm.nih.gov/27876874" }, { "database": "PubMed", "id": "27893783", "url": "https://pubmed.ncbi.nlm.nih.gov/27893783" }, { "database": "PubMed", "id": "27897192", "url": "https://pubmed.ncbi.nlm.nih.gov/27897192" }, { "database": "PubMed", "id": "27897407", "url": "https://pubmed.ncbi.nlm.nih.gov/27897407" }, { "database": "PubMed", "id": "27922594", "url": "https://pubmed.ncbi.nlm.nih.gov/27922594" }, { "database": "PubMed", "id": "27930667", "url": "https://pubmed.ncbi.nlm.nih.gov/27930667" }, { "database": "PubMed", "id": "27935220", "url": "https://pubmed.ncbi.nlm.nih.gov/27935220" }, { "database": "PubMed", "id": "27940127", "url": "https://pubmed.ncbi.nlm.nih.gov/27940127" }, { "database": "PubMed", "id": "27966074", "url": "https://pubmed.ncbi.nlm.nih.gov/27966074" }, { "database": "PubMed", "id": "27980227", "url": "https://pubmed.ncbi.nlm.nih.gov/27980227" }, { "database": "PubMed", "id": "28005008", "url": "https://pubmed.ncbi.nlm.nih.gov/28005008" }, { "database": "PubMed", "id": "28050125", "url": "https://pubmed.ncbi.nlm.nih.gov/28050125" }, { "database": "PubMed", "id": "28107427", "url": "https://pubmed.ncbi.nlm.nih.gov/28107427" }, { "database": "PubMed", "id": "28123341", "url": "https://pubmed.ncbi.nlm.nih.gov/28123341" }, { "database": "PubMed", "id": "28123351", "url": "https://pubmed.ncbi.nlm.nih.gov/28123351" }, { "database": "PubMed", "id": "28123943", "url": "https://pubmed.ncbi.nlm.nih.gov/28123943" }, { "database": "PubMed", "id": "28152035", "url": "https://pubmed.ncbi.nlm.nih.gov/28152035" }, { "database": "PubMed", "id": "28186492", "url": "https://pubmed.ncbi.nlm.nih.gov/28186492" }, { "database": "PubMed", "id": "28209725", "url": "https://pubmed.ncbi.nlm.nih.gov/28209725" }, { "database": "PubMed", "id": "28212537", "url": "https://pubmed.ncbi.nlm.nih.gov/28212537" }, { "database": "PubMed", "id": "28225038", "url": "https://pubmed.ncbi.nlm.nih.gov/28225038" }, { "database": "PubMed", "id": "28230282", "url": "https://pubmed.ncbi.nlm.nih.gov/28230282" }, { "database": "PubMed", "id": "28230856", "url": "https://pubmed.ncbi.nlm.nih.gov/28230856" }, { "database": "PubMed", "id": "28243164", "url": "https://pubmed.ncbi.nlm.nih.gov/28243164" }, { "database": "PubMed", "id": "28264587", "url": "https://pubmed.ncbi.nlm.nih.gov/28264587" }, { "database": "PubMed", "id": "28285180", "url": "https://pubmed.ncbi.nlm.nih.gov/28285180" }, { "database": "PubMed", "id": "28294959", "url": "https://pubmed.ncbi.nlm.nih.gov/28294959" }, { "database": "PubMed", "id": "28298211", "url": "https://pubmed.ncbi.nlm.nih.gov/28298211" }, { "database": "PubMed", "id": "28319140", "url": "https://pubmed.ncbi.nlm.nih.gov/28319140" }, { "database": "PubMed", "id": "28329851", "url": "https://pubmed.ncbi.nlm.nih.gov/28329851" }, { "database": "PubMed", "id": "28331616", "url": "https://pubmed.ncbi.nlm.nih.gov/28331616" }, { "database": "PubMed", "id": "28333124", "url": "https://pubmed.ncbi.nlm.nih.gov/28333124" }, { "database": "PubMed", "id": "28346493", "url": "https://pubmed.ncbi.nlm.nih.gov/28346493" }, { "database": "PubMed", "id": "28350865", "url": "https://pubmed.ncbi.nlm.nih.gov/28350865" }, { "database": "PubMed", "id": "28364027", "url": "https://pubmed.ncbi.nlm.nih.gov/28364027" }, { "database": "PubMed", "id": "28368423", "url": "https://pubmed.ncbi.nlm.nih.gov/28368423" }, { "database": "PubMed", "id": "28373901", "url": "https://pubmed.ncbi.nlm.nih.gov/28373901" }, { "database": "PubMed", "id": "28386126", "url": "https://pubmed.ncbi.nlm.nih.gov/28386126" }, { "database": "PubMed", "id": "28395173", "url": "https://pubmed.ncbi.nlm.nih.gov/28395173" }, { "database": "PubMed", "id": "28424421", "url": "https://pubmed.ncbi.nlm.nih.gov/28424421" }, { "database": "PubMed", "id": "28425986", "url": "https://pubmed.ncbi.nlm.nih.gov/28425986" }, { "database": "PubMed", "id": "28426713", "url": "https://pubmed.ncbi.nlm.nih.gov/28426713" }, { "database": "PubMed", "id": "28440748", "url": "https://pubmed.ncbi.nlm.nih.gov/28440748" }, { "database": "PubMed", "id": "28461774", "url": "https://pubmed.ncbi.nlm.nih.gov/28461774" }, { "database": "PubMed", "id": "28489892", "url": "https://pubmed.ncbi.nlm.nih.gov/28489892" }, { "database": "PubMed", "id": "28490443", "url": "https://pubmed.ncbi.nlm.nih.gov/28490443" }, { "database": "PubMed", "id": "28526415", "url": "https://pubmed.ncbi.nlm.nih.gov/28526415" }, { "database": "PubMed", "id": "28529539", "url": "https://pubmed.ncbi.nlm.nih.gov/28529539" }, { "database": "PubMed", "id": "28539257", "url": "https://pubmed.ncbi.nlm.nih.gov/28539257" }, { "database": "PubMed", "id": "28542434", "url": "https://pubmed.ncbi.nlm.nih.gov/28542434" }, { "database": "PubMed", "id": "28560349", "url": "https://pubmed.ncbi.nlm.nih.gov/28560349" }, { "database": "PubMed", "id": "28591208", "url": "https://pubmed.ncbi.nlm.nih.gov/28591208" }, { "database": "PubMed", "id": "28632169", "url": "https://pubmed.ncbi.nlm.nih.gov/28632169" }, { "database": "PubMed", "id": "28665395", "url": "https://pubmed.ncbi.nlm.nih.gov/28665395" }, { "database": "PubMed", "id": "28675664", "url": "https://pubmed.ncbi.nlm.nih.gov/28675664" }, { "database": "PubMed", "id": "28700632", "url": "https://pubmed.ncbi.nlm.nih.gov/28700632" }, { "database": "PubMed", "id": "28710412", "url": "https://pubmed.ncbi.nlm.nih.gov/28710412" }, { "database": "PubMed", "id": "28745831", "url": "https://pubmed.ncbi.nlm.nih.gov/28745831" }, { "database": "PubMed", "id": "28752031", "url": "https://pubmed.ncbi.nlm.nih.gov/28752031" }, { "database": "PubMed", "id": "28759639", "url": "https://pubmed.ncbi.nlm.nih.gov/28759639" }, { "database": "PubMed", "id": "28783756", "url": "https://pubmed.ncbi.nlm.nih.gov/28783756" }, { "database": "PubMed", "id": "28821740", "url": "https://pubmed.ncbi.nlm.nih.gov/28821740" }, { "database": "PubMed", "id": "28834262", "url": "https://pubmed.ncbi.nlm.nih.gov/28834262" }, { "database": "PubMed", "id": "28835690", "url": "https://pubmed.ncbi.nlm.nih.gov/28835690" }, { "database": "PubMed", "id": "28859155", "url": "https://pubmed.ncbi.nlm.nih.gov/28859155" }, { "database": "PubMed", "id": "28870245", "url": "https://pubmed.ncbi.nlm.nih.gov/28870245" }, { "database": "PubMed", "id": "28874678", "url": "https://pubmed.ncbi.nlm.nih.gov/28874678" }, { "database": "PubMed", "id": "28875936", "url": "https://pubmed.ncbi.nlm.nih.gov/28875936" }, { "database": "PubMed", "id": "28878342", "url": "https://pubmed.ncbi.nlm.nih.gov/28878342" }, { "database": "PubMed", "id": "28883493", "url": "https://pubmed.ncbi.nlm.nih.gov/28883493" }, { "database": "PubMed", "id": "28883758", "url": "https://pubmed.ncbi.nlm.nih.gov/28883758" }, { "database": "PubMed", "id": "28933316", "url": "https://pubmed.ncbi.nlm.nih.gov/28933316" }, { "database": "PubMed", "id": "28962394", "url": "https://pubmed.ncbi.nlm.nih.gov/28962394" }, { "database": "PubMed", "id": "28978011", "url": "https://pubmed.ncbi.nlm.nih.gov/28978011" }, { "database": "PubMed", "id": "28979184", "url": "https://pubmed.ncbi.nlm.nih.gov/28979184" }, { "database": "PubMed", "id": "29035165", "url": "https://pubmed.ncbi.nlm.nih.gov/29035165" }, { "database": "PubMed", "id": "29038536", "url": "https://pubmed.ncbi.nlm.nih.gov/29038536" }, { "database": "PubMed", "id": "29057818", "url": "https://pubmed.ncbi.nlm.nih.gov/29057818" }, { "database": "PubMed", "id": "29085990", "url": "https://pubmed.ncbi.nlm.nih.gov/29085990" }, { "database": "PubMed", "id": "29104499", "url": "https://pubmed.ncbi.nlm.nih.gov/29104499" }, { "database": "PubMed", "id": "29109794", "url": "https://pubmed.ncbi.nlm.nih.gov/29109794" }, { "database": "PubMed", "id": "29118722", "url": "https://pubmed.ncbi.nlm.nih.gov/29118722" }, { "database": "PubMed", "id": "29121094", "url": "https://pubmed.ncbi.nlm.nih.gov/29121094" }, { "database": "PubMed", "id": "29123170", "url": "https://pubmed.ncbi.nlm.nih.gov/29123170" }, { "database": "PubMed", "id": "29133930", "url": "https://pubmed.ncbi.nlm.nih.gov/29133930" }, { "database": "PubMed", "id": "29159980", "url": "https://pubmed.ncbi.nlm.nih.gov/29159980" }, { "database": "PubMed", "id": "29163149", "url": "https://pubmed.ncbi.nlm.nih.gov/29163149" }, { "database": "PubMed", "id": "29170374", "url": "https://pubmed.ncbi.nlm.nih.gov/29170374" }, { "database": "PubMed", "id": "29180704", "url": "https://pubmed.ncbi.nlm.nih.gov/29180704" }, { "database": "PubMed", "id": "29184057", "url": "https://pubmed.ncbi.nlm.nih.gov/29184057" }, { "database": "PubMed", "id": "29223528", "url": "https://pubmed.ncbi.nlm.nih.gov/29223528" }, { "database": "PubMed", "id": "29239329", "url": "https://pubmed.ncbi.nlm.nih.gov/29239329" }, { "database": "PubMed", "id": "29244772", "url": "https://pubmed.ncbi.nlm.nih.gov/29244772" }, { "database": "PubMed", "id": "29247431", "url": "https://pubmed.ncbi.nlm.nih.gov/29247431" }, { "database": "PubMed", "id": "29304075", "url": "https://pubmed.ncbi.nlm.nih.gov/29304075" }, { "database": "PubMed", "id": "29311937", "url": "https://pubmed.ncbi.nlm.nih.gov/29311937" }, { "database": "PubMed", "id": "29364220", "url": "https://pubmed.ncbi.nlm.nih.gov/29364220" }, { "database": "PubMed", "id": "29379062", "url": "https://pubmed.ncbi.nlm.nih.gov/29379062" }, { "database": "PubMed", "id": "29384221", "url": "https://pubmed.ncbi.nlm.nih.gov/29384221" }, { "database": "PubMed", "id": "29402989", "url": "https://pubmed.ncbi.nlm.nih.gov/29402989" }, { "database": "PubMed", "id": "29410630", "url": "https://pubmed.ncbi.nlm.nih.gov/29410630" }, { "database": "PubMed", "id": "29433422", "url": "https://pubmed.ncbi.nlm.nih.gov/29433422" }, { "database": "PubMed", "id": "29453154", "url": "https://pubmed.ncbi.nlm.nih.gov/29453154" }, { "database": "PubMed", "id": "29464929", "url": "https://pubmed.ncbi.nlm.nih.gov/29464929" }, { "database": "PubMed", "id": "29472543", "url": "https://pubmed.ncbi.nlm.nih.gov/29472543" }, { "database": "PubMed", "id": "29486284", "url": "https://pubmed.ncbi.nlm.nih.gov/29486284" }, { "database": "PubMed", "id": "29487597", "url": "https://pubmed.ncbi.nlm.nih.gov/29487597" }, { "database": "PubMed", "id": "29494346", "url": "https://pubmed.ncbi.nlm.nih.gov/29494346" }, { "database": "PubMed", "id": "29495962", "url": "https://pubmed.ncbi.nlm.nih.gov/29495962" }, { "database": "PubMed", "id": "29530069", "url": "https://pubmed.ncbi.nlm.nih.gov/29530069" }, { "database": "PubMed", "id": "29535623", "url": "https://pubmed.ncbi.nlm.nih.gov/29535623" }, { "database": "PubMed", "id": "29535720", "url": "https://pubmed.ncbi.nlm.nih.gov/29535720" }, { "database": "PubMed", "id": "29560100", "url": "https://pubmed.ncbi.nlm.nih.gov/29560100" }, { "database": "PubMed", "id": "29615924", "url": "https://pubmed.ncbi.nlm.nih.gov/29615924" }, { "database": "PubMed", "id": "29657993", "url": "https://pubmed.ncbi.nlm.nih.gov/29657993" }, { "database": "PubMed", "id": "29662189", "url": "https://pubmed.ncbi.nlm.nih.gov/29662189" }, { "database": "PubMed", "id": "29700562", "url": "https://pubmed.ncbi.nlm.nih.gov/29700562" }, { "database": "PubMed", "id": "29720580", "url": "https://pubmed.ncbi.nlm.nih.gov/29720580" }, { "database": "PubMed", "id": "29725001", "url": "https://pubmed.ncbi.nlm.nih.gov/29725001" }, { "database": "PubMed", "id": "29748608", "url": "https://pubmed.ncbi.nlm.nih.gov/29748608" }, { "database": "PubMed", "id": "29763645", "url": "https://pubmed.ncbi.nlm.nih.gov/29763645" }, { "database": "PubMed", "id": "29769144", "url": "https://pubmed.ncbi.nlm.nih.gov/29769144" }, { "database": "PubMed", "id": "29775456", "url": "https://pubmed.ncbi.nlm.nih.gov/29775456" }, { "database": "PubMed", "id": "29853881", "url": "https://pubmed.ncbi.nlm.nih.gov/29853881" }, { "database": "PubMed", "id": "29855474", "url": "https://pubmed.ncbi.nlm.nih.gov/29855474" }, { "database": "PubMed", "id": "29860106", "url": "https://pubmed.ncbi.nlm.nih.gov/29860106" }, { "database": "PubMed", "id": "29867489", "url": "https://pubmed.ncbi.nlm.nih.gov/29867489" }, { "database": "PubMed", "id": "29872253", "url": "https://pubmed.ncbi.nlm.nih.gov/29872253" }, { "database": "PubMed", "id": "29920520", "url": "https://pubmed.ncbi.nlm.nih.gov/29920520" }, { "database": "PubMed", "id": "29930536", "url": "https://pubmed.ncbi.nlm.nih.gov/29930536" }, { "database": "PubMed", "id": "29962852", "url": "https://pubmed.ncbi.nlm.nih.gov/29962852" }, { "database": "PubMed", "id": "30005372", "url": "https://pubmed.ncbi.nlm.nih.gov/30005372" }, { "database": "PubMed", "id": "30014636", "url": "https://pubmed.ncbi.nlm.nih.gov/30014636" }, { "database": "PubMed", "id": "30018139", "url": "https://pubmed.ncbi.nlm.nih.gov/30018139" }, { "database": "PubMed", "id": "30022023", "url": "https://pubmed.ncbi.nlm.nih.gov/30022023" }, { "database": "PubMed", "id": "30065170", "url": "https://pubmed.ncbi.nlm.nih.gov/30065170" }, { "database": "PubMed", "id": "30078230", "url": "https://pubmed.ncbi.nlm.nih.gov/30078230" }, { "database": "PubMed", "id": "30103648", "url": "https://pubmed.ncbi.nlm.nih.gov/30103648" }, { "database": "PubMed", "id": "30150922", "url": "https://pubmed.ncbi.nlm.nih.gov/30150922" }, { "database": "PubMed", "id": "30156060", "url": "https://pubmed.ncbi.nlm.nih.gov/30156060" }, { "database": "PubMed", "id": "30186439", "url": "https://pubmed.ncbi.nlm.nih.gov/30186439" }, { "database": "PubMed", "id": "30211334", "url": "https://pubmed.ncbi.nlm.nih.gov/30211334" }, { "database": "PubMed", "id": "30231545", "url": "https://pubmed.ncbi.nlm.nih.gov/30231545" }, { "database": "PubMed", "id": "30237867", "url": "https://pubmed.ncbi.nlm.nih.gov/30237867" }, { "database": "PubMed", "id": "30250638", "url": "https://pubmed.ncbi.nlm.nih.gov/30250638" }, { "database": "PubMed", "id": "30279732", "url": "https://pubmed.ncbi.nlm.nih.gov/30279732" }, { "database": "PubMed", "id": "30378754", "url": "https://pubmed.ncbi.nlm.nih.gov/30378754" }, { "database": "PubMed", "id": "30384400", "url": "https://pubmed.ncbi.nlm.nih.gov/30384400" }, { "database": "PubMed", "id": "30391477", "url": "https://pubmed.ncbi.nlm.nih.gov/30391477" }, { "database": "PubMed", "id": "30391964", "url": "https://pubmed.ncbi.nlm.nih.gov/30391964" }, { "database": "PubMed", "id": "30402124", "url": "https://pubmed.ncbi.nlm.nih.gov/30402124" }, { "database": "PubMed", "id": "30409162", "url": "https://pubmed.ncbi.nlm.nih.gov/30409162" }, { "database": "PubMed", "id": "30409503", "url": "https://pubmed.ncbi.nlm.nih.gov/30409503" }, { "database": "PubMed", "id": "30410062", "url": "https://pubmed.ncbi.nlm.nih.gov/30410062" }, { "database": "PubMed", "id": "30414960", "url": "https://pubmed.ncbi.nlm.nih.gov/30414960" }, { "database": "PubMed", "id": "30429249", "url": "https://pubmed.ncbi.nlm.nih.gov/30429249" }, { "database": "PubMed", "id": "30450767", "url": "https://pubmed.ncbi.nlm.nih.gov/30450767" }, { "database": "PubMed", "id": "30509210", "url": "https://pubmed.ncbi.nlm.nih.gov/30509210" }, { "database": "PubMed", "id": "30515090", "url": "https://pubmed.ncbi.nlm.nih.gov/30515090" }, { "database": "PubMed", "id": "30554658", "url": "https://pubmed.ncbi.nlm.nih.gov/30554658" }, { "database": "PubMed", "id": "30556043", "url": "https://pubmed.ncbi.nlm.nih.gov/30556043" }, { "database": "PubMed", "id": "30578122", "url": "https://pubmed.ncbi.nlm.nih.gov/30578122" }, { "database": "PubMed", "id": "30626204", "url": "https://pubmed.ncbi.nlm.nih.gov/30626204" }, { "database": "PubMed", "id": "30635036", "url": "https://pubmed.ncbi.nlm.nih.gov/30635036" }, { "database": "PubMed", "id": "30696333", "url": "https://pubmed.ncbi.nlm.nih.gov/30696333" }, { "database": "PubMed", "id": "30717198", "url": "https://pubmed.ncbi.nlm.nih.gov/30717198" }, { "database": "PubMed", "id": "30806987", "url": "https://pubmed.ncbi.nlm.nih.gov/30806987" }, { "database": "PubMed", "id": "30816216", "url": "https://pubmed.ncbi.nlm.nih.gov/30816216" }, { "database": "PubMed", "id": "30823934", "url": "https://pubmed.ncbi.nlm.nih.gov/30823934" }, { "database": "PubMed", "id": "30862120", "url": "https://pubmed.ncbi.nlm.nih.gov/30862120" }, { "database": "PubMed", "id": "30936879", "url": "https://pubmed.ncbi.nlm.nih.gov/30936879" }, { "database": "PubMed", "id": "30972066", "url": "https://pubmed.ncbi.nlm.nih.gov/30972066" }, { "database": "PubMed", "id": "30988282", "url": "https://pubmed.ncbi.nlm.nih.gov/30988282" }, { "database": "PubMed", "id": "31112530", "url": "https://pubmed.ncbi.nlm.nih.gov/31112530" }, { "database": "PubMed", "id": "31115790", "url": "https://pubmed.ncbi.nlm.nih.gov/31115790" }, { "database": "PubMed", "id": "31125414", "url": "https://pubmed.ncbi.nlm.nih.gov/31125414" }, { "database": "PubMed", "id": "31155593", "url": "https://pubmed.ncbi.nlm.nih.gov/31155593" }, { "database": "PubMed", "id": "31159888", "url": "https://pubmed.ncbi.nlm.nih.gov/31159888" }, { "database": "PubMed", "id": "31161862", "url": "https://pubmed.ncbi.nlm.nih.gov/31161862" }, { "database": "PubMed", "id": "31167373", "url": "https://pubmed.ncbi.nlm.nih.gov/31167373" }, { "database": "PubMed", "id": "31182807", "url": "https://pubmed.ncbi.nlm.nih.gov/31182807" }, { "database": "PubMed", "id": "31182914", "url": "https://pubmed.ncbi.nlm.nih.gov/31182914" }, { "database": "PubMed", "id": "31205503", "url": "https://pubmed.ncbi.nlm.nih.gov/31205503" }, { "database": "PubMed", "id": "31213670", "url": "https://pubmed.ncbi.nlm.nih.gov/31213670" }, { "database": "PubMed", "id": "31215459", "url": "https://pubmed.ncbi.nlm.nih.gov/31215459" }, { "database": "PubMed", "id": "31233346", "url": "https://pubmed.ncbi.nlm.nih.gov/31233346" }, { "database": "PubMed", "id": "31279779", "url": "https://pubmed.ncbi.nlm.nih.gov/31279779" }, { "database": "PubMed", "id": "31307481", "url": "https://pubmed.ncbi.nlm.nih.gov/31307481" }, { "database": "PubMed", "id": "31337981", "url": "https://pubmed.ncbi.nlm.nih.gov/31337981" }, { "database": "PubMed", "id": "31345225", "url": "https://pubmed.ncbi.nlm.nih.gov/31345225" }, { "database": "PubMed", "id": "31366324", "url": "https://pubmed.ncbi.nlm.nih.gov/31366324" }, { "database": "PubMed", "id": "31372175", "url": "https://pubmed.ncbi.nlm.nih.gov/31372175" }, { "database": "PubMed", "id": "31391499", "url": "https://pubmed.ncbi.nlm.nih.gov/31391499" }, { "database": "PubMed", "id": "31398213", "url": "https://pubmed.ncbi.nlm.nih.gov/31398213" }, { "database": "PubMed", "id": "31399584", "url": "https://pubmed.ncbi.nlm.nih.gov/31399584" }, { "database": "PubMed", "id": "31420304", "url": "https://pubmed.ncbi.nlm.nih.gov/31420304" }, { "database": "PubMed", "id": "31447681", "url": "https://pubmed.ncbi.nlm.nih.gov/31447681" }, { "database": "PubMed", "id": "31462256", "url": "https://pubmed.ncbi.nlm.nih.gov/31462256" }, { "database": "PubMed", "id": "31470507", "url": "https://pubmed.ncbi.nlm.nih.gov/31470507" }, { "database": "PubMed", "id": "31519159", "url": "https://pubmed.ncbi.nlm.nih.gov/31519159" }, { "database": "PubMed", "id": "31551760", "url": "https://pubmed.ncbi.nlm.nih.gov/31551760" }, { "database": "PubMed", "id": "31570855", "url": "https://pubmed.ncbi.nlm.nih.gov/31570855" }, { "database": "PubMed", "id": "31572367", "url": "https://pubmed.ncbi.nlm.nih.gov/31572367" }, { "database": "PubMed", "id": "31614949", "url": "https://pubmed.ncbi.nlm.nih.gov/31614949" }, { "database": "PubMed", "id": "31624287", "url": "https://pubmed.ncbi.nlm.nih.gov/31624287" }, { "database": "PubMed", "id": "31652791", "url": "https://pubmed.ncbi.nlm.nih.gov/31652791" }, { "database": "PubMed", "id": "31767175", "url": "https://pubmed.ncbi.nlm.nih.gov/31767175" }, { "database": "PubMed", "id": "31767180", "url": "https://pubmed.ncbi.nlm.nih.gov/31767180" }, { "database": "PubMed", "id": "31771622", "url": "https://pubmed.ncbi.nlm.nih.gov/31771622" }, { "database": "PubMed", "id": "31783835", "url": "https://pubmed.ncbi.nlm.nih.gov/31783835" }, { "database": "PubMed", "id": "31821410", "url": "https://pubmed.ncbi.nlm.nih.gov/31821410" }, { "database": "PubMed", "id": "31827703", "url": "https://pubmed.ncbi.nlm.nih.gov/31827703" }, { "database": "PubMed", "id": "31850494", "url": "https://pubmed.ncbi.nlm.nih.gov/31850494" }, { "database": "PubMed", "id": "31857853", "url": "https://pubmed.ncbi.nlm.nih.gov/31857853" }, { "database": "PubMed", "id": "31903103", "url": "https://pubmed.ncbi.nlm.nih.gov/31903103" }, { "database": "PubMed", "id": "31918917", "url": "https://pubmed.ncbi.nlm.nih.gov/31918917" }, { "database": "PubMed", "id": "31918924", "url": "https://pubmed.ncbi.nlm.nih.gov/31918924" }, { "database": "PubMed", "id": "31924750", "url": "https://pubmed.ncbi.nlm.nih.gov/31924750" }, { "database": "PubMed", "id": "31929511", "url": "https://pubmed.ncbi.nlm.nih.gov/31929511" }, { "database": "PubMed", "id": "31931851", "url": "https://pubmed.ncbi.nlm.nih.gov/31931851" }, { "database": "PubMed", "id": "31959776", "url": "https://pubmed.ncbi.nlm.nih.gov/31959776" }, { "database": "PubMed", "id": "31970200", "url": "https://pubmed.ncbi.nlm.nih.gov/31970200" }, { "database": "PubMed", "id": "31980707", "url": "https://pubmed.ncbi.nlm.nih.gov/31980707" }, { "database": "PubMed", "id": "32038161", "url": "https://pubmed.ncbi.nlm.nih.gov/32038161" }, { "database": "PubMed", "id": "32046324", "url": "https://pubmed.ncbi.nlm.nih.gov/32046324" }, { "database": "PubMed", "id": "32075060", "url": "https://pubmed.ncbi.nlm.nih.gov/32075060" }, { "database": "PubMed", "id": "32079307", "url": "https://pubmed.ncbi.nlm.nih.gov/32079307" }, { "database": "PubMed", "id": "32085796", "url": "https://pubmed.ncbi.nlm.nih.gov/32085796" }, { "database": "PubMed", "id": "32086008", "url": "https://pubmed.ncbi.nlm.nih.gov/32086008" }, { "database": "PubMed", "id": "32101748", "url": "https://pubmed.ncbi.nlm.nih.gov/32101748" }, { "database": "PubMed", "id": "32127592", "url": "https://pubmed.ncbi.nlm.nih.gov/32127592" }, { "database": "PubMed", "id": "32131762", "url": "https://pubmed.ncbi.nlm.nih.gov/32131762" }, { "database": "PubMed", "id": "32153410", "url": "https://pubmed.ncbi.nlm.nih.gov/32153410" }, { "database": "PubMed", "id": "32163656", "url": "https://pubmed.ncbi.nlm.nih.gov/32163656" }, { "database": "PubMed", "id": "32173345", "url": "https://pubmed.ncbi.nlm.nih.gov/32173345" }, { "database": "PubMed", "id": "32194423", "url": "https://pubmed.ncbi.nlm.nih.gov/32194423" }, { "database": "PubMed", "id": "32198214", "url": "https://pubmed.ncbi.nlm.nih.gov/32198214" }, { "database": "PubMed", "id": "32275682", "url": "https://pubmed.ncbi.nlm.nih.gov/32275682" }, { "database": "PubMed", "id": "32276588", "url": "https://pubmed.ncbi.nlm.nih.gov/32276588" }, { "database": "PubMed", "id": "32312949", "url": "https://pubmed.ncbi.nlm.nih.gov/32312949" }, { "database": "PubMed", "id": "32316601", "url": "https://pubmed.ncbi.nlm.nih.gov/32316601" }, { "database": "PubMed", "id": "32341362", "url": "https://pubmed.ncbi.nlm.nih.gov/32341362" }, { "database": "PubMed", "id": "32354153", "url": "https://pubmed.ncbi.nlm.nih.gov/32354153" }, { "database": "PubMed", "id": "32366272", "url": "https://pubmed.ncbi.nlm.nih.gov/32366272" }, { "database": "PubMed", "id": "32373532", "url": "https://pubmed.ncbi.nlm.nih.gov/32373532" }, { "database": "PubMed", "id": "32379706", "url": "https://pubmed.ncbi.nlm.nih.gov/32379706" }, { "database": "PubMed", "id": "32427102", "url": "https://pubmed.ncbi.nlm.nih.gov/32427102" }, { "database": "PubMed", "id": "32483262", "url": "https://pubmed.ncbi.nlm.nih.gov/32483262" }, { "database": "PubMed", "id": "32493400", "url": "https://pubmed.ncbi.nlm.nih.gov/32493400" }, { "database": "PubMed", "id": "32531473", "url": "https://pubmed.ncbi.nlm.nih.gov/32531473" }, { "database": "PubMed", "id": "32555370", "url": "https://pubmed.ncbi.nlm.nih.gov/32555370" }, { "database": "PubMed", "id": "32566257", "url": "https://pubmed.ncbi.nlm.nih.gov/32566257" }, { "database": "PubMed", "id": "32581790", "url": "https://pubmed.ncbi.nlm.nih.gov/32581790" }, { "database": "PubMed", "id": "32596245", "url": "https://pubmed.ncbi.nlm.nih.gov/32596245" }, { "database": "PubMed", "id": "32615737", "url": "https://pubmed.ncbi.nlm.nih.gov/32615737" }, { "database": "PubMed", "id": "32616893", "url": "https://pubmed.ncbi.nlm.nih.gov/32616893" }, { "database": "PubMed", "id": "32636842", "url": "https://pubmed.ncbi.nlm.nih.gov/32636842" }, { "database": "PubMed", "id": "32641498", "url": "https://pubmed.ncbi.nlm.nih.gov/32641498" }, { "database": "PubMed", "id": "32659127", "url": "https://pubmed.ncbi.nlm.nih.gov/32659127" }, { "database": "PubMed", "id": "32699356", "url": "https://pubmed.ncbi.nlm.nih.gov/32699356" }, { "database": "PubMed", "id": "32716920", "url": "https://pubmed.ncbi.nlm.nih.gov/32716920" }, { "database": "PubMed", "id": "32719388", "url": "https://pubmed.ncbi.nlm.nih.gov/32719388" }, { "database": "PubMed", "id": "32728173", "url": "https://pubmed.ncbi.nlm.nih.gov/32728173" }, { "database": "PubMed", "id": "32742256", "url": "https://pubmed.ncbi.nlm.nih.gov/32742256" }, { "database": "PubMed", "id": "32783890", "url": "https://pubmed.ncbi.nlm.nih.gov/32783890" }, { "database": "PubMed", "id": "32792672", "url": "https://pubmed.ncbi.nlm.nih.gov/32792672" }, { "database": "PubMed", "id": "32796688", "url": "https://pubmed.ncbi.nlm.nih.gov/32796688" }, { "database": "PubMed", "id": "32796834", "url": "https://pubmed.ncbi.nlm.nih.gov/32796834" }, { "database": "PubMed", "id": "32849638", "url": "https://pubmed.ncbi.nlm.nih.gov/32849638" }, { "database": "PubMed", "id": "32859869", "url": "https://pubmed.ncbi.nlm.nih.gov/32859869" }, { "database": "PubMed", "id": "32863210", "url": "https://pubmed.ncbi.nlm.nih.gov/32863210" }, { "database": "PubMed", "id": "32873626", "url": "https://pubmed.ncbi.nlm.nih.gov/32873626" }, { "database": "PubMed", "id": "32891670", "url": "https://pubmed.ncbi.nlm.nih.gov/32891670" }, { "database": "PubMed", "id": "32899862", "url": "https://pubmed.ncbi.nlm.nih.gov/32899862" }, { "database": "PubMed", "id": "32911704", "url": "https://pubmed.ncbi.nlm.nih.gov/32911704" }, { "database": "PubMed", "id": "32937140", "url": "https://pubmed.ncbi.nlm.nih.gov/32937140" }, { "database": "PubMed", "id": "32940423", "url": "https://pubmed.ncbi.nlm.nih.gov/32940423" }, { "database": "PubMed", "id": "32943626", "url": "https://pubmed.ncbi.nlm.nih.gov/32943626" }, { "database": "PubMed", "id": "32953932", "url": "https://pubmed.ncbi.nlm.nih.gov/32953932" }, { "database": "PubMed", "id": "32956848", "url": "https://pubmed.ncbi.nlm.nih.gov/32956848" }, { "database": "PubMed", "id": "32983109", "url": "https://pubmed.ncbi.nlm.nih.gov/32983109" }, { "database": "PubMed", "id": "32983159", "url": "https://pubmed.ncbi.nlm.nih.gov/32983159" }, { "database": "PubMed", "id": "33005011", "url": "https://pubmed.ncbi.nlm.nih.gov/33005011" }, { "database": "PubMed", "id": "33012785", "url": "https://pubmed.ncbi.nlm.nih.gov/33012785" }, { "database": "PubMed", "id": "33033766", "url": "https://pubmed.ncbi.nlm.nih.gov/33033766" }, { "database": "PubMed", "id": "33038070", "url": "https://pubmed.ncbi.nlm.nih.gov/33038070" }, { "database": "PubMed", "id": "33062046", "url": "https://pubmed.ncbi.nlm.nih.gov/33062046" }, { "database": "PubMed", "id": "33071755", "url": "https://pubmed.ncbi.nlm.nih.gov/33071755" }, { "database": "PubMed", "id": "33114361", "url": "https://pubmed.ncbi.nlm.nih.gov/33114361" }, { "database": "PubMed", "id": "33130679", "url": "https://pubmed.ncbi.nlm.nih.gov/33130679" }, { "database": "PubMed", "id": "33165366", "url": "https://pubmed.ncbi.nlm.nih.gov/33165366" }, { "database": "PubMed", "id": "33184378", "url": "https://pubmed.ncbi.nlm.nih.gov/33184378" }, { "database": "PubMed", "id": "33184414", "url": "https://pubmed.ncbi.nlm.nih.gov/33184414" }, { "database": "PubMed", "id": "33193405", "url": "https://pubmed.ncbi.nlm.nih.gov/33193405" }, { "database": "PubMed", "id": "33210462", "url": "https://pubmed.ncbi.nlm.nih.gov/33210462" }, { "database": "PubMed", "id": "33226552", "url": "https://pubmed.ncbi.nlm.nih.gov/33226552" }, { "database": "PubMed", "id": "33250856", "url": "https://pubmed.ncbi.nlm.nih.gov/33250856" }, { "database": "PubMed", "id": "33275593", "url": "https://pubmed.ncbi.nlm.nih.gov/33275593" }, { "database": "PubMed", "id": "33287820", "url": "https://pubmed.ncbi.nlm.nih.gov/33287820" }, { "database": "PubMed", "id": "33294856", "url": "https://pubmed.ncbi.nlm.nih.gov/33294856" }, { "database": "PubMed", "id": "33320884", "url": "https://pubmed.ncbi.nlm.nih.gov/33320884" }, { "database": "PubMed", "id": "33348907", "url": "https://pubmed.ncbi.nlm.nih.gov/33348907" }, { "database": "PubMed", "id": "33362773", "url": "https://pubmed.ncbi.nlm.nih.gov/33362773" }, { "database": "PubMed", "id": "33413592", "url": "https://pubmed.ncbi.nlm.nih.gov/33413592" }, { "database": "PubMed", "id": "33414476", "url": "https://pubmed.ncbi.nlm.nih.gov/33414476" }, { "database": "PubMed", "id": "33419082", "url": "https://pubmed.ncbi.nlm.nih.gov/33419082" }, { "database": "PubMed", "id": "33435535", "url": "https://pubmed.ncbi.nlm.nih.gov/33435535" }, { "database": "PubMed", "id": "33500390", "url": "https://pubmed.ncbi.nlm.nih.gov/33500390" }, { "database": "PubMed", "id": "33520717", "url": "https://pubmed.ncbi.nlm.nih.gov/33520717" }, { "database": "PubMed", "id": "33532181", "url": "https://pubmed.ncbi.nlm.nih.gov/33532181" }, { "database": "PubMed", "id": "33547321", "url": "https://pubmed.ncbi.nlm.nih.gov/33547321" }, { "database": "PubMed", "id": "33567340", "url": "https://pubmed.ncbi.nlm.nih.gov/33567340" }, { "database": "PubMed", "id": "33595435", "url": "https://pubmed.ncbi.nlm.nih.gov/33595435" }, { "database": "PubMed", "id": "33603781", "url": "https://pubmed.ncbi.nlm.nih.gov/33603781" }, { "database": "PubMed", "id": "33613308", "url": "https://pubmed.ncbi.nlm.nih.gov/33613308" }, { "database": "PubMed", "id": "33633735", "url": "https://pubmed.ncbi.nlm.nih.gov/33633735" }, { "database": "PubMed", "id": "33649479", "url": "https://pubmed.ncbi.nlm.nih.gov/33649479" }, { "database": "PubMed", "id": "33658993", "url": "https://pubmed.ncbi.nlm.nih.gov/33658993" }, { "database": "PubMed", "id": "33659884", "url": "https://pubmed.ncbi.nlm.nih.gov/33659884" }, { "database": "PubMed", "id": "33669811", "url": "https://pubmed.ncbi.nlm.nih.gov/33669811" }, { "database": "PubMed", "id": "33672385", "url": "https://pubmed.ncbi.nlm.nih.gov/33672385" }, { "database": "PubMed", "id": "33677938", "url": "https://pubmed.ncbi.nlm.nih.gov/33677938" }, { "database": "PubMed", "id": "33688389", "url": "https://pubmed.ncbi.nlm.nih.gov/33688389" }, { "database": "PubMed", "id": "33754024", "url": "https://pubmed.ncbi.nlm.nih.gov/33754024" }, { "database": "PubMed", "id": "33758172", "url": "https://pubmed.ncbi.nlm.nih.gov/33758172" }, { "database": "PubMed", "id": "33758188", "url": "https://pubmed.ncbi.nlm.nih.gov/33758188" }, { "database": "PubMed", "id": "33804171", "url": "https://pubmed.ncbi.nlm.nih.gov/33804171" }, { "database": "PubMed", "id": "33807180", "url": "https://pubmed.ncbi.nlm.nih.gov/33807180" }, { "database": "PubMed", "id": "33846776", "url": "https://pubmed.ncbi.nlm.nih.gov/33846776" }, { "database": "PubMed", "id": "33849555", "url": "https://pubmed.ncbi.nlm.nih.gov/33849555" }, { "database": "PubMed", "id": "33869980", "url": "https://pubmed.ncbi.nlm.nih.gov/33869980" }, { "database": "PubMed", "id": "33884100", "url": "https://pubmed.ncbi.nlm.nih.gov/33884100" }, { "database": "PubMed", "id": "33931442", "url": "https://pubmed.ncbi.nlm.nih.gov/33931442" }, { "database": "PubMed", "id": "33941789", "url": "https://pubmed.ncbi.nlm.nih.gov/33941789" }, { "database": "PubMed", "id": "33971888", "url": "https://pubmed.ncbi.nlm.nih.gov/33971888" }, { "database": "PubMed", "id": "34082428", "url": "https://pubmed.ncbi.nlm.nih.gov/34082428" }, { "database": "PubMed", "id": "34208786", "url": "https://pubmed.ncbi.nlm.nih.gov/34208786" }, { "database": "PubMed", "id": "34366869", "url": "https://pubmed.ncbi.nlm.nih.gov/34366869" }, { "database": "PubMed", "id": "34465724", "url": "https://pubmed.ncbi.nlm.nih.gov/34465724" }, { "database": "PubMed", "id": "34988938", "url": "https://pubmed.ncbi.nlm.nih.gov/34988938" }, { "database": "PubMed", "id": "35023763", "url": "https://pubmed.ncbi.nlm.nih.gov/35023763" }, { "database": "PubMed", "id": "35201262", "url": "https://pubmed.ncbi.nlm.nih.gov/35201262" }, { "database": "PubMed", "id": "35224167", "url": "https://pubmed.ncbi.nlm.nih.gov/35224167" }, { "database": "PubMed", "id": "35452152", "url": "https://pubmed.ncbi.nlm.nih.gov/35452152" }, { "database": "PubMed", "id": "35477177", "url": "https://pubmed.ncbi.nlm.nih.gov/35477177" }, { "database": "PubMed", "id": "35748215", "url": "https://pubmed.ncbi.nlm.nih.gov/35748215" }, { "database": "PubMed", "id": "35766003", "url": "https://pubmed.ncbi.nlm.nih.gov/35766003" }, { "database": "PubMed", "id": "35907465", "url": "https://pubmed.ncbi.nlm.nih.gov/35907465" }, { "database": "PubMed", "id": "35964410", "url": "https://pubmed.ncbi.nlm.nih.gov/35964410" }, { "database": "PubMed", "id": "36065437", "url": "https://pubmed.ncbi.nlm.nih.gov/36065437" }, { "database": "PubMed", "id": "36148310", "url": "https://pubmed.ncbi.nlm.nih.gov/36148310" }, { "database": "PubMed", "id": "36198369", "url": "https://pubmed.ncbi.nlm.nih.gov/36198369" }, { "database": "PubMed", "id": "36215790", "url": "https://pubmed.ncbi.nlm.nih.gov/36215790" }, { "database": "PubMed", "id": "36297523", "url": "https://pubmed.ncbi.nlm.nih.gov/36297523" }, { "database": "PubMed", "id": "36325883", "url": "https://pubmed.ncbi.nlm.nih.gov/36325883" }, { "database": "PubMed", "id": "9927197", "url": "https://pubmed.ncbi.nlm.nih.gov/9927197" }, { "database": "PubMed", "id": "27430312", "url": "https://pubmed.ncbi.nlm.nih.gov/27430312" }, { "database": "PubMed", "id": "15753085", "url": "https://pubmed.ncbi.nlm.nih.gov/15753085" }, { "database": "PubMed", "id": "26095253", "url": "https://pubmed.ncbi.nlm.nih.gov/26095253" }, { "database": "PubMed", "id": "26107252", "url": "https://pubmed.ncbi.nlm.nih.gov/26107252" }, { "database": "PubMed", "id": "26359501", "url": "https://pubmed.ncbi.nlm.nih.gov/26359501" }, { "database": "PubMed", "id": "32350463", "url": "https://pubmed.ncbi.nlm.nih.gov/32350463" }, { "database": "PubMed", "id": "12783884", "url": "https://pubmed.ncbi.nlm.nih.gov/12783884" } ], "site_lbl": "Ser473", "uniprot_canonical_ac": "P31750-1" } ], "record_id": "pubmed.26100075", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alternative Activation Mechanisms of Protein Kinase B Trigger Distinct Downstream Signaling Responses.", "journal": "The Journal of biological chemistry", "date": "2015-10-09", "authors": "Balzano Deborah, Fawal Mohamad-Ali, Vel\u00e1zquez Jose V, Santiveri Clara M, Yang Joshua, Pastor Joaqu\u00edn, Campos-Olivas Ram\u00f3n, Djouder Nabil, Lietha Daniel", "reference": { "type": "PubMed", "id": "26286748", "url": "https://pubmed.ncbi.nlm.nih.gov/26286748" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.26286748", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Loss of Fas apoptosis inhibitory molecule leads to spontaneous obesity and hepatosteatosis.", "journal": "Cell death & disease", "date": "2016", "authors": "Huo J, Ma Y, Liu JJ, Ho YS, Liu S, Soh LY, Chen S, Xu S, Han W, Hong A, Lim SC, Lam KP", "reference": { "type": "PubMed", "id": "26866272", "url": "https://pubmed.ncbi.nlm.nih.gov/26866272" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 474, "end_pos": 474, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MTOR", "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" }, { "database": "PRO", "id": "Q60823", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q60823" }, { "database": "iPTMnet", "id": "Q60823", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q60823" }, { "database": "PubMed", "id": "31548312", "url": "https://pubmed.ncbi.nlm.nih.gov/31548312" }, { "database": "PubMed", "id": "26866272", "url": "https://pubmed.ncbi.nlm.nih.gov/26866272" }, { "database": "PubMed", "id": "27251941", "url": "https://pubmed.ncbi.nlm.nih.gov/27251941" }, { "database": "PubMed", "id": "28102348", "url": "https://pubmed.ncbi.nlm.nih.gov/28102348" }, { "database": "PubMed", "id": "31270932", "url": "https://pubmed.ncbi.nlm.nih.gov/31270932" } ], "site_lbl": "Ser474", "uniprot_canonical_ac": "Q60823-1" } ], "record_id": "pubmed.26866272", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The phosphatidylethanolamine derivative diDCP-LA-PE mimics intracellular insulin signaling.", "journal": "Scientific reports", "date": "2016", "authors": "Nishizaki T, Gotoh A, Shimizu T, Tanaka A", "reference": { "type": "PubMed", "id": "27251941", "url": "https://pubmed.ncbi.nlm.nih.gov/27251941" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 309, "end_pos": 309, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PDPK1", "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" }, { "database": "iPTMnet", "id": "Q60823", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q60823" }, { "database": "PubMed", "id": "26100075", "url": "https://pubmed.ncbi.nlm.nih.gov/26100075" }, { "database": "PubMed", "id": "27251941", "url": "https://pubmed.ncbi.nlm.nih.gov/27251941" } ], "site_lbl": "Thr309", "uniprot_canonical_ac": "Q60823-1" }, { "start_pos": 474, "end_pos": 474, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MTOR", "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" }, { "database": "PRO", "id": "Q60823", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q60823" }, { "database": "iPTMnet", "id": "Q60823", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q60823" }, { "database": "PubMed", "id": "31548312", "url": "https://pubmed.ncbi.nlm.nih.gov/31548312" }, { "database": "PubMed", "id": "26866272", "url": "https://pubmed.ncbi.nlm.nih.gov/26866272" }, { "database": "PubMed", "id": "27251941", "url": "https://pubmed.ncbi.nlm.nih.gov/27251941" }, { "database": "PubMed", "id": "28102348", "url": "https://pubmed.ncbi.nlm.nih.gov/28102348" }, { "database": "PubMed", "id": "31270932", "url": "https://pubmed.ncbi.nlm.nih.gov/31270932" } ], "site_lbl": "Ser474", "uniprot_canonical_ac": "Q60823-1" } ], "record_id": "pubmed.27251941", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Sodium-Glucose Cotransporter 2 Inhibitor Dapagliflozin Prevents Cardiomyopathy in a Diabetic Lipodystrophic Mouse Model.", "journal": "Diabetes", "date": "2017", "authors": "Joubert M, Jagu B, Montaigne D, Marechal X, Tesse A, Ayer A, Dollet L, Le May C, Toumaniantz G, Manrique A, Charpentier F, Staels B, Magre J, Cariou B, Prieur X", "reference": { "type": "PubMed", "id": "28052965", "url": "https://pubmed.ncbi.nlm.nih.gov/28052965" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9R1E0-1", "protein_name": "Forkhead box protein O1", "gene_name": "Foxo1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "28528544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28528544" }, { "id": "Q60823", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q60823" }, { "id": "28052965", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28052965" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q60823-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 645, "start_aa": "Thr", "end_pos": 645, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr645", "evidence": [ { "id": "25153642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153642" }, { "id": "Q9R1E0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R1E0" }, { "id": "24730386", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24730386" }, { "id": "28528544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28528544" }, { "id": "36852467", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36852467" }, { "id": "40997131", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40997131" }, { "id": "38191912", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38191912" }, { "id": "25944660", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25944660" }, { "id": "28052965", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28052965" }, { "id": "40021952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40021952" }, { "id": "25142777", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25142777" }, { "id": "34678516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34678516" }, { "id": "40885482", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40885482" }, { "id": "32783937", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32783937" }, { "id": "32848054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32848054" }, { "id": "Q9R1E0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9R1E0" }, { "id": "38861834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38861834" }, { "id": "32782141", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32782141" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9R1E0-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 646, "start_aa": "Thr", "end_pos": 646, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr646", "evidence": [ { "id": "25153642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153642" }, { "id": "Q9R1E0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R1E0" }, { "id": "24730386", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24730386" }, { "id": "28528544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28528544" }, { "id": "36852467", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36852467" }, { "id": "40997131", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40997131" }, { "id": "38191912", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38191912" }, { "id": "25944660", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25944660" }, { "id": "28052965", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28052965" }, { "id": "40021952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40021952" }, { "id": "25142777", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25142777" }, { "id": "34678516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34678516" }, { "id": "40885482", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40885482" }, { "id": "32783937", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32783937" }, { "id": "38861834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38861834" }, { "id": "Q9R1E0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9R1E0" }, { "id": "32782141", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32782141" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9R1E0-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 651, "start_aa": "Ser", "end_pos": 651, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser651", "evidence": [ { "id": "25153642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153642" }, { "id": "Q9R1E0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R1E0" }, { "id": "24730386", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24730386" }, { "id": "28528544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28528544" }, { "id": "36852467", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36852467" }, { "id": "40997131", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40997131" }, { "id": "38191912", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38191912" }, { "id": "25944660", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25944660" }, { "id": "28052965", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28052965" }, { "id": "40021952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40021952" }, { "id": "25142777", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25142777" }, { "id": "34678516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34678516" }, { "id": "40885482", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40885482" }, { "id": "32783937", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32783937" }, { "id": "Q9R1E0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9R1E0" }, { "id": "38861834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38861834" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9R1E0-1" } ], "record_id": "pubmed.28052965", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_o_linked_sites", "count": 3 }, { "field": "exact_o_linked_glycan_sites", "count": 3 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_o_linked_sites", "count": 3 }, { "field": "exact_o_linked_glycan_sites", "count": 3 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HO-1 inhibits preadipocyte proliferation and differentiation at the onset of obesity via ROS dependent activation of Akt2.", "journal": "Scientific reports", "date": "2017", "authors": "Wagner G, Lindroos-Christensen J, Einwallner E, Husa J, Zapf TC, Lipp K, Rauscher S, Groger M, Spittler A, Loewe R, Gruber F, Duvigneau JC, Mohr T, Sutterluty-Fall H, Klinglmuller F, Prager G, Huppertz B, Yun J, Wagner O, Esterbauer H, Bilban M", "reference": { "type": "PubMed", "id": "28102348", "url": "https://pubmed.ncbi.nlm.nih.gov/28102348" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 474, "end_pos": 474, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MTOR", "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" }, { "database": "PRO", "id": "Q60823", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q60823" }, { "database": "iPTMnet", "id": "Q60823", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q60823" }, { "database": "PubMed", "id": "31548312", "url": "https://pubmed.ncbi.nlm.nih.gov/31548312" }, { "database": "PubMed", "id": "26866272", "url": "https://pubmed.ncbi.nlm.nih.gov/26866272" }, { "database": "PubMed", "id": "27251941", "url": "https://pubmed.ncbi.nlm.nih.gov/27251941" }, { "database": "PubMed", "id": "28102348", "url": "https://pubmed.ncbi.nlm.nih.gov/28102348" }, { "database": "PubMed", "id": "31270932", "url": "https://pubmed.ncbi.nlm.nih.gov/31270932" } ], "site_lbl": "Ser474", "uniprot_canonical_ac": "Q60823-1" } ], "record_id": "pubmed.28102348", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "14-3-3 proteins regulate desmosomal adhesion via plakophilins.", "journal": "Journal of cell science", "date": "2018", "authors": "Rietscher K, Keil R, Jordan A, Hatzfeld M", "reference": { "type": "PubMed", "id": "29678907", "url": "https://pubmed.ncbi.nlm.nih.gov/29678907" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y446-1", "protein_name": "Plakophilin-3", "gene_name": "PKP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31947-1", "protein_name": "14-3-3 protein sigma", "gene_name": "SFN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97350-1", "protein_name": "Plakophilin-1", "gene_name": "Pkp1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9QY23-1", "protein_name": "Plakophilin-3", "gene_name": "Pkp3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q13835-1", "protein_name": "Plakophilin-1", "gene_name": "PKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61981-1", "protein_name": "14-3-3 protein gamma", "gene_name": "YWHAG", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 285, "end_pos": 285, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes interaction with SFN.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y446", "url": "https://www.uniprot.org/uniprotkb/Q9Y446" }, { "database": "PubMed", "id": "24124604", "url": "https://pubmed.ncbi.nlm.nih.gov/24124604" }, { "database": "PubMed", "id": "29678907", "url": "https://pubmed.ncbi.nlm.nih.gov/29678907" } ], "uniprot_canonical_ac": "Q9Y446-1" }, { "start_pos": 118, "end_pos": 118, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces the interaction with YWHAG.", "evidence": [ { "database": "UniProtKB", "id": "Q13835", "url": "https://www.uniprot.org/uniprotkb/Q13835" }, { "database": "PubMed", "id": "29678907", "url": "https://pubmed.ncbi.nlm.nih.gov/29678907" } ], "uniprot_canonical_ac": "Q13835-1" }, { "start_pos": 119, "end_pos": 119, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces the interaction with YWHAG.", "evidence": [ { "database": "UniProtKB", "id": "Q13835", "url": "https://www.uniprot.org/uniprotkb/Q13835" }, { "database": "PubMed", "id": "29678907", "url": "https://pubmed.ncbi.nlm.nih.gov/29678907" } ], "uniprot_canonical_ac": "Q13835-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes interaction with YWHAG.", "evidence": [ { "database": "UniProtKB", "id": "Q13835", "url": "https://www.uniprot.org/uniprotkb/Q13835" }, { "database": "PubMed", "id": "29678907", "url": "https://pubmed.ncbi.nlm.nih.gov/29678907" } ], "uniprot_canonical_ac": "Q13835-1" }, { "start_pos": 171, "end_pos": 171, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on interaction with YWHAG.", "evidence": [ { "database": "UniProtKB", "id": "Q13835", "url": "https://www.uniprot.org/uniprotkb/Q13835" }, { "database": "PubMed", "id": "29678907", "url": "https://pubmed.ncbi.nlm.nih.gov/29678907" } ], "uniprot_canonical_ac": "Q13835-1" }, { "start_pos": 54, "end_pos": 54, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on interaction with YWHAG.", "evidence": [ { "database": "UniProtKB", "id": "Q13835", "url": "https://www.uniprot.org/uniprotkb/Q13835" }, { "database": "PubMed", "id": "29678907", "url": "https://pubmed.ncbi.nlm.nih.gov/29678907" } ], "uniprot_canonical_ac": "Q13835-1" } ], "phosphorylation": [ { "start_pos": 285, "end_pos": 285, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9Y446", "url": "https://www.uniprot.org/uniprotkb/Q9Y446" }, { "database": "PubMed", "id": "24124604", "url": "https://pubmed.ncbi.nlm.nih.gov/24124604" }, { "database": "iPTMnet", "id": "Q9Y446", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Y446" }, { "database": "PubMed", "id": "29678907", "url": "https://pubmed.ncbi.nlm.nih.gov/29678907" } ], "site_lbl": "Ser285", "uniprot_canonical_ac": "Q9Y446-1" }, { "start_pos": 155, "end_pos": 155, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13835", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13835" }, { "database": "PubMed", "id": "29678907", "url": "https://pubmed.ncbi.nlm.nih.gov/29678907" } ], "site_lbl": "Ser155", "uniprot_canonical_ac": "Q13835-1" } ], "record_id": "pubmed.29678907", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PACAP ameliorates hepatic metabolism and inflammation through up-regulating FAIM in obesity.", "journal": "Journal of cellular and molecular medicine", "date": "2019", "authors": "Xiao X, Qiu P, Gong HZ, Chen XM, Sun Y, Hong A, Ma Y", "reference": { "type": "PubMed", "id": "31270932", "url": "https://pubmed.ncbi.nlm.nih.gov/31270932" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 474, "end_pos": 474, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MTOR", "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" }, { "database": "PRO", "id": "Q60823", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q60823" }, { "database": "iPTMnet", "id": "Q60823", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q60823" }, { "database": "PubMed", "id": "31548312", "url": "https://pubmed.ncbi.nlm.nih.gov/31548312" }, { "database": "PubMed", "id": "26866272", "url": "https://pubmed.ncbi.nlm.nih.gov/26866272" }, { "database": "PubMed", "id": "27251941", "url": "https://pubmed.ncbi.nlm.nih.gov/27251941" }, { "database": "PubMed", "id": "28102348", "url": "https://pubmed.ncbi.nlm.nih.gov/28102348" }, { "database": "PubMed", "id": "31270932", "url": "https://pubmed.ncbi.nlm.nih.gov/31270932" } ], "site_lbl": "Ser474", "uniprot_canonical_ac": "Q60823-1" } ], "record_id": "pubmed.31270932", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, chromosomal localization and expression analysis of the mouse Akt2 oncogene.", "journal": "Oncogene", "date": "1995", "authors": "Altomare D A, Guo K, Cheng J Q, Sonoda G, Walsh K, Testa J R", "reference": { "type": "PubMed", "id": "7566964", "url": "https://pubmed.ncbi.nlm.nih.gov/7566964" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q60823-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "Akt2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60823", "url": "https://www.uniprot.org/uniprotkb/Q60823" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.7566964", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adaptor protein 3BP2 is a potential ligand of Src homology 2 and 3 domains of Lyn protein-tyrosine kinase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Maeno K, Sada K, Kyo S, Miah SM, Kawauchi-Kamata K, Qu X, Shi Y, Yamamura H", "reference": { "type": "PubMed", "id": "12709437", "url": "https://pubmed.ncbi.nlm.nih.gov/12709437" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q06649-1", "protein_name": "SH3 domain-binding protein 2", "gene_name": "Sh3bp2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q00655-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Pig" }, { "uniprot_canonical_ac": "P78314-1", "protein_name": "SH3 domain-binding protein 2", "gene_name": "SH3BP2", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q06649", "url": "https://www.uniprot.org/uniprotkb/Q06649" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 174, "end_pos": 174, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SYK", "evidence": [ { "database": "UniProtKB", "id": "Q06649", "url": "https://www.uniprot.org/uniprotkb/Q06649" }, { "database": "iPTMnet", "id": "Q06649", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06649" }, { "database": "PubMed", "id": "12709437", "url": "https://pubmed.ncbi.nlm.nih.gov/12709437" } ], "site_lbl": "Tyr174", "uniprot_canonical_ac": "Q06649-1" }, { "start_pos": 183, "end_pos": 183, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SYK", "evidence": [ { "database": "UniProtKB", "id": "Q06649", "url": "https://www.uniprot.org/uniprotkb/Q06649" }, { "database": "IntAct", "id": "Q06649", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q06649*" }, { "database": "iPTMnet", "id": "Q06649", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06649" }, { "database": "PubMed", "id": "15751964", "url": "https://pubmed.ncbi.nlm.nih.gov/15751964" }, { "database": "PubMed", "id": "12709437", "url": "https://pubmed.ncbi.nlm.nih.gov/12709437" } ], "site_lbl": "Tyr183", "uniprot_canonical_ac": "Q06649-1" }, { "start_pos": 446, "end_pos": 446, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SYK", "evidence": [ { "database": "UniProtKB", "id": "Q06649", "url": "https://www.uniprot.org/uniprotkb/Q06649" }, { "database": "IntAct", "id": "Q06649", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q06649*" }, { "database": "iPTMnet", "id": "Q06649", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06649" }, { "database": "PubMed", "id": "15751964", "url": "https://pubmed.ncbi.nlm.nih.gov/15751964" }, { "database": "PubMed", "id": "12709437", "url": "https://pubmed.ncbi.nlm.nih.gov/12709437" } ], "site_lbl": "Tyr446", "uniprot_canonical_ac": "Q06649-1" }, { "start_pos": 174, "end_pos": 174, "kinase_uniprot_canonical_ac": "P43405-1", "kinase_gene_name": "SYK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P78314", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P78314" }, { "database": "PubMed", "id": "12709437", "url": "https://pubmed.ncbi.nlm.nih.gov/12709437" } ], "site_lbl": "Tyr174", "uniprot_canonical_ac": "P78314-1" }, { "start_pos": 183, "end_pos": 183, "kinase_uniprot_canonical_ac": "P43405-1", "kinase_gene_name": "SYK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P78314", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P78314" }, { "database": "PubMed", "id": "11390470", "url": "https://pubmed.ncbi.nlm.nih.gov/11390470" }, { "database": "PubMed", "id": "12709437", "url": "https://pubmed.ncbi.nlm.nih.gov/12709437" } ], "site_lbl": "Tyr183", "uniprot_canonical_ac": "P78314-1" }, { "start_pos": 448, "end_pos": 448, "kinase_uniprot_canonical_ac": "P43405-1", "kinase_gene_name": "SYK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P78314", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P78314" }, { "database": "PubMed", "id": "12709437", "url": "https://pubmed.ncbi.nlm.nih.gov/12709437" } ], "site_lbl": "Tyr448", "uniprot_canonical_ac": "P78314-1" } ], "mutagenesis": [ { "start_pos": 395, "end_pos": 395, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q00655", "url": "https://www.uniprot.org/uniprotkb/Q00655" }, { "database": "PubMed", "id": "12709437", "url": "https://pubmed.ncbi.nlm.nih.gov/12709437" } ], "uniprot_canonical_ac": "Q00655-1" } ], "record_id": "pubmed.12709437", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tyrosine phosphorylation of adaptor protein 3BP2 induces T cell receptor-mediated activation of transcription factor.", "journal": "Biochemistry", "date": "2005", "authors": "Qu X, Kawauchi-Kamata K, Miah SM, Hatani T, Yamamura H, Sada K", "reference": { "type": "PubMed", "id": "15751964", "url": "https://pubmed.ncbi.nlm.nih.gov/15751964" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q06649-1", "protein_name": "SH3 domain-binding protein 2", "gene_name": "Sh3bp2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P78314-1", "protein_name": "SH3 domain-binding protein 2", "gene_name": "SH3BP2", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q06649", "url": "https://www.uniprot.org/uniprotkb/Q06649" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 183, "end_pos": 183, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SYK", "evidence": [ { "database": "UniProtKB", "id": "Q06649", "url": "https://www.uniprot.org/uniprotkb/Q06649" }, { "database": "IntAct", "id": "Q06649", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q06649*" }, { "database": "iPTMnet", "id": "Q06649", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06649" }, { "database": "PubMed", "id": "15751964", "url": "https://pubmed.ncbi.nlm.nih.gov/15751964" }, { "database": "PubMed", "id": "12709437", "url": "https://pubmed.ncbi.nlm.nih.gov/12709437" } ], "site_lbl": "Tyr183", "uniprot_canonical_ac": "Q06649-1" }, { "start_pos": 446, "end_pos": 446, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SYK", "evidence": [ { "database": "UniProtKB", "id": "Q06649", "url": "https://www.uniprot.org/uniprotkb/Q06649" }, { "database": "IntAct", "id": "Q06649", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q06649*" }, { "database": "iPTMnet", "id": "Q06649", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06649" }, { "database": "PubMed", "id": "15751964", "url": "https://pubmed.ncbi.nlm.nih.gov/15751964" }, { "database": "PubMed", "id": "12709437", "url": "https://pubmed.ncbi.nlm.nih.gov/12709437" } ], "site_lbl": "Tyr446", "uniprot_canonical_ac": "Q06649-1" }, { "start_pos": 448, "end_pos": 448, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SYK", "evidence": [ { "database": "UniProtKB", "id": "P78314", "url": "https://www.uniprot.org/uniprotkb/P78314" }, { "database": "IntAct", "id": "P78314", "url": "https://www.ebi.ac.uk/intact/interactors/id:P78314*" }, { "database": "iPTMnet", "id": "P78314", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P78314" }, { "database": "PubMed", "id": "15751964", "url": "https://pubmed.ncbi.nlm.nih.gov/15751964" } ], "site_lbl": "Tyr448", "uniprot_canonical_ac": "P78314-1" } ], "record_id": "pubmed.15751964", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Brain-specific expression of the nuclear actin-related protein ArpNalpha and its involvement in mammalian SWI/SNF chromatin remodeling complex.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2002", "authors": "Kuroda Yukiko, Oma Yukako, Nishimori Katsuhiko, Ohta Tsutomu, Harata Masahiko", "reference": { "type": "PubMed", "id": "12437990", "url": "https://pubmed.ncbi.nlm.nih.gov/12437990" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99MR0-1", "protein_name": "Actin-like protein 6B", "gene_name": "Actl6b", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99MR0", "url": "https://www.uniprot.org/uniprotkb/Q99MR0" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.12437990", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of dendritic development by neuron-specific chromatin remodeling complexes.", "journal": "Neuron", "date": "2007-10-04", "authors": "Wu Jiang I, Lessard Julie, Olave Ivan A, Qiu Zilong, Ghosh Anirvan, Graef Isabella A, Crabtree Gerald R", "reference": { "type": "PubMed", "id": "17920018", "url": "https://pubmed.ncbi.nlm.nih.gov/17920018" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99MR0-1", "protein_name": "Actin-like protein 6B", "gene_name": "Actl6b", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BW22-1", "protein_name": "Calcium-responsive transactivator", "gene_name": "Ss18l1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99MR0", "url": "https://www.uniprot.org/uniprotkb/Q99MR0" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.17920018", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of angiomotin/JEAP family proteins: interaction with MUPP1/Patj and their endogenous properties.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2007", "authors": "Sugihara-Mizuno Y, Adachi M, Kobayashi Y, Hamazaki Y, Nishimura M, Imai T, Furuse M, Tsukita S", "reference": { "type": "PubMed", "id": "17397395", "url": "https://pubmed.ncbi.nlm.nih.gov/17397395" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K371-1", "protein_name": "Angiomotin-like protein 2", "gene_name": "Amotl2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9D4H4-1", "protein_name": "Angiomotin-like protein 1", "gene_name": "Amotl1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K371", "url": "https://www.uniprot.org/uniprotkb/Q8K371" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.17397395", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AmotL2 links VE-cadherin to contractile actin fibres necessary for aortic lumen expansion.", "journal": "Nature communications", "date": "2014-05-07", "authors": "Hultin Sara, Zheng Yujuan, Mojallal Mahdi, Vertuani Simona, Gentili Christian, Balland Martial, Milloud Rachel, Belting Heinz-Georg, Affolter Markus, Helker Christian S M, Adams Ralf H, Herzog Wiebke, Uhlen Per, Majumdar Arindam, Holmgren Lars", "reference": { "type": "PubMed", "id": "24806444", "url": "https://pubmed.ncbi.nlm.nih.gov/24806444" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K371-1", "protein_name": "Angiomotin-like protein 2", "gene_name": "Amotl2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P60710-1", "protein_name": "Actin, cytoplasmic 1", "gene_name": "Actb", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "A1YB07-1", "protein_name": "Angiomotin-like 2a", "gene_name": "amotl2a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "B8A5S6-1", "protein_name": "Angiomotin-like 2b", "gene_name": "amotl2b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q6RHR9-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1", "gene_name": "Magi1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P55284-1", "protein_name": "Cadherin-5", "gene_name": "Cdh5", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K371", "url": "https://www.uniprot.org/uniprotkb/Q8K371" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 107, "end_pos": 107, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes interaction with MAGI1 and ACTB. No effect on interaction with CDH5.", "evidence": [ { "database": "UniProtKB", "id": "Q8K371", "url": "https://www.uniprot.org/uniprotkb/Q8K371" }, { "database": "PubMed", "id": "24806444", "url": "https://pubmed.ncbi.nlm.nih.gov/24806444" } ], "uniprot_canonical_ac": "Q8K371-1" }, { "start_pos": 214, "end_pos": 214, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on interaction with CDH5, MAGI1 and ACTB.", "evidence": [ { "database": "UniProtKB", "id": "Q8K371", "url": "https://www.uniprot.org/uniprotkb/Q8K371" }, { "database": "PubMed", "id": "24806444", "url": "https://pubmed.ncbi.nlm.nih.gov/24806444" } ], "uniprot_canonical_ac": "Q8K371-1" } ], "record_id": "pubmed.24806444", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The E-cadherin/AmotL2 complex organizes actin filaments required for epithelial hexagonal packing and blastocyst hatching.", "journal": "Scientific reports", "date": "2017", "authors": "Hildebrand S, Hultin S, Subramani A, Petropoulos S, Zhang Y, Cao X, Mpindi J, Kalloniemi O, Johansson S, Majumdar A, Lanner F, Holmgren L", "reference": { "type": "PubMed", "id": "28842668", "url": "https://pubmed.ncbi.nlm.nih.gov/28842668" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K371-1", "protein_name": "Angiomotin-like protein 2", "gene_name": "Amotl2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "A1YB07-1", "protein_name": "Angiomotin-like 2a", "gene_name": "amotl2a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q90Z37-1", "protein_name": "Cadherin-1", "gene_name": "cdh1", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "B8A5S6-1", "protein_name": "Angiomotin-like 2b", "gene_name": "amotl2b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q9Y2J4-1", "protein_name": "Angiomotin-like protein 2", "gene_name": "AMOTL2", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K371", "url": "https://www.uniprot.org/uniprotkb/Q8K371" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 107, "end_pos": 107, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes interaction with MAGI1 and ACTB. No effect on interaction with CDH1.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2J4", "url": "https://www.uniprot.org/uniprotkb/Q9Y2J4" }, { "database": "PubMed", "id": "28842668", "url": "https://pubmed.ncbi.nlm.nih.gov/28842668" } ], "uniprot_canonical_ac": "Q9Y2J4-1" }, { "start_pos": 213, "end_pos": 213, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes interaction with YAP1 and ubiquitination at K-347 and K-408. Abolishes interaction with WWTR1, but does not affect the interaction between WWTR1 and TTF1 on gene promoter regions. No effect on interaction with CDH1.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2J4", "url": "https://www.uniprot.org/uniprotkb/Q9Y2J4" }, { "database": "PubMed", "id": "26598551", "url": "https://pubmed.ncbi.nlm.nih.gov/26598551" }, { "database": "PubMed", "id": "28842668", "url": "https://pubmed.ncbi.nlm.nih.gov/28842668" }, { "database": "PubMed", "id": "23911299", "url": "https://pubmed.ncbi.nlm.nih.gov/23911299" } ], "uniprot_canonical_ac": "Q9Y2J4-1" } ], "record_id": "pubmed.28842668", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AMOTL2 restrains transforming growth factor-beta1-induced proliferation and extracellular matrix deposition of airway smooth muscle cells via the down-regulation of YAP1 activation.", "journal": "Environmental toxicology", "date": "2021", "authors": "Fang P, Deng WJ, Fan N, Shi J, Shi HY, Ou L, Pan JL, Yang SY", "reference": { "type": "PubMed", "id": "34323359", "url": "https://pubmed.ncbi.nlm.nih.gov/34323359" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K371-1", "protein_name": "Angiomotin-like protein 2", "gene_name": "Amotl2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K371", "url": "https://www.uniprot.org/uniprotkb/Q8K371" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.34323359", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The VE-cadherin/AmotL2 mechanosensory pathway suppresses aortic inflammation and the formation of abdominal aortic aneurysms.", "journal": "Nature cardiovascular research", "date": "2023-07", "authors": "Zhang Yuanyuan, Zhang Yumeng, Hutterer Evelyn, Hultin Sara, Bergman Otto, Kolbeinsdottir Solrun, Jin Hong, Forteza Maria J, Ketelhuth Daniel F J, Roy Joy, Hedin Ulf, Enge Martin, Matic Ljubica, Eriksson Per, Holmgren Lars", "reference": { "type": "PubMed", "id": "39195920", "url": "https://pubmed.ncbi.nlm.nih.gov/39195920" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K371-1", "protein_name": "Angiomotin-like protein 2", "gene_name": "Amotl2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y2J4-1", "protein_name": "Angiomotin-like protein 2", "gene_name": "AMOTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33151-1", "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K371", "url": "https://www.uniprot.org/uniprotkb/Q8K371" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.39195920", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of HSD3B7 knockout mice reveals that a 3alpha-hydroxyl stereochemistry is required for bile acid function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Shea HC, Head DD, Setchell KD, Russell DW", "reference": { "type": "PubMed", "id": "17601774", "url": "https://pubmed.ncbi.nlm.nih.gov/17601774" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9EQC1-1", "protein_name": "3 beta-hydroxysteroid dehydrogenase type 7", "gene_name": "Hsd3b7", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9EQC1", "url": "https://www.uniprot.org/uniprotkb/Q9EQC1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.17601774", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Normal retinal development and retinofugal projections in mice lacking the retina-specific variant of actin-binding LIM domain protein.", "journal": "Neuroscience", "date": "2003", "authors": "Lu C, Huang X, Ma H F, Gooley J J, Aparacio J, Roof D J, Chen C, Chen D F, Li T", "reference": { "type": "PubMed", "id": "12849746", "url": "https://pubmed.ncbi.nlm.nih.gov/12849746" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K4G5-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "Ablim1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K4G5", "url": "https://www.uniprot.org/uniprotkb/Q8K4G5" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.12849746", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Actin binding LIM 1 (abLIM1) negatively controls osteoclastogenesis by regulating cell migration and fusion.", "journal": "Journal of cellular physiology", "date": "2018", "authors": "Narahara H, Sakai E, Yamaguchi Y, Narahara S, Iwatake M, Okamoto K, Yoshida N, Tsukuba T", "reference": { "type": "PubMed", "id": "29904924", "url": "https://pubmed.ncbi.nlm.nih.gov/29904924" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K4G5-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "Ablim1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K4G5", "url": "https://www.uniprot.org/uniprotkb/Q8K4G5" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.29904924", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Actin-binding LIM protein 1 regulates receptor activator of NF-kappaB ligand-mediated osteoclast differentiation and motility.", "journal": "BMB reports", "date": "2018", "authors": "Jin SH, Kim H, Gu DR, Park KH, Lee YR, Choi Y, Lee SH", "reference": { "type": "PubMed", "id": "29921413", "url": "https://pubmed.ncbi.nlm.nih.gov/29921413" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K4G5-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "Ablim1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K4G5", "url": "https://www.uniprot.org/uniprotkb/Q8K4G5" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.29921413", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of abLIM, a novel actin-binding and double zinc finger protein.", "journal": "J. Cell Biol.", "date": "1997", "authors": "Roof D J, Hayes A, Adamian M, Chishti A H, Li T", "reference": { "type": "PubMed", "id": "9245787", "url": "https://pubmed.ncbi.nlm.nih.gov/9245787" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K4G5-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "Ablim1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8K4G5", "url": "https://www.uniprot.org/uniprotkb/Q8K4G5" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.9245787", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alteration in the processing of the ACRBP/sp32 protein and sperm head/acrosome malformations in proprotein convertase 4 (PCSK4) null mice.", "journal": "Mol. Hum. Reprod.", "date": "2012", "authors": "Tardif S, Guyonnet B, Cormier N, Cornwall GA", "reference": { "type": "PubMed", "id": "22357636", "url": "https://pubmed.ncbi.nlm.nih.gov/22357636" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3V140-1", "protein_name": "Acrosin-binding protein", "gene_name": "Acrbp", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P29121-1", "protein_name": "Proprotein convertase subtilisin/kexin type 4", "gene_name": "Pcsk4", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3V140", "url": "https://www.uniprot.org/uniprotkb/Q3V140" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.22357636", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two functional forms of ACRBP/sp32 are produced by pre-mRNA alternative splicing in the mouse.", "journal": "Biology of reproduction", "date": "2013", "authors": "Kanemori Y, Ryu JH, Sudo M, Niida-Araida Y, Kodaira K, Takenaka M, Kohno N, Sugiura S, Kashiwabara S, Baba T", "reference": { "type": "PubMed", "id": "23426433", "url": "https://pubmed.ncbi.nlm.nih.gov/23426433" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3V140-1", "protein_name": "Acrosin-binding protein", "gene_name": "Acrbp", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3V140", "url": "https://www.uniprot.org/uniprotkb/Q3V140" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.23426433", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biogenesis of sperm acrosome is regulated by pre-mRNA alternative splicing of Acrbp in the mouse.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Kanemori Y, Koga Y, Sudo M, Kang W, Kashiwabara S, Ikawa M, Hasuwa H, Nagashima K, Ishikawa Y, Ogonuki N, Ogura A, Baba T", "reference": { "type": "PubMed", "id": "27303034", "url": "https://pubmed.ncbi.nlm.nih.gov/27303034" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3V140-1", "protein_name": "Acrosin-binding protein", "gene_name": "Acrbp", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3V140", "url": "https://www.uniprot.org/uniprotkb/Q3V140" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.27303034", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The histone methyltransferase SETD2 is required for expression of acrosin-binding protein 1 and protamines and essential for spermiogenesis in mice.", "journal": "The Journal of biological chemistry", "date": "2018", "authors": "Zuo X, Rong B, Li L, Lv R, Lan F, Tong MH", "reference": { "type": "PubMed", "id": "29716999", "url": "https://pubmed.ncbi.nlm.nih.gov/29716999" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3V140-1", "protein_name": "Acrosin-binding protein", "gene_name": "Acrbp", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3V140", "url": "https://www.uniprot.org/uniprotkb/Q3V140" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.29716999", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]