[ { "title": "Mec1 is one of multiple kinases that prime the Mcm2-7 helicase for phosphorylation by Cdc7.", "journal": "Molecular cell", "date": "2010-11-12", "authors": "Randell John C W, Fan Andy, Chan Clara, Francis Laura I, Heller Ryan C, Galani Kyriaki, Bell Stephen P", "reference": { "type": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30665-1", "protein_name": "DNA replication licensing factor MCM4", "gene_name": "MCM4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53091-1", "protein_name": "DNA replication licensing factor MCM6", "gene_name": "MCM6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P24279-1", "protein_name": "DNA replication licensing factor MCM3", "gene_name": "MCM3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38132-1", "protein_name": "DNA replication licensing factor MCM7", "gene_name": "MCM7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P29469-1", "protein_name": "DNA replication licensing factor MCM2", "gene_name": "MCM2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30665", "url": "https://www.uniprot.org/uniprotkb/P30665" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 108, "end_pos": 108, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser108", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 112, "end_pos": 112, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser112", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 140, "end_pos": 140, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Thr140", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser141", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 145, "end_pos": 145, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "18321994", "url": "https://pubmed.ncbi.nlm.nih.gov/18321994" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser145", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser171", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 174, "end_pos": 174, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" } ], "site_lbl": "Ser174", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "18321994", "url": "https://pubmed.ncbi.nlm.nih.gov/18321994" } ], "site_lbl": "Ser17", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 31, "end_pos": 31, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Ser31", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 42, "end_pos": 42, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Ser42", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 52, "end_pos": 52, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P30665", "url": "https://www.uniprot.org/uniprotkb/P30665" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser52", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 56, "end_pos": 56, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P30665", "url": "https://www.uniprot.org/uniprotkb/P30665" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser56", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P30665", "url": "https://www.uniprot.org/uniprotkb/P30665" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "18321994", "url": "https://pubmed.ncbi.nlm.nih.gov/18321994" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser69", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "18321994", "url": "https://pubmed.ncbi.nlm.nih.gov/18321994" } ], "site_lbl": "Ser7", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 82, "end_pos": 82, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser82", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser87", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Ser19", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000003169", "url": "https://www.yeastgenome.org/locus/S000003169" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser227", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53091", "url": "https://www.uniprot.org/uniprotkb/P53091" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000003169", "url": "https://www.yeastgenome.org/locus/S000003169" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser249", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 37, "end_pos": 37, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Ser37", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 408, "end_pos": 408, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Thr408", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 49, "end_pos": 49, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Ser49", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 56, "end_pos": 56, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000003169", "url": "https://www.yeastgenome.org/locus/S000003169" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser56", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Thr66", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Ser70", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 78, "end_pos": 78, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53091", "url": "https://www.uniprot.org/uniprotkb/P53091" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000003169", "url": "https://www.yeastgenome.org/locus/S000003169" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser78", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Thr9", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 215, "end_pos": 215, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24279" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Thr215", "uniprot_canonical_ac": "P24279-1" }, { "start_pos": 751, "end_pos": 751, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24279" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000758", "url": "https://www.yeastgenome.org/locus/S000000758" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser751", "uniprot_canonical_ac": "P24279-1" }, { "start_pos": 765, "end_pos": 765, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24279" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Ser765", "uniprot_canonical_ac": "P24279-1" }, { "start_pos": 777, "end_pos": 777, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P24279", "url": "https://www.uniprot.org/uniprotkb/P24279" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "iPTMnet", "id": "P24279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24279" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000000758", "url": "https://www.yeastgenome.org/locus/S000000758" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser777", "uniprot_canonical_ac": "P24279-1" }, { "start_pos": 781, "end_pos": 781, "kinase_uniprot_canonical_ac": "P00546-1", "kinase_gene_name": "CDC28", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24279" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser781", "uniprot_canonical_ac": "P24279-1" }, { "start_pos": 781, "end_pos": 781, "kinase_uniprot_canonical_ac": "P24869-1", "kinase_gene_name": "CLB2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24279" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser781", "uniprot_canonical_ac": "P24279-1" }, { "start_pos": 791, "end_pos": 791, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24279" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000758", "url": "https://www.yeastgenome.org/locus/S000000758" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr791", "uniprot_canonical_ac": "P24279-1" }, { "start_pos": 794, "end_pos": 794, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24279" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000758", "url": "https://www.yeastgenome.org/locus/S000000758" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser794", "uniprot_canonical_ac": "P24279-1" }, { "start_pos": 801, "end_pos": 801, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24279" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000758", "url": "https://www.yeastgenome.org/locus/S000000758" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser801", "uniprot_canonical_ac": "P24279-1" }, { "start_pos": 824, "end_pos": 824, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24279" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000758", "url": "https://www.yeastgenome.org/locus/S000000758" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser824", "uniprot_canonical_ac": "P24279-1" }, { "start_pos": 845, "end_pos": 845, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P24279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24279" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000758", "url": "https://www.yeastgenome.org/locus/S000000758" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser845", "uniprot_canonical_ac": "P24279-1" }, { "start_pos": 868, "end_pos": 868, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P24279", "url": "https://www.uniprot.org/uniprotkb/P24279" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "iPTMnet", "id": "P24279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24279" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000758", "url": "https://www.yeastgenome.org/locus/S000000758" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr868", "uniprot_canonical_ac": "P24279-1" }, { "start_pos": 344, "end_pos": 344, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38132", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38132" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Ser344", "uniprot_canonical_ac": "P38132-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P38132", "url": "https://www.uniprot.org/uniprotkb/P38132" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "iPTMnet", "id": "P38132", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38132" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000406", "url": "https://www.yeastgenome.org/locus/S000000406" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr811", "uniprot_canonical_ac": "P38132-1" }, { "start_pos": 816, "end_pos": 816, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38132", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38132" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000406", "url": "https://www.yeastgenome.org/locus/S000000406" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser816", "uniprot_canonical_ac": "P38132-1" }, { "start_pos": 820, "end_pos": 820, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38132", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38132" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000406", "url": "https://www.yeastgenome.org/locus/S000000406" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr820", "uniprot_canonical_ac": "P38132-1" }, { "start_pos": 97, "end_pos": 97, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38132", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38132" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Thr97", "uniprot_canonical_ac": "P38132-1" }, { "start_pos": 105, "end_pos": 105, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P29469", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29469" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000119", "url": "https://www.yeastgenome.org/locus/S000000119" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser105", "uniprot_canonical_ac": "P29469-1" }, { "start_pos": 107, "end_pos": 107, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P29469", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29469" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Ser107", "uniprot_canonical_ac": "P29469-1" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P29469", "url": "https://www.uniprot.org/uniprotkb/P29469" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P29469", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29469" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000119", "url": "https://www.yeastgenome.org/locus/S000000119" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser14", "uniprot_canonical_ac": "P29469-1" }, { "start_pos": 164, "end_pos": 164, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P29469", "url": "https://www.uniprot.org/uniprotkb/P29469" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P29469", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29469" }, { "database": "PubMed", "id": "19692334", "url": "https://pubmed.ncbi.nlm.nih.gov/19692334" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "PubMed", "id": "22564307", "url": "https://pubmed.ncbi.nlm.nih.gov/22564307" }, { "database": "PubMed", "id": "26582917", "url": "https://pubmed.ncbi.nlm.nih.gov/26582917" }, { "database": "PubMed", "id": "28510759", "url": "https://pubmed.ncbi.nlm.nih.gov/28510759" }, { "database": "SGD", "id": "S000000119", "url": "https://www.yeastgenome.org/locus/S000000119" } ], "site_lbl": "Ser164", "uniprot_canonical_ac": "P29469-1" }, { "start_pos": 16, "end_pos": 16, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P29469", "url": "https://www.uniprot.org/uniprotkb/P29469" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P29469", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29469" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000000119", "url": "https://www.yeastgenome.org/locus/S000000119" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser16", "uniprot_canonical_ac": "P29469-1" }, { "start_pos": 170, "end_pos": 170, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P29469", "url": "https://www.uniprot.org/uniprotkb/P29469" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P29469", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29469" }, { "database": "PubMed", "id": "19692334", "url": "https://pubmed.ncbi.nlm.nih.gov/19692334" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "PubMed", "id": "22564307", "url": "https://pubmed.ncbi.nlm.nih.gov/22564307" }, { "database": "PubMed", "id": "26582917", "url": "https://pubmed.ncbi.nlm.nih.gov/26582917" }, { "database": "PubMed", "id": "28510759", "url": "https://pubmed.ncbi.nlm.nih.gov/28510759" }, { "database": "SGD", "id": "S000000119", "url": "https://www.yeastgenome.org/locus/S000000119" } ], "site_lbl": "Ser170", "uniprot_canonical_ac": "P29469-1" }, { "start_pos": 725, "end_pos": 725, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P29469", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29469" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" } ], "site_lbl": "Ser725", "uniprot_canonical_ac": "P29469-1" } ], "record_id": "pubmed.21070963", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 54 }, { "field": "total_sites", "count": 52 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural mechanism for the selective phosphorylation of DNA-loaded MCM double hexamers by the Dbf4-dependent kinase.", "journal": "Nature structural & molecular biology", "date": "2022-01", "authors": "Greiwe Julia F, Miller Thomas C R, Locke Julia, Martino Fabrizio, Howell Steven, Schreiber Anne, Nans Andrea, Diffley John F X, Costa Alessandro", "reference": { "type": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30665-1", "protein_name": "DNA replication licensing factor MCM4", "gene_name": "MCM4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53091-1", "protein_name": "DNA replication licensing factor MCM6", "gene_name": "MCM6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30665", "url": "https://www.uniprot.org/uniprotkb/P30665" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 108, "end_pos": 108, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser108", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 112, "end_pos": 112, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser112", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 118, "end_pos": 118, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Thr118", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 140, "end_pos": 140, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Thr140", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser141", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 144, "end_pos": 144, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser144", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser171", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 52, "end_pos": 52, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P30665", "url": "https://www.uniprot.org/uniprotkb/P30665" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser52", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 56, "end_pos": 56, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P30665", "url": "https://www.uniprot.org/uniprotkb/P30665" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser56", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 68, "end_pos": 68, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser68", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P30665", "url": "https://www.uniprot.org/uniprotkb/P30665" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "18321994", "url": "https://pubmed.ncbi.nlm.nih.gov/18321994" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser69", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser75", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 76, "end_pos": 76, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser76", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 82, "end_pos": 82, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser82", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30665", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30665" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000006223", "url": "https://www.yeastgenome.org/locus/S000006223" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser87", "uniprot_canonical_ac": "P30665-1" }, { "start_pos": 1016, "end_pos": 1016, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003169", "url": "https://www.yeastgenome.org/locus/S000003169" }, { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser1016", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 1017, "end_pos": 1017, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000003169", "url": "https://www.yeastgenome.org/locus/S000003169" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser1017", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003169", "url": "https://www.yeastgenome.org/locus/S000003169" }, { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 232, "end_pos": 232, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003169", "url": "https://www.yeastgenome.org/locus/S000003169" }, { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser232", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 234, "end_pos": 234, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003169", "url": "https://www.yeastgenome.org/locus/S000003169" }, { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser234", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003169", "url": "https://www.yeastgenome.org/locus/S000003169" }, { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Thr75", "uniprot_canonical_ac": "P53091-1" }, { "start_pos": 78, "end_pos": 78, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53091", "url": "https://www.uniprot.org/uniprotkb/P53091" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P53091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53091" }, { "database": "PubMed", "id": "21070963", "url": "https://pubmed.ncbi.nlm.nih.gov/21070963" }, { "database": "SGD", "id": "S000003169", "url": "https://www.yeastgenome.org/locus/S000003169" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34963704", "url": "https://pubmed.ncbi.nlm.nih.gov/34963704" } ], "site_lbl": "Ser78", "uniprot_canonical_ac": "P53091-1" } ], "record_id": "pubmed.34963704", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 23 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NAM7 nuclear gene encodes a novel member of a family of helicases with a Zn-ligand motif and is involved in mitochondrial functions in Saccharomyces cerevisiae.", "journal": "J. Mol. Biol.", "date": "1992", "authors": "Altamura N, Groudinsky O, Dujardin G, Slonimski P P", "reference": { "type": "PubMed", "id": "1314899", "url": "https://pubmed.ncbi.nlm.nih.gov/1314899" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30771-1", "protein_name": "ATP-dependent helicase NAM7", "gene_name": "NAM7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1314899", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gene products that promote mRNA turnover in Saccharomyces cerevisiae.", "journal": "Mol. Cell. Biol.", "date": "1992", "authors": "Leeds P, Wood J M, Lee B S, Culbertson M R", "reference": { "type": "PubMed", "id": "1569946", "url": "https://pubmed.ncbi.nlm.nih.gov/1569946" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30771-1", "protein_name": "ATP-dependent helicase NAM7", "gene_name": "NAM7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1569946", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and functional analysis of novel phosphorylation sites in the RNA surveillance protein Upf1.", "journal": "Nucleic acids research", "date": "2014-02", "authors": "Lasalde Clarivel, Rivera Andrea V, Le\u00f3n Alfredo J, Gonz\u00e1lez-Feliciano Jos\u00e9 A, Estrella Luis A, Rodr\u00edguez-Cruz Eva N, Correa Mar\u00eda E, Cajigas Iv\u00e1n J, Bracho Dina P, Vega Irving E, Wilkinson Miles F, Gonz\u00e1lez Carlos I", "reference": { "type": "PubMed", "id": "24198248", "url": "https://pubmed.ncbi.nlm.nih.gov/24198248" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30771-1", "protein_name": "ATP-dependent helicase NAM7", "gene_name": "NAM7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 738, "end_pos": 738, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30771", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30771" }, { "database": "PubMed", "id": "24198248", "url": "https://pubmed.ncbi.nlm.nih.gov/24198248" } ], "site_lbl": "Tyr738", "uniprot_canonical_ac": "P30771-1" }, { "start_pos": 742, "end_pos": 742, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30771", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30771" }, { "database": "PubMed", "id": "24198248", "url": "https://pubmed.ncbi.nlm.nih.gov/24198248" } ], "site_lbl": "Tyr742", "uniprot_canonical_ac": "P30771-1" }, { "start_pos": 748, "end_pos": 748, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30771", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30771" }, { "database": "PubMed", "id": "24198248", "url": "https://pubmed.ncbi.nlm.nih.gov/24198248" } ], "site_lbl": "Ser748", "uniprot_canonical_ac": "P30771-1" }, { "start_pos": 754, "end_pos": 754, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P30771", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30771" }, { "database": "PubMed", "id": "24198248", "url": "https://pubmed.ncbi.nlm.nih.gov/24198248" } ], "site_lbl": "Tyr754", "uniprot_canonical_ac": "P30771-1" } ], "record_id": "pubmed.24198248", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "UPF1-like helicase grip on nucleic acids dictates processivity.", "journal": "Nature communications", "date": "2018", "authors": "Kanaan J, Raj S, Decourty L, Saveanu C, Croquette V, Le Hir H", "reference": { "type": "PubMed", "id": "30218034", "url": "https://pubmed.ncbi.nlm.nih.gov/30218034" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30771-1", "protein_name": "ATP-dependent helicase NAM7", "gene_name": "NAM7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38935-1", "protein_name": "DNA-binding protein SMUBP-2", "gene_name": "IGHMBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92900-1", "protein_name": "Regulator of nonsense transcripts 1", "gene_name": "UPF1", "tax_name": "Human" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 484, "end_pos": 484, "sequence_org": "A", "sequence_mut": "H", "comment": "Decreased DNA binding, decreased helicase processivity.", "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" }, { "database": "PubMed", "id": "30218034", "url": "https://pubmed.ncbi.nlm.nih.gov/30218034" } ], "uniprot_canonical_ac": "P30771-1" }, { "start_pos": 484, "end_pos": 486, "sequence_org": "AKS", "sequence_mut": "HPA", "comment": "Decreased DNA binding, decreased helicase processivity, does not restore NMD in a yeast deletion mutant.", "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" }, { "database": "PubMed", "id": "30218034", "url": "https://pubmed.ncbi.nlm.nih.gov/30218034" } ], "uniprot_canonical_ac": "P30771-1" }, { "start_pos": 485, "end_pos": 485, "sequence_org": "K", "sequence_mut": "P", "comment": "Decreased DNA binding, decreased helicase processivity.", "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" }, { "database": "PubMed", "id": "30218034", "url": "https://pubmed.ncbi.nlm.nih.gov/30218034" } ], "uniprot_canonical_ac": "P30771-1" }, { "start_pos": 486, "end_pos": 486, "sequence_org": "S", "sequence_mut": "A", "comment": "No change in DNA binding or helicase processivity.", "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" }, { "database": "PubMed", "id": "30218034", "url": "https://pubmed.ncbi.nlm.nih.gov/30218034" } ], "uniprot_canonical_ac": "P30771-1" }, { "start_pos": 487, "end_pos": 487, "sequence_org": "R", "sequence_mut": "S", "comment": "Decreased DNA binding, decreased helicase processivity.", "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" }, { "database": "PubMed", "id": "30218034", "url": "https://pubmed.ncbi.nlm.nih.gov/30218034" } ], "uniprot_canonical_ac": "P30771-1" } ], "record_id": "pubmed.30218034", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification and characterization of the Upf1 protein: a factor involved in translation and mRNA degradation.", "journal": "RNA (New York, N.Y.)", "date": "1995-08", "authors": "Czaplinski K, Weng Y, Hagan K W, Peltz S W", "reference": { "type": "PubMed", "id": "7489520", "url": "https://pubmed.ncbi.nlm.nih.gov/7489520" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30771-1", "protein_name": "ATP-dependent helicase NAM7", "gene_name": "NAM7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 436, "end_pos": 436, "sequence_org": "K", "sequence_mut": "Q", "comment": "Loss of ATPase, DNA and RNA helicase activity, still binds RNA.", "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" }, { "database": "PubMed", "id": "7489520", "url": "https://pubmed.ncbi.nlm.nih.gov/7489520" }, { "database": "PubMed", "id": "8816461", "url": "https://pubmed.ncbi.nlm.nih.gov/8816461" } ], "uniprot_canonical_ac": "P30771-1" } ], "record_id": "pubmed.7489520", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The majority of yeast UPF1 co-localizes with polyribosomes in the cytoplasm.", "journal": "Mol. Biol. Cell", "date": "1995", "authors": "Atkin A L, Altamura N, Leeds P, Culbertson M R", "reference": { "type": "PubMed", "id": "7545033", "url": "https://pubmed.ncbi.nlm.nih.gov/7545033" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30771-1", "protein_name": "ATP-dependent helicase NAM7", "gene_name": "NAM7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7545033", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic and biochemical characterization of mutations in the ATPase and helicase regions of the Upf1 protein.", "journal": "Molecular and cellular biology", "date": "1996-10", "authors": "Weng Y, Czaplinski K, Peltz S W", "reference": { "type": "PubMed", "id": "8816461", "url": "https://pubmed.ncbi.nlm.nih.gov/8816461" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30771-1", "protein_name": "ATP-dependent helicase NAM7", "gene_name": "NAM7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38798-1", "protein_name": "Nonsense-mediated mRNA decay protein 2", "gene_name": "NMD2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 436, "end_pos": 436, "sequence_org": "K", "sequence_mut": "Q", "comment": "Loss of ATPase, DNA and RNA helicase activity, still binds RNA.", "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" }, { "database": "PubMed", "id": "7489520", "url": "https://pubmed.ncbi.nlm.nih.gov/7489520" }, { "database": "PubMed", "id": "8816461", "url": "https://pubmed.ncbi.nlm.nih.gov/8816461" } ], "uniprot_canonical_ac": "P30771-1" }, { "start_pos": 572, "end_pos": 573, "sequence_org": "DE", "sequence_mut": "AA", "comment": "Loss of ATPase and RNA helicase activity, binds RNA.", "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" }, { "database": "PubMed", "id": "8816461", "url": "https://pubmed.ncbi.nlm.nih.gov/8816461" } ], "uniprot_canonical_ac": "P30771-1" }, { "start_pos": 793, "end_pos": 794, "sequence_org": "RR", "sequence_mut": "AA", "comment": "Loss of ATPase and RNA helicase activity, loss of RNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" }, { "database": "PubMed", "id": "8816461", "url": "https://pubmed.ncbi.nlm.nih.gov/8816461" } ], "uniprot_canonical_ac": "P30771-1" }, { "start_pos": 793, "end_pos": 794, "sequence_org": "RR", "sequence_mut": "KK", "comment": "Wild-type nonsense suppression and mRNA turnover phenotypes in vivo, decreased ATPase and greatly decreased RNA helicase activity in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" }, { "database": "PubMed", "id": "8816461", "url": "https://pubmed.ncbi.nlm.nih.gov/8816461" } ], "uniprot_canonical_ac": "P30771-1" }, { "start_pos": 800, "end_pos": 801, "sequence_org": "TR", "sequence_mut": "AA", "comment": "Loss of ATPase and RNA helicase activity, loss of RNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" }, { "database": "PubMed", "id": "8816461", "url": "https://pubmed.ncbi.nlm.nih.gov/8816461" } ], "uniprot_canonical_ac": "P30771-1" } ], "record_id": "pubmed.8816461", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mof4-1 is an allele of the UPF1/IFS2 gene which affects both mRNA turnover and -1 ribosomal frameshifting efficiency.", "journal": "The EMBO journal", "date": "1996-10-15", "authors": "Cui Y, Dinman J D, Peltz S W", "reference": { "type": "PubMed", "id": "8896465", "url": "https://pubmed.ncbi.nlm.nih.gov/8896465" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30771-1", "protein_name": "ATP-dependent helicase NAM7", "gene_name": "NAM7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30771", "url": "https://www.uniprot.org/uniprotkb/P30771" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8896465", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The yeast nuclear gene MRF1 encodes a mitochondrial peptide chain release factor and cures several mitochondrial RNA splicing defects.", "journal": "Nucleic Acids Res.", "date": "1992", "authors": "Pel H J, Maat C, Rep M, Grivell L A", "reference": { "type": "PubMed", "id": "1475194", "url": "https://pubmed.ncbi.nlm.nih.gov/1475194" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30775-1", "protein_name": "Peptide chain release factor 1, mitochondrial", "gene_name": "MRF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P30777-1", "protein_name": "GPI mannosyltransferase 3", "gene_name": "GPI10", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30775", "url": "https://www.uniprot.org/uniprotkb/P30775" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1475194", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The yeast translation release factors Mrf1p and Sup45p (eRF1) are methylated, respectively, by the methyltransferases Mtq1p and Mtq2p.", "journal": "The Journal of biological chemistry", "date": "2006-02-03", "authors": "Polevoda Bogdan, Span Lisa, Sherman Fred", "reference": { "type": "PubMed", "id": "16321977", "url": "https://pubmed.ncbi.nlm.nih.gov/16321977" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30775-1", "protein_name": "Peptide chain release factor 1, mitochondrial", "gene_name": "MRF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03920-1", "protein_name": "eRF1 methyltransferase catalytic subunit MTQ2", "gene_name": "MTQ2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53944-1", "protein_name": "Mitochondrial MRF1 N(5)-glutamine methyltransferase MTQ1", "gene_name": "MTQ1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P12385-1", "protein_name": "Eukaryotic peptide chain release factor subunit 1", "gene_name": "SUP45", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30775", "url": "https://www.uniprot.org/uniprotkb/P30775" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16321977", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ATP synthase of yeast mitochondria. Characterization of subunit d and sequence analysis of the structural gene ATP7.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Norais N, Prome D, Velours J", "reference": { "type": "PubMed", "id": "1832157", "url": "https://pubmed.ncbi.nlm.nih.gov/1832157" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30902-1", "protein_name": "ATP synthase subunit d, mitochondrial", "gene_name": "ATP7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30902", "url": "https://www.uniprot.org/uniprotkb/P30902" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1832157", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequencing and analysis of 51.6 kilobases on the left arm of chromosome XI from Saccharomyces cerevisiae reveals 23 open reading frames including the FAS1 gene.", "journal": "Yeast", "date": "1993", "authors": "Wiemann S, Voss H, Schwager C, Rupp T, Stegemann J, Zimmermann J, Grothues D, Sensen C, Erfle H, Hewitt N", "reference": { "type": "PubMed", "id": "8154185", "url": "https://pubmed.ncbi.nlm.nih.gov/8154185" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30902-1", "protein_name": "ATP synthase subunit d, mitochondrial", "gene_name": "ATP7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32895-1", "protein_name": "Ribose-phosphate pyrophosphokinase 1", "gene_name": "PRS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34233-1", "protein_name": "Transcriptional regulatory protein ASH1", "gene_name": "ASH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36104-1", "protein_name": "COMPASS component SWD2", "gene_name": "SWD2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34232-1", "protein_name": "mRNA transport regulator MTR2", "gene_name": "MTR2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34237-1", "protein_name": "Protein CASP", "gene_name": "COY1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34239-1", "protein_name": "Protein LST4", "gene_name": "LST4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34240-1", "protein_name": "Zinc-regulated transporter 3", "gene_name": "ZRT3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34243-1", "protein_name": "DNA polymerase alpha-associated DNA helicase A", "gene_name": "HCS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32464-1", "protein_name": "Protein HYM1", "gene_name": "HYM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33204-1", "protein_name": "Actin-related protein 2/3 complex subunit 4", "gene_name": "ARC19", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32461-1", "protein_name": "2-(3-amino-3-carboxypropyl)histidine synthase subunit 2", "gene_name": "DPH2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34231-1", "protein_name": "Uncharacterized protein YKL187C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34234-1", "protein_name": "Protein LOT5", "gene_name": "LOT5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25296-1", "protein_name": "Calcineurin subunit B", "gene_name": "CNB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25502-1", "protein_name": "Proline utilization trans-activator", "gene_name": "PUT3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P05740-1", "protein_name": "Large ribosomal subunit protein uL22A", "gene_name": "RPL17A", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P06783-1", "protein_name": "Pheromone a factor receptor", "gene_name": "STE3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07149-1", "protein_name": "Fatty acid synthase subunit beta", "gene_name": "FAS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P08432-1", "protein_name": "Ornithine decarboxylase", "gene_name": "SPE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34230-1", "protein_name": "Peroxisomal long-chain fatty acid import protein 1", "gene_name": "PXA2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34241-1", "protein_name": "Nucleolar pre-ribosomal-associated protein 1", "gene_name": "URB1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30902", "url": "https://www.uniprot.org/uniprotkb/P30902" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8154185", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 22 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Targeting of malate synthase 1 to the peroxisomes of Saccharomyces cerevisiae cells depends on growth on oleic acid medium.", "journal": "European journal of biochemistry", "date": "2002-02", "authors": "Kunze Markus, Kragler Friedrich, Binder Maximilian, Hartig Andreas, Gurvitz Aner", "reference": { "type": "PubMed", "id": "11846793", "url": "https://pubmed.ncbi.nlm.nih.gov/11846793" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30952-1", "protein_name": "Malate synthase 1", "gene_name": "MLS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30952", "url": "https://www.uniprot.org/uniprotkb/P30952" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 552, "end_pos": 554, "sequence_org": "SKL", "sequence_mut": "", "comment": "Impairs the peroxisomal localitation and leads to both nuclear and cytosolic localization.", "evidence": [ { "database": "UniProtKB", "id": "P30952", "url": "https://www.uniprot.org/uniprotkb/P30952" }, { "database": "PubMed", "id": "11846793", "url": "https://pubmed.ncbi.nlm.nih.gov/11846793" } ], "uniprot_canonical_ac": "P30952-1" } ], "record_id": "pubmed.11846793", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differentially regulated malate synthase genes participate in carbon and nitrogen metabolism of S. cerevisiae.", "journal": "Nucleic acids research", "date": "1992-11-11", "authors": "Hartig A, Simon M M, Schuster T, Daugherty J R, Yoo H S, Cooper T G", "reference": { "type": "PubMed", "id": "1454530", "url": "https://pubmed.ncbi.nlm.nih.gov/1454530" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30952-1", "protein_name": "Malate synthase 1", "gene_name": "MLS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30952", "url": "https://www.uniprot.org/uniprotkb/P30952" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1454530", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence for domesticated and wild populations of Saccharomyces cerevisiae.", "journal": "PLoS genetics", "date": "2005-07", "authors": "Fay Justin C, Benavides Joseph A", "reference": { "type": "PubMed", "id": "16103919", "url": "https://pubmed.ncbi.nlm.nih.gov/16103919" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30952-1", "protein_name": "Malate synthase 1", "gene_name": "MLS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30952", "url": "https://www.uniprot.org/uniprotkb/P30952" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16103919", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pex9p is a new yeast peroxisomal import receptor for PTS1-containing proteins.", "journal": "J. Cell Sci.", "date": "2016", "authors": "Effelsberg Daniel, Cruz-Zaragoza Luis Daniel, Schliebs Wolfgang, Erdmann Ralf", "reference": { "type": "PubMed", "id": "27678487", "url": "https://pubmed.ncbi.nlm.nih.gov/27678487" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P30952-1", "protein_name": "Malate synthase 1", "gene_name": "MLS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04364-1", "protein_name": "Peroxisomal targeting signal receptor 9", "gene_name": "PEX9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P21826-1", "protein_name": "Malate synthase 2", "gene_name": "DAL7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53112-1", "protein_name": "Peroxisomal membrane protein PEX14", "gene_name": "PEX14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05568-1", "protein_name": "Peroxisome biogenesis factor 10", "gene_name": "PEX10", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P30952", "url": "https://www.uniprot.org/uniprotkb/P30952" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.27678487", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SNC1, a yeast homolog of the synaptic vesicle-associated membrane protein/synaptobrevin gene family: genetic interactions with the RAS and CAP genes.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1992", "authors": "Gerst J E, Rodgers L, Riggs M, Wigler M", "reference": { "type": "PubMed", "id": "1316605", "url": "https://pubmed.ncbi.nlm.nih.gov/1316605" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31109-1", "protein_name": "Synaptobrevin homolog 1", "gene_name": "SNC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31109", "url": "https://www.uniprot.org/uniprotkb/P31109" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1316605", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Swf1-dependent palmitoylation of the SNARE Tlg1 prevents its ubiquitination and degradation.", "journal": "The EMBO journal", "date": "2005-07-20", "authors": "Valdez-Taubas Javier, Pelham Hugh", "reference": { "type": "PubMed", "id": "15973437", "url": "https://pubmed.ncbi.nlm.nih.gov/15973437" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31109-1", "protein_name": "Synaptobrevin homolog 1", "gene_name": "SNC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31377-1", "protein_name": "Syntaxin-8", "gene_name": "SYN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33328-1", "protein_name": "Synaptobrevin homolog 2", "gene_name": "SNC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36096-1", "protein_name": "Transmembrane E3 ubiquitin-protein ligase 1", "gene_name": "TUL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04629-1", "protein_name": "Palmitoyltransferase SWF1", "gene_name": "SWF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12006-1", "protein_name": "Palmitoyltransferase PFA4", "gene_name": "PFA4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03322-1", "protein_name": "t-SNARE affecting a late Golgi compartment protein 1", "gene_name": "TLG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31109", "url": "https://www.uniprot.org/uniprotkb/P31109" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 164, "end_pos": 164, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q04629", "url": "https://www.uniprot.org/uniprotkb/Q04629" }, { "database": "PubMed", "id": "15973437", "url": "https://pubmed.ncbi.nlm.nih.gov/15973437" } ], "uniprot_canonical_ac": "Q04629-1" }, { "start_pos": 205, "end_pos": 206, "sequence_org": "CC", "sequence_mut": "LL", "comment": "Not palmitoylated, rapidly degraded in a TUL1-dependent manner.", "evidence": [ { "database": "UniProtKB", "id": "Q03322", "url": "https://www.uniprot.org/uniprotkb/Q03322" }, { "database": "PubMed", "id": "15973437", "url": "https://pubmed.ncbi.nlm.nih.gov/15973437" } ], "uniprot_canonical_ac": "Q03322-1" }, { "start_pos": 205, "end_pos": 206, "sequence_org": "CC", "sequence_mut": "SS", "comment": "Not palmitoylated, rapidly degraded in a TUL1-dependent manner.", "evidence": [ { "database": "UniProtKB", "id": "Q03322", "url": "https://www.uniprot.org/uniprotkb/Q03322" }, { "database": "PubMed", "id": "15973437", "url": "https://pubmed.ncbi.nlm.nih.gov/15973437" } ], "uniprot_canonical_ac": "Q03322-1" } ], "record_id": "pubmed.15973437", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cyclin-dependent kinase promotes formation of the synaptonemal complex in yeast meiosis.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2010-10", "authors": "Zhu Zhihui, Mori Saori, Oshiumi Hiroyuki, Matsuzaki Kenichiro, Shinohara Miki, Shinohara Akira", "reference": { "type": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31111-1", "protein_name": "Synaptonemal complex protein ZIP1", "gene_name": "ZIP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31111", "url": "https://www.uniprot.org/uniprotkb/P31111" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 763, "end_pos": 763, "kinase_uniprot_canonical_ac": "P00546-1", "kinase_gene_name": "CDC28", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" } ], "site_lbl": "Ser763", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 763, "end_pos": 763, "kinase_uniprot_canonical_ac": "P30283-1", "kinase_gene_name": "CLB5", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" } ], "site_lbl": "Ser763", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 763, "end_pos": 763, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002693", "url": "https://www.yeastgenome.org/locus/S000002693" }, { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "33502312", "url": "https://pubmed.ncbi.nlm.nih.gov/33502312" } ], "site_lbl": "Ser763", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 783, "end_pos": 783, "kinase_uniprot_canonical_ac": "P00546-1", "kinase_gene_name": "CDC28", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" } ], "site_lbl": "Ser783", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 783, "end_pos": 783, "kinase_uniprot_canonical_ac": "P30283-1", "kinase_gene_name": "CLB5", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" } ], "site_lbl": "Ser783", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 783, "end_pos": 783, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002693", "url": "https://www.yeastgenome.org/locus/S000002693" }, { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" } ], "site_lbl": "Ser783", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 828, "end_pos": 828, "kinase_uniprot_canonical_ac": "P00546-1", "kinase_gene_name": "CDC28", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" } ], "site_lbl": "Ser828", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 828, "end_pos": 828, "kinase_uniprot_canonical_ac": "P30283-1", "kinase_gene_name": "CLB5", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" } ], "site_lbl": "Ser828", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 828, "end_pos": 828, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002693", "url": "https://www.yeastgenome.org/locus/S000002693" }, { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" } ], "site_lbl": "Ser828", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 89, "end_pos": 89, "kinase_uniprot_canonical_ac": "P00546-1", "kinase_gene_name": "CDC28", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" } ], "site_lbl": "Ser89", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 89, "end_pos": 89, "kinase_uniprot_canonical_ac": "P30283-1", "kinase_gene_name": "CLB5", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" } ], "site_lbl": "Ser89", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 89, "end_pos": 89, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002693", "url": "https://www.yeastgenome.org/locus/S000002693" }, { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20825495", "url": "https://pubmed.ncbi.nlm.nih.gov/20825495" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser89", "uniprot_canonical_ac": "P31111-1" } ], "record_id": "pubmed.20825495", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Mec1- and PP4-dependent checkpoint couples centromere pairing to meiotic recombination.", "journal": "Developmental cell", "date": "2010-10-19", "authors": "Falk Jill E, Chan Andrew Chi-ho, Hoffmann Eva, Hochwagen Andreas", "reference": { "type": "PubMed", "id": "20951350", "url": "https://pubmed.ncbi.nlm.nih.gov/20951350" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31111-1", "protein_name": "Synaptonemal complex protein ZIP1", "gene_name": "ZIP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31111", "url": "https://www.uniprot.org/uniprotkb/P31111" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20951350", "url": "https://pubmed.ncbi.nlm.nih.gov/20951350" } ], "site_lbl": "Ser75", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20951350", "url": "https://pubmed.ncbi.nlm.nih.gov/20951350" } ], "site_lbl": "Ser75", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "20951350", "url": "https://pubmed.ncbi.nlm.nih.gov/20951350" } ], "site_lbl": "Ser75", "uniprot_canonical_ac": "P31111-1" } ], "record_id": "pubmed.20951350", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of the Synaptonemal Complex Protein Zip1 Regulates the Crossover/Noncrossover Decision during Yeast Meiosis.", "journal": "PLoS biology", "date": "2015-12", "authors": "Chen Xiangyu, Suhandynata Ray T, Sandhu Rima, Rockmill Beth, Mohibullah Neeman, Niu Hengyao, Liang Jason, Lo Hsiao-Chi, Miller Danny E, Zhou Huilin, B\u00f6rner G Valentin, Hollingsworth Nancy M", "reference": { "type": "PubMed", "id": "26682552", "url": "https://pubmed.ncbi.nlm.nih.gov/26682552" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31111-1", "protein_name": "Synaptonemal complex protein ZIP1", "gene_name": "ZIP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31111", "url": "https://www.uniprot.org/uniprotkb/P31111" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 815, "end_pos": 815, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "26682552", "url": "https://pubmed.ncbi.nlm.nih.gov/26682552" } ], "site_lbl": "Ser815", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 816, "end_pos": 816, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "26682552", "url": "https://pubmed.ncbi.nlm.nih.gov/26682552" } ], "site_lbl": "Ser816", "uniprot_canonical_ac": "P31111-1" }, { "start_pos": 818, "end_pos": 818, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31111" }, { "database": "PubMed", "id": "26682552", "url": "https://pubmed.ncbi.nlm.nih.gov/26682552" } ], "site_lbl": "Ser818", "uniprot_canonical_ac": "P31111-1" } ], "record_id": "pubmed.26682552", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZIP1 is a synaptonemal complex protein required for meiotic chromosome synapsis.", "journal": "Cell", "date": "1993", "authors": "Sym M, Engebrecht J A, Roeder G S", "reference": { "type": "PubMed", "id": "7916652", "url": "https://pubmed.ncbi.nlm.nih.gov/7916652" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31111-1", "protein_name": "Synaptonemal complex protein ZIP1", "gene_name": "ZIP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31111", "url": "https://www.uniprot.org/uniprotkb/P31111" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7916652", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A gene tightly linked to CEN6 is important for growth of Saccharomyces cerevisiae.", "journal": "Curr. Genet.", "date": "1991", "authors": "Carbone M L, Solinas M, Sora S, Panzeri L", "reference": { "type": "PubMed", "id": "2036682", "url": "https://pubmed.ncbi.nlm.nih.gov/2036682" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31115-1", "protein_name": "tRNA pseudouridine(38/39) synthase", "gene_name": "DEG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31115", "url": "https://www.uniprot.org/uniprotkb/P31115" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.2036682", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequencing of a 23 kb fragment from Saccharomyces cerevisiae chromosome VI.", "journal": "Yeast", "date": "1996", "authors": "Naitou M, Ozawa M, Sasanuma S I, Kobayashi M, Hagiwara H, Shibata T, Hanaoka F, Watanabe K, Ono A, Yamazaki M, Tashiro H, Eki T, Murakami Y", "reference": { "type": "PubMed", "id": "8789262", "url": "https://pubmed.ncbi.nlm.nih.gov/8789262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31115-1", "protein_name": "tRNA pseudouridine(38/39) synthase", "gene_name": "DEG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34077-1", "protein_name": "Nucleoporin NIC96", "gene_name": "NIC96", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43583-1", "protein_name": "Proteasome activator BLM10", "gene_name": "BLM10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40965-1", "protein_name": "MutS protein homolog 4", "gene_name": "MSH4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25808-1", "protein_name": "ATP-dependent rRNA helicase SPB4", "gene_name": "SPB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43586-1", "protein_name": "60S ribosomal subunit assembly/export protein LOC1", "gene_name": "LOC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07560-1", "protein_name": "Ras-related protein SEC4", "gene_name": "SEC4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43585-1", "protein_name": "Vacuolar transporter chaperone complex subunit 2", "gene_name": "VTC2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31115", "url": "https://www.uniprot.org/uniprotkb/P31115" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8789262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structures of homoserine dehydrogenase suggest a novel catalytic mechanism for oxidoreductases.", "journal": "Nature structural biology", "date": "2000-03", "authors": "DeLaBarre B, Thompson P R, Wright G D, Berghuis A M", "reference": { "type": "PubMed", "id": "10700284", "url": "https://pubmed.ncbi.nlm.nih.gov/10700284" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31116-1", "protein_name": "Homoserine dehydrogenase", "gene_name": "HOM6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 117, "end_pos": 117, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" }, { "database": "PubMed", "id": "10700284", "url": "https://pubmed.ncbi.nlm.nih.gov/10700284" } ], "uniprot_canonical_ac": "P31116-1" }, { "start_pos": 208, "end_pos": 208, "sequence_org": "E", "sequence_mut": "D", "comment": "Increases KM for aspartate-semialdehyde 48-fold and reduces kcat by 50%.", "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" }, { "database": "PubMed", "id": "10700284", "url": "https://pubmed.ncbi.nlm.nih.gov/10700284" } ], "uniprot_canonical_ac": "P31116-1" }, { "start_pos": 208, "end_pos": 208, "sequence_org": "E", "sequence_mut": "L", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" }, { "database": "PubMed", "id": "10700284", "url": "https://pubmed.ncbi.nlm.nih.gov/10700284" } ], "uniprot_canonical_ac": "P31116-1" }, { "start_pos": 208, "end_pos": 208, "sequence_org": "E", "sequence_mut": "Q", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" }, { "database": "PubMed", "id": "10700284", "url": "https://pubmed.ncbi.nlm.nih.gov/10700284" } ], "uniprot_canonical_ac": "P31116-1" }, { "start_pos": 219, "end_pos": 219, "sequence_org": "D", "sequence_mut": "L", "comment": "Reduces kcat 150-fold.", "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" }, { "database": "PubMed", "id": "10700284", "url": "https://pubmed.ncbi.nlm.nih.gov/10700284" } ], "uniprot_canonical_ac": "P31116-1" }, { "start_pos": 223, "end_pos": 223, "sequence_org": "K", "sequence_mut": "V", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" }, { "database": "PubMed", "id": "10700284", "url": "https://pubmed.ncbi.nlm.nih.gov/10700284" } ], "uniprot_canonical_ac": "P31116-1" } ], "record_id": "pubmed.10700284", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of yeast homoserine dehydrogenase, an antifungal target: the invariant histidine 309 is important for enzyme integrity.", "journal": "Biochimica et biophysica acta", "date": "2001-01-12", "authors": "Jacques S L, Nieman C, Bareich D, Broadhead G, Kinach R, Honek J F, Wright G D", "reference": { "type": "PubMed", "id": "11341914", "url": "https://pubmed.ncbi.nlm.nih.gov/11341914" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31116-1", "protein_name": "Homoserine dehydrogenase", "gene_name": "HOM6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 309, "end_pos": 309, "sequence_org": "H", "sequence_mut": "A", "comment": "Reduces kcat 40-fold. Affects dimer formation.", "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" }, { "database": "PubMed", "id": "11341914", "url": "https://pubmed.ncbi.nlm.nih.gov/11341914" } ], "uniprot_canonical_ac": "P31116-1" }, { "start_pos": 79, "end_pos": 79, "sequence_org": "H", "sequence_mut": "A", "comment": "Reduces kcat 2-fold.", "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" }, { "database": "PubMed", "id": "11341914", "url": "https://pubmed.ncbi.nlm.nih.gov/11341914" } ], "uniprot_canonical_ac": "P31116-1" } ], "record_id": "pubmed.11341914", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Enzyme-assisted suicide: molecular basis for the antifungal activity of 5-hydroxy-4-oxonorvaline by potent inhibition of homoserine dehydrogenase.", "journal": "Chem. Biol.", "date": "2003", "authors": "Jacques Suzanne L, Mirza I Ahmad, Ejim Linda, Koteva Kalinka, Hughes Donald W, Green Kirk, Kinach Robert, Honek John F, Lai Hoi Kiong, Berghuis Albert M, Wright Gerard D", "reference": { "type": "PubMed", "id": "14583265", "url": "https://pubmed.ncbi.nlm.nih.gov/14583265" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31116-1", "protein_name": "Homoserine dehydrogenase", "gene_name": "HOM6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14583265", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "New phenolic inhibitors of yeast homoserine dehydrogenase.", "journal": "Bioorg. Med. Chem.", "date": "2004", "authors": "Ejim Linda, Mirza I Ahmad, Capone Christina, Nazi Ishac, Jenkins Steve, Chee Gaik-Lean, Berghuis Albert M, Wright Gerard D", "reference": { "type": "PubMed", "id": "15210149", "url": "https://pubmed.ncbi.nlm.nih.gov/15210149" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31116-1", "protein_name": "Homoserine dehydrogenase", "gene_name": "HOM6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15210149", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The oligosaccharides in a recombinant hepatitis B virus surface antigen (HBsAg) carrying the pre-S2 region derived from yeast.", "journal": "FEBS letters", "date": "1992-05-11", "authors": "Kobayashi M, Ban J, Asano T, Utsunomiya M, Kusumoto S, Nishi K, Kato K", "reference": { "type": "PubMed", "id": "1633844", "url": "https://pubmed.ncbi.nlm.nih.gov/1633844" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31116-1", "protein_name": "Homoserine dehydrogenase", "gene_name": "HOM6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 29, "start_aa": "Ser", "end_pos": 29, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser29", "evidence": [ { "id": "1633844", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1633844" }, { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "P31116-1" } ], "record_id": "pubmed.1633844", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "Rapid purification and characterization of homoserine dehydrogenase from Saccharomyces cerevisiae.", "journal": "Arch. Biochem. Biophys.", "date": "1991", "authors": "Yumoto N, Kawata Y, Noda S, Tokushige M", "reference": { "type": "PubMed", "id": "1897932", "url": "https://pubmed.ncbi.nlm.nih.gov/1897932" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31116-1", "protein_name": "Homoserine dehydrogenase", "gene_name": "HOM6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1897932", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evolutionary relationships between yeast and bacterial homoserine dehydrogenases.", "journal": "FEBS Lett.", "date": "1993", "authors": "Thomas D, Barbey R, Surdin-Kerjan Y", "reference": { "type": "PubMed", "id": "8500624", "url": "https://pubmed.ncbi.nlm.nih.gov/8500624" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31116-1", "protein_name": "Homoserine dehydrogenase", "gene_name": "HOM6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31116", "url": "https://www.uniprot.org/uniprotkb/P31116" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8500624", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Determinants of enzymatic specificity in the Cys-Met-metabolism PLP-dependent enzymes family: crystal structure of cystathionine gamma-lyase from yeast and intrafamiliar structure comparison.", "journal": "Biol. Chem.", "date": "2003", "authors": "Messerschmidt Albrecht, Worbs Michael, Steegborn Clemens, Wahl Markus C, Huber Robert, Laber Bernd, Clausen Tim", "reference": { "type": "PubMed", "id": "12715888", "url": "https://pubmed.ncbi.nlm.nih.gov/12715888" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31373-1", "protein_name": "Cystathionine gamma-lyase", "gene_name": "CYS3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31373", "url": "https://www.uniprot.org/uniprotkb/P31373" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12715888", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of the CYS3 (CYI1) gene of Saccharomyces cerevisiae.", "journal": "Journal of bacteriology", "date": "1992-05", "authors": "Ono B, Tanaka K, Naito K, Heike C, Shinoda S, Yamamoto S, Ohmori S, Oshima T, Toh-e A", "reference": { "type": "PubMed", "id": "1577698", "url": "https://pubmed.ncbi.nlm.nih.gov/1577698" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31373-1", "protein_name": "Cystathionine gamma-lyase", "gene_name": "CYS3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31373", "url": "https://www.uniprot.org/uniprotkb/P31373" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1577698", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and bacterial expression of the CYS3 gene encoding cystathionine gamma-lyase of Saccharomyces cerevisiae and the physicochemical and enzymatic properties of the protein.", "journal": "Journal of bacteriology", "date": "1993-08", "authors": "Yamagata S, D'Andrea R J, Fujisaki S, Isaji M, Nakamura K", "reference": { "type": "PubMed", "id": "8335636", "url": "https://pubmed.ncbi.nlm.nih.gov/8335636" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31373-1", "protein_name": "Cystathionine gamma-lyase", "gene_name": "CYS3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31373", "url": "https://www.uniprot.org/uniprotkb/P31373" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8335636", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequencing of chromosome I from Saccharomyces cerevisiae: analysis of a 32 kb region between the LTE1 and SPO7 genes.", "journal": "Genome", "date": "1993", "authors": "Ouellette B F, Clark M W, Keng T, Storms R K, Zhong W, Zeng B, Fortin N, Delaney S, Barton A, Kaback D B", "reference": { "type": "PubMed", "id": "8458570", "url": "https://pubmed.ncbi.nlm.nih.gov/8458570" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31373-1", "protein_name": "Cystathionine gamma-lyase", "gene_name": "CYS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31374-1", "protein_name": "Serine/threonine-protein kinase PSK1", "gene_name": "PSK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31376-1", "protein_name": "SWR1-complex protein 3", "gene_name": "SWC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31377-1", "protein_name": "Syntaxin-8", "gene_name": "SYN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31378-1", "protein_name": "Endonuclease III homolog 1", "gene_name": "NTG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31380-1", "protein_name": "Chromatin remodeling protein FUN30", "gene_name": "FUN30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31382-1", "protein_name": "Dolichyl-phosphate-mannose--protein mannosyltransferase 2", "gene_name": "PMT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31383-1", "protein_name": "Protein phosphatase PP2A regulatory subunit A", "gene_name": "TPD3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31385-1", "protein_name": "Transcriptional regulatory protein DEP1", "gene_name": "DEP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P18409-1", "protein_name": "Mitochondrial distribution and morphology protein 10", "gene_name": "MDM10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31384-1", "protein_name": "CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4", "gene_name": "CCR4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31379-1", "protein_name": "Outer spore wall protein LDS1", "gene_name": "LDS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31381-1", "protein_name": "Nucleoside transporter FUN26", "gene_name": "FUN26", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31386-1", "protein_name": "Protein KTI13", "gene_name": "ATS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31373", "url": "https://www.uniprot.org/uniprotkb/P31373" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8458570", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Physical localization of yeast CYS3, a gene whose product resembles the rat gamma-cystathionase and Escherichia coli cystathionine gamma-synthase enzymes.", "journal": "Yeast", "date": "1993", "authors": "Barton A B, Kaback D B, Clark M W, Keng T, Ouellette B F, Storms R K, Zeng B, Zhong W, Fortin N, Delaney S", "reference": { "type": "PubMed", "id": "8511966", "url": "https://pubmed.ncbi.nlm.nih.gov/8511966" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31373-1", "protein_name": "Cystathionine gamma-lyase", "gene_name": "CYS3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31373", "url": "https://www.uniprot.org/uniprotkb/P31373" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8511966", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cystathionine gamma-lyase of Saccharomyces cerevisiae: structural gene and cystathionine gamma-synthase activity.", "journal": "Yeast", "date": "1993", "authors": "Ono B, Ishii N, Naito K, Miyoshi S, Shinoda S, Yamamoto S, Ohmori S", "reference": { "type": "PubMed", "id": "8511969", "url": "https://pubmed.ncbi.nlm.nih.gov/8511969" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31373-1", "protein_name": "Cystathionine gamma-lyase", "gene_name": "CYS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P06106-1", "protein_name": "Homocysteine/cysteine synthase", "gene_name": "MET17", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31373", "url": "https://www.uniprot.org/uniprotkb/P31373" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8511969", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coordinate regulation of sugar flux and translation by PAS kinase.", "journal": "Cell", "date": "2002-10-04", "authors": "Rutter Jared, Probst Brandon L, McKnight Steven L", "reference": { "type": "PubMed", "id": "12372297", "url": "https://pubmed.ncbi.nlm.nih.gov/12372297" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31374-1", "protein_name": "Serine/threonine-protein kinase PSK1", "gene_name": "PSK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32861-1", "protein_name": "UTP--glucose-1-phosphate uridylyltransferase", "gene_name": "UGP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38912-1", "protein_name": "Eukaryotic translation initiation factor 1A", "gene_name": "TIF11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08217-1", "protein_name": "Serine/threonine-protein kinase PSK2", "gene_name": "PSK2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25567-1", "protein_name": "RNA-binding protein SRO9", "gene_name": "SRO9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P27472-1", "protein_name": "Glycogen [starch] synthase isoform 2", "gene_name": "GSY2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P12962-1", "protein_name": "Cap-associated protein CAF20", "gene_name": "CAF20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31374", "url": "https://www.uniprot.org/uniprotkb/P31374" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32861", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32861" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "12372297", "url": "https://pubmed.ncbi.nlm.nih.gov/12372297" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17531808", "url": "https://pubmed.ncbi.nlm.nih.gov/17531808" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000001518", "url": "https://www.yeastgenome.org/locus/S000001518" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser11", "uniprot_canonical_ac": "P32861-1" }, { "start_pos": 125, "end_pos": 125, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38912", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38912" }, { "database": "PubMed", "id": "12372297", "url": "https://pubmed.ncbi.nlm.nih.gov/12372297" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000004873", "url": "https://www.yeastgenome.org/locus/S000004873" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser125", "uniprot_canonical_ac": "P38912-1" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P25567", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25567" }, { "database": "PubMed", "id": "12372297", "url": "https://pubmed.ncbi.nlm.nih.gov/12372297" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000000542", "url": "https://www.yeastgenome.org/locus/S000000542" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Thr69", "uniprot_canonical_ac": "P25567-1" }, { "start_pos": 71, "end_pos": 71, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P25567", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25567" }, { "database": "PubMed", "id": "12372297", "url": "https://pubmed.ncbi.nlm.nih.gov/12372297" }, { "database": "SGD", "id": "S000000542", "url": "https://www.yeastgenome.org/locus/S000000542" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr71", "uniprot_canonical_ac": "P25567-1" }, { "start_pos": 655, "end_pos": 655, "kinase_uniprot_canonical_ac": "P17157-1", "kinase_gene_name": "PHO85", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P27472", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27472" }, { "database": "PubMed", "id": "10490639", "url": "https://pubmed.ncbi.nlm.nih.gov/10490639" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "12372297", "url": "https://pubmed.ncbi.nlm.nih.gov/12372297" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "8226915", "url": "https://pubmed.ncbi.nlm.nih.gov/8226915" }, { "database": "PubMed", "id": "8754836", "url": "https://pubmed.ncbi.nlm.nih.gov/8754836" }, { "database": "PubMed", "id": "9584169", "url": "https://pubmed.ncbi.nlm.nih.gov/9584169" } ], "site_lbl": "Ser655", "uniprot_canonical_ac": "P27472-1" }, { "start_pos": 655, "end_pos": 655, "kinase_uniprot_canonical_ac": "P53124-1", "kinase_gene_name": "PCL10", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P27472", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27472" }, { "database": "PubMed", "id": "10490639", "url": "https://pubmed.ncbi.nlm.nih.gov/10490639" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "12372297", "url": "https://pubmed.ncbi.nlm.nih.gov/12372297" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "8226915", "url": "https://pubmed.ncbi.nlm.nih.gov/8226915" }, { "database": "PubMed", "id": "8754836", "url": "https://pubmed.ncbi.nlm.nih.gov/8754836" }, { "database": "PubMed", "id": "9584169", "url": "https://pubmed.ncbi.nlm.nih.gov/9584169" } ], "site_lbl": "Ser655", "uniprot_canonical_ac": "P27472-1" }, { "start_pos": 58, "end_pos": 58, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P12962", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12962" }, { "database": "PubMed", "id": "12372297", "url": "https://pubmed.ncbi.nlm.nih.gov/12372297" }, { "database": "SGD", "id": "S000005802", "url": "https://www.yeastgenome.org/locus/S000005802" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" } ], "site_lbl": "Ser58", "uniprot_canonical_ac": "P12962-1" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P12962", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12962" }, { "database": "PubMed", "id": "12372297", "url": "https://pubmed.ncbi.nlm.nih.gov/12372297" }, { "database": "SGD", "id": "S000005802", "url": "https://www.yeastgenome.org/locus/S000005802" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" } ], "site_lbl": "Ser59", "uniprot_canonical_ac": "P12962-1" } ], "record_id": "pubmed.12372297", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a Saccharomyces cerevisiae homolog of the SNF2 transcriptional regulator in the DNA sequence of an 8.6 kb region in the LTE1-CYS1 interval on the left arm of chromosome I.", "journal": "Yeast", "date": "1992", "authors": "Clark M W, Zhong W W, Keng T, Storms R K, Barton A, Kaback D B, Bussey H", "reference": { "type": "PubMed", "id": "1561836", "url": "https://pubmed.ncbi.nlm.nih.gov/1561836" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31374-1", "protein_name": "Serine/threonine-protein kinase PSK1", "gene_name": "PSK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31380-1", "protein_name": "Chromatin remodeling protein FUN30", "gene_name": "FUN30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31379-1", "protein_name": "Outer spore wall protein LDS1", "gene_name": "LDS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31386-1", "protein_name": "Protein KTI13", "gene_name": "ATS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31374", "url": "https://www.uniprot.org/uniprotkb/P31374" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1561836", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of glucose partitioning by PAS kinase and Ugp1 phosphorylation.", "journal": "Molecular cell", "date": "2007-05-25", "authors": "Smith Tammy L, Rutter Jared", "reference": { "type": "PubMed", "id": "17531808", "url": "https://pubmed.ncbi.nlm.nih.gov/17531808" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31374-1", "protein_name": "Serine/threonine-protein kinase PSK1", "gene_name": "PSK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32861-1", "protein_name": "UTP--glucose-1-phosphate uridylyltransferase", "gene_name": "UGP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08217-1", "protein_name": "Serine/threonine-protein kinase PSK2", "gene_name": "PSK2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31374", "url": "https://www.uniprot.org/uniprotkb/P31374" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32861", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32861" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "12372297", "url": "https://pubmed.ncbi.nlm.nih.gov/12372297" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17531808", "url": "https://pubmed.ncbi.nlm.nih.gov/17531808" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000001518", "url": "https://www.yeastgenome.org/locus/S000001518" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser11", "uniprot_canonical_ac": "P32861-1" } ], "record_id": "pubmed.17531808", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The YAL017 gene on the left arm of chromosome I of Saccharomyces cerevisiae encodes a putative serine/threonine protein kinase.", "journal": "Yeast (Chichester, England)", "date": "1993-05", "authors": "Clark M W, Zhong W W, Keng T, Storms R K, Ouellette B F, Barton A, Kaback D B, Bussey H", "reference": { "type": "PubMed", "id": "8322517", "url": "https://pubmed.ncbi.nlm.nih.gov/8322517" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31374-1", "protein_name": "Serine/threonine-protein kinase PSK1", "gene_name": "PSK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31374", "url": "https://www.uniprot.org/uniprotkb/P31374" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8322517", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A new yeast endosomal SNARE related to mammalian syntaxin 8.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2002-12", "authors": "Lewis Michael J, Pelham Hugh R B", "reference": { "type": "PubMed", "id": "12453154", "url": "https://pubmed.ncbi.nlm.nih.gov/12453154" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31377-1", "protein_name": "Syntaxin-8", "gene_name": "SYN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04338-1", "protein_name": "t-SNARE VTI1", "gene_name": "VTI1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31377", "url": "https://www.uniprot.org/uniprotkb/P31377" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12453154", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: analysis of the genes in the FUN38-MAK16-SPO7 region.", "journal": "J. Bacteriol.", "date": "1994", "authors": "Barton A B, Kaback D B", "reference": { "type": "PubMed", "id": "8144453", "url": "https://pubmed.ncbi.nlm.nih.gov/8144453" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31377-1", "protein_name": "Syntaxin-8", "gene_name": "SYN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31378-1", "protein_name": "Endonuclease III homolog 1", "gene_name": "NTG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31380-1", "protein_name": "Chromatin remodeling protein FUN30", "gene_name": "FUN30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31383-1", "protein_name": "Protein phosphatase PP2A regulatory subunit A", "gene_name": "TPD3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31385-1", "protein_name": "Transcriptional regulatory protein DEP1", "gene_name": "DEP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31384-1", "protein_name": "CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4", "gene_name": "CCR4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31386-1", "protein_name": "Protein KTI13", "gene_name": "ATS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31377", "url": "https://www.uniprot.org/uniprotkb/P31377" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8144453", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oxidative DNA damage causes mitochondrial genomic instability in Saccharomyces cerevisiae.", "journal": "Mol. Cell. Biol.", "date": "2005", "authors": "Doudican Nicole A, Song Binwei, Shadel Gerald S, Doetsch Paul W", "reference": { "type": "PubMed", "id": "15923634", "url": "https://pubmed.ncbi.nlm.nih.gov/15923634" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31378-1", "protein_name": "Endonuclease III homolog 1", "gene_name": "NTG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07271-1", "protein_name": "ATP-dependent DNA helicase PIF1", "gene_name": "PIF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31378", "url": "https://www.uniprot.org/uniprotkb/P31378" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15923634", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ntg1p, the base excision repair protein, generates mutagenic intermediates in yeast mitochondrial DNA.", "journal": "DNA Repair", "date": "2006", "authors": "Phadnis Naina, Mehta Reema, Meednu Nida, Sia Elaine A", "reference": { "type": "PubMed", "id": "16730479", "url": "https://pubmed.ncbi.nlm.nih.gov/16730479" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31378-1", "protein_name": "Endonuclease III homolog 1", "gene_name": "NTG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31378", "url": "https://www.uniprot.org/uniprotkb/P31378" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16730479", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reactive oxygen species regulate DNA copy number in isolated yeast mitochondria by triggering recombination-mediated replication.", "journal": "Nucleic acids research", "date": "2009-02", "authors": "Hori Akiko, Yoshida Minoru, Shibata Takehiko, Ling Feng", "reference": { "type": "PubMed", "id": "19074198", "url": "https://pubmed.ncbi.nlm.nih.gov/19074198" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31378-1", "protein_name": "Endonuclease III homolog 1", "gene_name": "NTG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31378", "url": "https://www.uniprot.org/uniprotkb/P31378" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.19074198", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of base excision repair: Ntg1 nuclear and mitochondrial dynamic localization in response to genotoxic stress.", "journal": "Nucleic acids research", "date": "2010-07", "authors": "Swartzlander Dan B, Griffiths Lyra M, Lee Joan, Degtyareva Natalya P, Doetsch Paul W, Corbett Anita H", "reference": { "type": "PubMed", "id": "20194111", "url": "https://pubmed.ncbi.nlm.nih.gov/20194111" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31378-1", "protein_name": "Endonuclease III homolog 1", "gene_name": "NTG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31378", "url": "https://www.uniprot.org/uniprotkb/P31378" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 15, "end_pos": 16, "sequence_org": "KR", "sequence_mut": "AA", "comment": "In NTG1(nls1); reduces nuclear localization by 60%.", "evidence": [ { "database": "UniProtKB", "id": "P31378", "url": "https://www.uniprot.org/uniprotkb/P31378" }, { "database": "PubMed", "id": "20194111", "url": "https://pubmed.ncbi.nlm.nih.gov/20194111" } ], "uniprot_canonical_ac": "P31378-1" }, { "start_pos": 243, "end_pos": 243, "sequence_org": "K", "sequence_mut": "Q", "comment": "Abolishes cleavage of substrate oligonucleotides.", "evidence": [ { "database": "UniProtKB", "id": "P31378", "url": "https://www.uniprot.org/uniprotkb/P31378" }, { "database": "PubMed", "id": "20194111", "url": "https://pubmed.ncbi.nlm.nih.gov/20194111" } ], "uniprot_canonical_ac": "P31378-1" }, { "start_pos": 33, "end_pos": 34, "sequence_org": "KR", "sequence_mut": "AA", "comment": "In NTG1(nls2); reduces nuclear localization by 60%.", "evidence": [ { "database": "UniProtKB", "id": "P31378", "url": "https://www.uniprot.org/uniprotkb/P31378" }, { "database": "PubMed", "id": "20194111", "url": "https://pubmed.ncbi.nlm.nih.gov/20194111" } ], "uniprot_canonical_ac": "P31378-1" }, { "start_pos": 3, "end_pos": 6, "sequence_org": "KISK", "sequence_mut": "EISE", "comment": "In NTG1(mts); reduces mitochondrial localization by 40%.", "evidence": [ { "database": "UniProtKB", "id": "P31378", "url": "https://www.uniprot.org/uniprotkb/P31378" }, { "database": "PubMed", "id": "20194111", "url": "https://pubmed.ncbi.nlm.nih.gov/20194111" } ], "uniprot_canonical_ac": "P31378-1" } ], "record_id": "pubmed.20194111", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of a yeast 8-oxoguanine DNA glycosylase reveals the existence of a base-excision DNA-repair protein superfamily.", "journal": "Current biology : CB", "date": "1996-08-01", "authors": "Nash H M, Bruner S D, Sch\u00e4rer O D, Kawate T, Addona T A, Spooner E, Lane W S, Verdine G L", "reference": { "type": "PubMed", "id": "8805338", "url": "https://pubmed.ncbi.nlm.nih.gov/8805338" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31378-1", "protein_name": "Endonuclease III homolog 1", "gene_name": "NTG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31378", "url": "https://www.uniprot.org/uniprotkb/P31378" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8805338", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Base excision of oxidative purine and pyrimidine DNA damage in Saccharomyces cerevisiae by a DNA glycosylase with sequence similarity to endonuclease III from Escherichia coli.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996-10-01", "authors": "Eide L, Bj\u00f8r\u00e5s M, Pirovano M, Alseth I, Berdal K G, Seeberg E", "reference": { "type": "PubMed", "id": "8855249", "url": "https://pubmed.ncbi.nlm.nih.gov/8855249" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31378-1", "protein_name": "Endonuclease III homolog 1", "gene_name": "NTG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31378", "url": "https://www.uniprot.org/uniprotkb/P31378" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8855249", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Repair of oxidatively damaged guanine in Saccharomyces cerevisiae by an alternative pathway.", "journal": "Current biology : CB", "date": "1998-03-26", "authors": "Bruner S D, Nash H M, Lane W S, Verdine G L", "reference": { "type": "PubMed", "id": "9545197", "url": "https://pubmed.ncbi.nlm.nih.gov/9545197" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31378-1", "protein_name": "Endonuclease III homolog 1", "gene_name": "NTG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31378", "url": "https://www.uniprot.org/uniprotkb/P31378" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9545197", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The SNF2-family member Fun30 promotes gene silencing in heterochromatic loci.", "journal": "PloS one", "date": "2009-12-01", "authors": "Neves-Costa Ana, Will W Ryan, Vetter Anna T, Miller J Ross, Varga-Weisz Patrick", "reference": { "type": "PubMed", "id": "19956593", "url": "https://pubmed.ncbi.nlm.nih.gov/19956593" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31380-1", "protein_name": "Chromatin remodeling protein FUN30", "gene_name": "FUN30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P50874-1", "protein_name": "Origin recognition complex subunit 5", "gene_name": "ORC5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31380", "url": "https://www.uniprot.org/uniprotkb/P31380" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 603, "end_pos": 603, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of marker silencing in HMR, the silent mating-type locus. Abolishes both the silencing function and the ability to promote DNA end resection of double-strand breaks (DSBs).", "evidence": [ { "database": "UniProtKB", "id": "P31380", "url": "https://www.uniprot.org/uniprotkb/P31380" }, { "database": "PubMed", "id": "19956593", "url": "https://pubmed.ncbi.nlm.nih.gov/19956593" }, { "database": "PubMed", "id": "22960744", "url": "https://pubmed.ncbi.nlm.nih.gov/22960744" } ], "uniprot_canonical_ac": "P31380-1" }, { "start_pos": 73, "end_pos": 111, "sequence_org": "VALVNLAREFPDFSQTLVQAVFKSNSFNLQSARERLTRL", "sequence_mut": "", "comment": "Decreased marker silencing in HMR, the silent mating-type locus.", "evidence": [ { "database": "UniProtKB", "id": "P31380", "url": "https://www.uniprot.org/uniprotkb/P31380" }, { "database": "PubMed", "id": "19956593", "url": "https://pubmed.ncbi.nlm.nih.gov/19956593" } ], "uniprot_canonical_ac": "P31380-1" } ], "record_id": "pubmed.19956593", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Snf2 homolog Fun30 acts as a homodimeric ATP-dependent chromatin-remodeling enzyme.", "journal": "The Journal of biological chemistry", "date": "2010-03-26", "authors": "Awad Salma, Ryan Daniel, Prochasson Philippe, Owen-Hughes Tom, Hassan Ahmed H", "reference": { "type": "PubMed", "id": "20075079", "url": "https://pubmed.ncbi.nlm.nih.gov/20075079" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31380-1", "protein_name": "Chromatin remodeling protein FUN30", "gene_name": "FUN30", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31380", "url": "https://www.uniprot.org/uniprotkb/P31380" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.20075079", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Fun30 nucleosome remodeller promotes resection of DNA double-strand break ends.", "journal": "Nature", "date": "2012-09-27", "authors": "Chen Xuefeng, Cui Dandan, Papusha Alma, Zhang Xiaotian, Chu Chia-Dwo, Tang Jiangwu, Chen Kaifu, Pan Xuewen, Ira Grzegorz", "reference": { "type": "PubMed", "id": "22960743", "url": "https://pubmed.ncbi.nlm.nih.gov/22960743" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31380-1", "protein_name": "Chromatin remodeling protein FUN30", "gene_name": "FUN30", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31380", "url": "https://www.uniprot.org/uniprotkb/P31380" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.22960743", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The yeast Fun30 and human SMARCAD1 chromatin remodellers promote DNA end resection.", "journal": "Nature", "date": "2012-09-27", "authors": "Costelloe Thomas, Louge Rapha\u00ebl, Tomimatsu Nozomi, Mukherjee Bipasha, Martini Emmanuelle, Khadaroo Basheer, Dubois Kenny, Wiegant Wouter W, Thierry Agn\u00e8s, Burma Sandeep, van Attikum Haico, Llorente Bertrand", "reference": { "type": "PubMed", "id": "22960744", "url": "https://pubmed.ncbi.nlm.nih.gov/22960744" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31380-1", "protein_name": "Chromatin remodeling protein FUN30", "gene_name": "FUN30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9H4L7-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1", "gene_name": "SMARCAD1", "tax_name": "Human" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31380", "url": "https://www.uniprot.org/uniprotkb/P31380" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 603, "end_pos": 603, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of marker silencing in HMR, the silent mating-type locus. Abolishes both the silencing function and the ability to promote DNA end resection of double-strand breaks (DSBs).", "evidence": [ { "database": "UniProtKB", "id": "P31380", "url": "https://www.uniprot.org/uniprotkb/P31380" }, { "database": "PubMed", "id": "19956593", "url": "https://pubmed.ncbi.nlm.nih.gov/19956593" }, { "database": "PubMed", "id": "22960744", "url": "https://pubmed.ncbi.nlm.nih.gov/22960744" } ], "uniprot_canonical_ac": "P31380-1" } ], "record_id": "pubmed.22960744", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Saccharomyces cerevisiae chromatin remodeler Fun30 regulates DNA end resection and checkpoint deactivation.", "journal": "Molecular and cellular biology", "date": "2012-11", "authors": "Eapen Vinay V, Sugawara Neal, Tsabar Michael, Wu Wei-Hua, Haber James E", "reference": { "type": "PubMed", "id": "23007155", "url": "https://pubmed.ncbi.nlm.nih.gov/23007155" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31380-1", "protein_name": "Chromatin remodeling protein FUN30", "gene_name": "FUN30", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31380", "url": "https://www.uniprot.org/uniprotkb/P31380" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.23007155", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SWI/SNF-like chromatin remodeling factor Fun30 supports point centromere function in S. cerevisiae.", "journal": "PLoS genetics", "date": "2012-09", "authors": "Durand-Dubief Micka\u00ebl, Will William Ryan, Petrini Edoardo, Theodorou Delphine, Harris Rachael R, Crawford Margaret R, Paszkiewicz Konrad, Krueger Felix, Correra Rosa Maria, Vetter Anna T, Miller J Ross, Kent Nicholas A, Varga-Weisz Patrick", "reference": { "type": "PubMed", "id": "23028372", "url": "https://pubmed.ncbi.nlm.nih.gov/23028372" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31380-1", "protein_name": "Chromatin remodeling protein FUN30", "gene_name": "FUN30", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31380", "url": "https://www.uniprot.org/uniprotkb/P31380" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.23028372", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of the ATPase-C domain of the chromatin remodeller Fun30 from Saccharomyces cerevisiae.", "journal": "Acta Crystallogr. F Struct. Biol. Commun.", "date": "2017", "authors": "Liu L., Jiang T.", "reference": { "type": "PubMed", "id": "28045388", "url": "https://pubmed.ncbi.nlm.nih.gov/28045388" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31380-1", "protein_name": "Chromatin remodeling protein FUN30", "gene_name": "FUN30", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31380", "url": "https://www.uniprot.org/uniprotkb/P31380" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.28045388", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Roles of O-mannosylation of aberrant proteins in reduction of the load for endoplasmic reticulum chaperones in yeast.", "journal": "The Journal of biological chemistry", "date": "2004-11-26", "authors": "Nakatsukasa Kunio, Okada Shigeo, Umebayashi Kyohei, Fukuda Ryoichi, Nishikawa Shuh-Ichi, Endo Toshiya", "reference": { "type": "PubMed", "id": "15377669", "url": "https://pubmed.ncbi.nlm.nih.gov/15377669" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31382-1", "protein_name": "Dolichyl-phosphate-mannose--protein mannosyltransferase 2", "gene_name": "PMT2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31382", "url": "https://www.uniprot.org/uniprotkb/P31382" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15377669", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein O-mannosyltransferases participate in ER protein quality control.", "journal": "Journal of cell science", "date": "2011-01-01", "authors": "Goder Veit, Melero Alejandro", "reference": { "type": "PubMed", "id": "21147851", "url": "https://pubmed.ncbi.nlm.nih.gov/21147851" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31382-1", "protein_name": "Dolichyl-phosphate-mannose--protein mannosyltransferase 2", "gene_name": "PMT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33775-1", "protein_name": "Dolichyl-phosphate-mannose--protein mannosyltransferase 1", "gene_name": "PMT1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31382", "url": "https://www.uniprot.org/uniprotkb/P31382" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.21147851", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein O-glycosylation in yeast. The PMT2 gene specifies a second protein O-mannosyltransferase that functions in addition to the PMT1-encoded activity.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Lussier M, Gentzsch M, Sdicu A M, Bussey H, Tanner W", "reference": { "type": "PubMed", "id": "7852348", "url": "https://pubmed.ncbi.nlm.nih.gov/7852348" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31382-1", "protein_name": "Dolichyl-phosphate-mannose--protein mannosyltransferase 2", "gene_name": "PMT2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31382", "url": "https://www.uniprot.org/uniprotkb/P31382" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7852348", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein O-glycosylation in Saccharomyces cerevisiae: the protein O-mannosyltransferases Pmt1p and Pmt2p function as heterodimer.", "journal": "FEBS letters", "date": "1995-12-18", "authors": "Gentzsch M, Immervoll T, Tanner W", "reference": { "type": "PubMed", "id": "8543034", "url": "https://pubmed.ncbi.nlm.nih.gov/8543034" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31382-1", "protein_name": "Dolichyl-phosphate-mannose--protein mannosyltransferase 2", "gene_name": "PMT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33775-1", "protein_name": "Dolichyl-phosphate-mannose--protein mannosyltransferase 1", "gene_name": "PMT1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31382", "url": "https://www.uniprot.org/uniprotkb/P31382" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8543034", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inactivation of the protein phosphatase 2A regulatory subunit A results in morphological and transcriptional defects in Saccharomyces cerevisiae.", "journal": "Mol. Cell. Biol.", "date": "1992", "authors": "van Zyl W, Huang W, Sneddon A A, Stark M, Camier S, Werner M, Marck C, Sentenac A, Broach J R", "reference": { "type": "PubMed", "id": "1328868", "url": "https://pubmed.ncbi.nlm.nih.gov/1328868" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31383-1", "protein_name": "Protein phosphatase PP2A regulatory subunit A", "gene_name": "TPD3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31383", "url": "https://www.uniprot.org/uniprotkb/P31383" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1328868", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of a mutant of Saccharomyces cerevisiae with pleiotropic deficiencies in transcriptional activation and repression.", "journal": "Genetics", "date": "1994-05", "authors": "Lamping E, L\u00fcckl J, Paltauf F, Henry S A, Kohlwein S D", "reference": { "type": "PubMed", "id": "8056324", "url": "https://pubmed.ncbi.nlm.nih.gov/8056324" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31385-1", "protein_name": "Transcriptional regulatory protein DEP1", "gene_name": "DEP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31385", "url": "https://www.uniprot.org/uniprotkb/P31385" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8056324", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct evidence for the intracellular localization of Hsp104 in Saccharomyces cerevisiae by immunoelectron microscopy.", "journal": "Cell Stress Chaperones", "date": "1999", "authors": "Kawai R, Fujita K, Iwahashi H, Komatsu Y", "reference": { "type": "PubMed", "id": "10467108", "url": "https://pubmed.ncbi.nlm.nih.gov/10467108" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10467108", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rnq1: an epigenetic modifier of protein function in yeast.", "journal": "Molecular cell", "date": "2000-01", "authors": "Sondheimer N, Lindquist S", "reference": { "type": "PubMed", "id": "10678178", "url": "https://pubmed.ncbi.nlm.nih.gov/10678178" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25367-1", "protein_name": "[PIN+] prion protein RNQ1", "gene_name": "RNQ1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10678178", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[URE3] prion propagation in Saccharomyces cerevisiae: requirement for chaperone Hsp104 and curing by overexpressed chaperone Ydj1p.", "journal": "Molecular and cellular biology", "date": "2000-12", "authors": "Moriyama H, Edskes H K, Wickner R B", "reference": { "type": "PubMed", "id": "11073991", "url": "https://pubmed.ncbi.nlm.nih.gov/11073991" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23202-1", "protein_name": "Transcriptional regulator URE2", "gene_name": "URE2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11073991", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Subunit interactions influence the biochemical and biological properties of Hsp104.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001-01-30", "authors": "Schirmer E C, Ware D M, Queitsch C, Kowal A S, Lindquist S L", "reference": { "type": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 217, "end_pos": 217, "sequence_org": "G", "sequence_mut": "S", "comment": "Largely reduces ATP hydrolysis. Alters bud morphology and causes septin mislocalization; when associated with I-499.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "14978213", "url": "https://pubmed.ncbi.nlm.nih.gov/14978213" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 217, "end_pos": 217, "sequence_org": "G", "sequence_mut": "V", "comment": "Completely abolishes ATP hydrolysis.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "14978213", "url": "https://pubmed.ncbi.nlm.nih.gov/14978213" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 218, "end_pos": 218, "sequence_org": "K", "sequence_mut": "T", "comment": "Abolishes substrate binding. Unable to confer thermotolerance. Reduces ATP hydrolysis by 98%; when associated with T-315. Completely abolishes ATPase activity; when associated with T-620.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 619, "end_pos": 619, "sequence_org": "G", "sequence_mut": "V", "comment": "Impairs oligomerization at low protein concentrations.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 620, "end_pos": 620, "sequence_org": "K", "sequence_mut": "T", "comment": "Impairs oligomerization at low protein concentrations. Reduces ATP hydrolysis rate. Unable to confer thermotolerance. Completely abolishes ATPase activity; when associated with T-218.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 621, "end_pos": 621, "sequence_org": "T", "sequence_mut": "A", "comment": "Reduces ATP hydrolysis, but does not affect oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.11158570", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Guanidine hydrochloride inhibits Hsp104 activity in vivo: a possible explanation for its effect in curing yeast prions.", "journal": "Current microbiology", "date": "2001-07", "authors": "Jung G, Masison D C", "reference": { "type": "PubMed", "id": "11375656", "url": "https://pubmed.ncbi.nlm.nih.gov/11375656" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11375656", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The elimination of the yeast [PSI+] prion by guanidine hydrochloride is the result of Hsp104 inactivation.", "journal": "Molecular microbiology", "date": "2001-06", "authors": "Ferreira P C, Ness F, Edwards S R, Cox B S, Tuite M F", "reference": { "type": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 218, "end_pos": 218, "sequence_org": "K", "sequence_mut": "T", "comment": "Abolishes substrate binding. Unable to confer thermotolerance. Reduces ATP hydrolysis by 98%; when associated with T-315. Completely abolishes ATPase activity; when associated with T-620.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 620, "end_pos": 620, "sequence_org": "K", "sequence_mut": "T", "comment": "Impairs oligomerization at low protein concentrations. Reduces ATP hydrolysis rate. Unable to confer thermotolerance. Completely abolishes ATPase activity; when associated with T-218.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.11442834", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hsp104 interacts with Hsp90 cochaperones in respiring yeast.", "journal": "Mol. Cell. Biol.", "date": "2001", "authors": "Abbas-Terki T, Donz\u00e9 O, Briand P A, Picard D", "reference": { "type": "PubMed", "id": "11604493", "url": "https://pubmed.ncbi.nlm.nih.gov/11604493" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11604493", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cooperative kinetics of both Hsp104 ATPase domains and interdomain communication revealed by AAA sensor-1 mutants.", "journal": "The EMBO journal", "date": "2002-01-15", "authors": "Hattendorf Douglas A, Lindquist Susan L", "reference": { "type": "PubMed", "id": "11782421", "url": "https://pubmed.ncbi.nlm.nih.gov/11782421" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 317, "end_pos": 317, "sequence_org": "T", "sequence_mut": "A", "comment": "Reduces rate of ATP hydrolysis at NBD1 nearly 10-fold. No effect on oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11782421", "url": "https://pubmed.ncbi.nlm.nih.gov/11782421" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 728, "end_pos": 728, "sequence_org": "N", "sequence_mut": "A", "comment": "Almost completely abolishes ATP hydrolysis at NBD2, but does not affect nucleotide binding, thus keeping NBD2 in an ATP-bound state. Reduces stimulation of ATP hydrolysis upon substrate binding.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "18160044", "url": "https://pubmed.ncbi.nlm.nih.gov/18160044" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "11782421", "url": "https://pubmed.ncbi.nlm.nih.gov/11782421" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.11782421", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of the AAA sensor-2 motif in the C-terminal ATPase domain of Hsp104 with a site-specific fluorescent probe of nucleotide binding.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002-03-05", "authors": "Hattendorf Douglas A, Lindquist Susan L", "reference": { "type": "PubMed", "id": "11867765", "url": "https://pubmed.ncbi.nlm.nih.gov/11867765" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 819, "end_pos": 819, "sequence_org": "Y", "sequence_mut": "W", "comment": "Site-specific fluorescent probe in an otherwise Trp-less HSP104. Fluorescence of this Trp changes in response to ATP and ADP binding at NBD2. Has no effect on ATP hydrolysis or protein stability.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11867765", "url": "https://pubmed.ncbi.nlm.nih.gov/11867765" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 826, "end_pos": 826, "sequence_org": "R", "sequence_mut": "M", "comment": "Reduces ATP and ADP binding at NBD2 6-fold, but does not affect ATP hydrolysis at NBD2. Reduces catalytic rate at NBD1.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11867765", "url": "https://pubmed.ncbi.nlm.nih.gov/11867765" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.11867765", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HSF and Msn2/4p can exclusively or cooperatively activate the yeast HSP104 gene.", "journal": "Mol. Microbiol.", "date": "2002", "authors": "Grably Melanie R, Stanhill Ariel, Tell Osnat, Engelberg David", "reference": { "type": "PubMed", "id": "11967066", "url": "https://pubmed.ncbi.nlm.nih.gov/11967066" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11967066", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Defining a pathway of communication from the C-terminal peptide binding domain to the N-terminal ATPase domain in a AAA protein.", "journal": "Molecular cell", "date": "2002-04", "authors": "Cashikar Anil G, Schirmer Eric C, Hattendorf Douglas A, Glover John R, Ramakrishnan Melarkode S, Ware Danielle M, Lindquist Susan L", "reference": { "type": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 218, "end_pos": 218, "sequence_org": "K", "sequence_mut": "T", "comment": "Abolishes substrate binding. Unable to confer thermotolerance. Reduces ATP hydrolysis by 98%; when associated with T-315. Completely abolishes ATPase activity; when associated with T-620.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 315, "end_pos": 315, "sequence_org": "A", "sequence_mut": "T", "comment": "Reduces ATP hydrolysis by 98%; when associated with T-218.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 503, "end_pos": 503, "sequence_org": "A", "sequence_mut": "V", "comment": "Increases basal level of ATPase activity and abolishes stimulation of ATP hydrolysis upon substrate binding. Inhibits growth at 37 degrees Celsius.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "14978213", "url": "https://pubmed.ncbi.nlm.nih.gov/14978213" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 728, "end_pos": 728, "sequence_org": "N", "sequence_mut": "A", "comment": "Almost completely abolishes ATP hydrolysis at NBD2, but does not affect nucleotide binding, thus keeping NBD2 in an ATP-bound state. Reduces stimulation of ATP hydrolysis upon substrate binding.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "18160044", "url": "https://pubmed.ncbi.nlm.nih.gov/18160044" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "11782421", "url": "https://pubmed.ncbi.nlm.nih.gov/11782421" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.11983167", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Guanidine hydrochloride inhibits the generation of prion `seeds` but not prion protein aggregation in yeast.", "journal": "Molecular and cellular biology", "date": "2002-08", "authors": "Ness Fr\u00e9d\u00e9rique, Ferreira Paulo, Cox Brian S, Tuite Mick F", "reference": { "type": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 218, "end_pos": 218, "sequence_org": "K", "sequence_mut": "T", "comment": "Abolishes substrate binding. Unable to confer thermotolerance. Reduces ATP hydrolysis by 98%; when associated with T-315. Completely abolishes ATPase activity; when associated with T-620.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 620, "end_pos": 620, "sequence_org": "K", "sequence_mut": "T", "comment": "Impairs oligomerization at low protein concentrations. Reduces ATP hydrolysis rate. Unable to confer thermotolerance. Completely abolishes ATPase activity; when associated with T-218.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.12101251", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Amino acid residue 184 of yeast Hsp104 chaperone is critical for prion-curing by guanidine, prion propagation, and thermotolerance.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002-07-23", "authors": "Jung Giman, Jones Gary, Masison Daniel C", "reference": { "type": "PubMed", "id": "12105276", "url": "https://pubmed.ncbi.nlm.nih.gov/12105276" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "A", "comment": "Confers resistance to prion-curing by guanidine.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "12105276", "url": "https://pubmed.ncbi.nlm.nih.gov/12105276" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "D", "comment": "Confers resistance to prion-curing by guanidine.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "12105276", "url": "https://pubmed.ncbi.nlm.nih.gov/12105276" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "F", "comment": "Confers resistance to prion-curing by guanidine.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "12105276", "url": "https://pubmed.ncbi.nlm.nih.gov/12105276" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "K", "comment": "Impairs prion propagation.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "12105276", "url": "https://pubmed.ncbi.nlm.nih.gov/12105276" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "L", "comment": "Confers resistance to prion-curing by guanidine.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "12105276", "url": "https://pubmed.ncbi.nlm.nih.gov/12105276" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "N", "comment": "Confers resistance to prion-curing by guanidine.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "12105276", "url": "https://pubmed.ncbi.nlm.nih.gov/12105276" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "Q", "comment": "Confers resistance to prion-curing by guanidine.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "12105276", "url": "https://pubmed.ncbi.nlm.nih.gov/12105276" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "S", "comment": "Confers resistance to prion-curing by guanidine.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "12105276", "url": "https://pubmed.ncbi.nlm.nih.gov/12105276" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "W", "comment": "Impairs prion propagation.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "12105276", "url": "https://pubmed.ncbi.nlm.nih.gov/12105276" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "Y", "comment": "Impairs prion propagation.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "12105276", "url": "https://pubmed.ncbi.nlm.nih.gov/12105276" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.12105276", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast [PSI+] prion aggregates are formed by small Sup35 polymers fragmented by Hsp104.", "journal": "The Journal of biological chemistry", "date": "2003-12-05", "authors": "Kryndushkin Dmitry S, Alexandrov Ilya M, Ter-Avanesyan Michael D, Kushnirov Vitaly V", "reference": { "type": "PubMed", "id": "14507919", "url": "https://pubmed.ncbi.nlm.nih.gov/14507919" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14507919", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The prion curing agent guanidinium chloride specifically inhibits ATP hydrolysis by Hsp104.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Grimminger Valerie, Richter Klaus, Imhof Axel, Buchner Johannes, Walter Stefan", "reference": { "type": "PubMed", "id": "14668331", "url": "https://pubmed.ncbi.nlm.nih.gov/14668331" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14668331", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dominant gain-of-function mutations in Hsp104p reveal crucial roles for the middle region.", "journal": "Molecular biology of the cell", "date": "2004-05", "authors": "Schirmer Eric C, Homann Oliver R, Kowal Anthony S, Lindquist Susan", "reference": { "type": "PubMed", "id": "14978213", "url": "https://pubmed.ncbi.nlm.nih.gov/14978213" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 217, "end_pos": 217, "sequence_org": "G", "sequence_mut": "S", "comment": "Largely reduces ATP hydrolysis. Alters bud morphology and causes septin mislocalization; when associated with I-499.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "14978213", "url": "https://pubmed.ncbi.nlm.nih.gov/14978213" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 217, "end_pos": 217, "sequence_org": "G", "sequence_mut": "V", "comment": "Completely abolishes ATP hydrolysis.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "14978213", "url": "https://pubmed.ncbi.nlm.nih.gov/14978213" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 499, "end_pos": 499, "sequence_org": "T", "sequence_mut": "I", "comment": "Reduces ATP hydrolysis by 50%. Alters bud morphology and causes septin mislocalization; when associated with S-217.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "14978213", "url": "https://pubmed.ncbi.nlm.nih.gov/14978213" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 503, "end_pos": 503, "sequence_org": "A", "sequence_mut": "V", "comment": "Increases basal level of ATPase activity and abolishes stimulation of ATP hydrolysis upon substrate binding. Inhibits growth at 37 degrees Celsius.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "14978213", "url": "https://pubmed.ncbi.nlm.nih.gov/14978213" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 509, "end_pos": 509, "sequence_org": "A", "sequence_mut": "D", "comment": "Reduces thermotolerance.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "14978213", "url": "https://pubmed.ncbi.nlm.nih.gov/14978213" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.14978213", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Upregulation of the Hsp104 chaperone at physiological temperature during recovery from thermal insult.", "journal": "Mol. Microbiol.", "date": "2004", "authors": "Sepp\u00e4 Laura, H\u00e4nninen Anna-Liisa, Makarow Marja", "reference": { "type": "PubMed", "id": "15049822", "url": "https://pubmed.ncbi.nlm.nih.gov/15049822" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15049822", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence for an unfolding/threading mechanism for protein disaggregation by Saccharomyces cerevisiae Hsp104.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Lum R, Tkach JM, Vierling E, Glover JR", "reference": { "type": "PubMed", "id": "15128736", "url": "https://pubmed.ncbi.nlm.nih.gov/15128736" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 257, "end_pos": 257, "sequence_org": "Y", "sequence_mut": "A", "comment": "Reduces thermotolerance 10-fold.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "15128736", "url": "https://pubmed.ncbi.nlm.nih.gov/15128736" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 645, "end_pos": 645, "sequence_org": "E", "sequence_mut": "K", "comment": "Abolishes the ability to refold aggregated protein in vitro and to provide thermotolerance in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "15128736", "url": "https://pubmed.ncbi.nlm.nih.gov/15128736" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 662, "end_pos": 662, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes the ability to refold aggregated protein in vitro and to provide thermotolerance in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "15128736", "url": "https://pubmed.ncbi.nlm.nih.gov/15128736" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 662, "end_pos": 662, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "15128736", "url": "https://pubmed.ncbi.nlm.nih.gov/15128736" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 662, "end_pos": 662, "sequence_org": "Y", "sequence_mut": "K", "comment": "Abolishes the ability to refold aggregated protein in vitro and to provide thermotolerance in vivo.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "15128736", "url": "https://pubmed.ncbi.nlm.nih.gov/15128736" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 662, "end_pos": 662, "sequence_org": "Y", "sequence_mut": "W", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "15128736", "url": "https://pubmed.ncbi.nlm.nih.gov/15128736" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.15128736", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hsp104 catalyzes formation and elimination of self-replicating Sup35 prion conformers.", "journal": "Science (New York, N.Y.)", "date": "2004-06-18", "authors": "Shorter James, Lindquist Susan", "reference": { "type": "PubMed", "id": "15155912", "url": "https://pubmed.ncbi.nlm.nih.gov/15155912" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15155912", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disassembling protein aggregates in the yeast cytosol. The cooperation of Hsp26 with Ssa1 and Hsp104.", "journal": "The Journal of biological chemistry", "date": "2005-06-24", "authors": "Haslbeck Martin, Miess Anita, Stromer Thusnelda, Walter Stefan, Buchner Johannes", "reference": { "type": "PubMed", "id": "15843375", "url": "https://pubmed.ncbi.nlm.nih.gov/15843375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15843375", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A chaperone pathway in protein disaggregation. Hsp26 alters the nature of protein aggregates to facilitate reactivation by Hsp104.", "journal": "The Journal of biological chemistry", "date": "2005-06-24", "authors": "Cashikar Anil G, Duennwald Martin, Lindquist Susan L", "reference": { "type": "PubMed", "id": "15845535", "url": "https://pubmed.ncbi.nlm.nih.gov/15845535" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15845535", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hsp104 is required for tolerance to many forms of stress.", "journal": "The EMBO journal", "date": "1992-06", "authors": "Sanchez Y, Taulien J, Borkovich K A, Lindquist S", "reference": { "type": "PubMed", "id": "1600951", "url": "https://pubmed.ncbi.nlm.nih.gov/1600951" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1600951", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Substrate binding to the molecular chaperone Hsp104 and its regulation by nucleotides.", "journal": "The Journal of biological chemistry", "date": "2005-11-18", "authors": "B\u00f6sl Benjamin, Grimminger Valerie, Walter Stefan", "reference": { "type": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 218, "end_pos": 218, "sequence_org": "K", "sequence_mut": "T", "comment": "Abolishes substrate binding. Unable to confer thermotolerance. Reduces ATP hydrolysis by 98%; when associated with T-315. Completely abolishes ATPase activity; when associated with T-620.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 285, "end_pos": 285, "sequence_org": "E", "sequence_mut": "Q", "comment": "In HSP104(TRAP); completely abolishes ATP hydrolysis, but does not affect nucleotide binding, thus keeping HSP104 in an ATP-bound state; when associated with Q-687.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 620, "end_pos": 620, "sequence_org": "K", "sequence_mut": "T", "comment": "Impairs oligomerization at low protein concentrations. Reduces ATP hydrolysis rate. Unable to confer thermotolerance. Completely abolishes ATPase activity; when associated with T-218.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 687, "end_pos": 687, "sequence_org": "E", "sequence_mut": "Q", "comment": "In HSP104(TRAP); completely abolishes ATP hydrolysis, but does not affect nucleotide binding, thus keeping HSP104 in an ATP-bound state; when associated with Q-285.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.16135516", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast prion-protein, sup35, fibril formation proceeds by addition and substraction of oligomers.", "journal": "Chembiochem : a European journal of chemical biology", "date": "2006-05", "authors": "Narayanan Saravanakumar, Walter Stefan, Reif Bernd", "reference": { "type": "PubMed", "id": "16570324", "url": "https://pubmed.ncbi.nlm.nih.gov/16570324" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16570324", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Destruction or potentiation of different prions catalyzed by similar Hsp104 remodeling activities.", "journal": "Molecular cell", "date": "2006-08-04", "authors": "Shorter James, Lindquist Susan", "reference": { "type": "PubMed", "id": "16885031", "url": "https://pubmed.ncbi.nlm.nih.gov/16885031" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16885031", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hsp104-dependent remodeling of prion complexes mediates protein-only inheritance.", "journal": "PLoS biology", "date": "2007-02", "authors": "Satpute-Krishnan Prasanna, Langseth Sara X, Serio Tricia R", "reference": { "type": "PubMed", "id": "17253904", "url": "https://pubmed.ncbi.nlm.nih.gov/17253904" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17253904", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Asymmetric deceleration of ClpB or Hsp104 ATPase activity unleashes protein-remodeling activity.", "journal": "Nature structural & molecular biology", "date": "2007-02", "authors": "Doyle Shannon M, Shorter James, Zolkiewski Michal, Hoskins Joel R, Lindquist Susan, Wickner Sue", "reference": { "type": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 218, "end_pos": 218, "sequence_org": "K", "sequence_mut": "T", "comment": "Abolishes substrate binding. Unable to confer thermotolerance. Reduces ATP hydrolysis by 98%; when associated with T-315. Completely abolishes ATPase activity; when associated with T-620.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 317, "end_pos": 317, "sequence_org": "T", "sequence_mut": "A", "comment": "Reduces rate of ATP hydrolysis at NBD1 nearly 10-fold. No effect on oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "11782421", "url": "https://pubmed.ncbi.nlm.nih.gov/11782421" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 620, "end_pos": 620, "sequence_org": "K", "sequence_mut": "T", "comment": "Impairs oligomerization at low protein concentrations. Reduces ATP hydrolysis rate. Unable to confer thermotolerance. Completely abolishes ATPase activity; when associated with T-218.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 728, "end_pos": 728, "sequence_org": "N", "sequence_mut": "A", "comment": "Almost completely abolishes ATP hydrolysis at NBD2, but does not affect nucleotide binding, thus keeping NBD2 in an ATP-bound state. Reduces stimulation of ATP hydrolysis upon substrate binding.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "18160044", "url": "https://pubmed.ncbi.nlm.nih.gov/18160044" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "11782421", "url": "https://pubmed.ncbi.nlm.nih.gov/11782421" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.17259993", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Channel mutations in Hsp104 hexamer distinctively affect thermotolerance and prion-specific propagation.", "journal": "Molecular microbiology", "date": "2007-03", "authors": "Kurahashi Hiroshi, Nakamura Yoshikazu", "reference": { "type": "PubMed", "id": "17367387", "url": "https://pubmed.ncbi.nlm.nih.gov/17367387" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 462, "end_pos": 462, "sequence_org": "L", "sequence_mut": "R", "comment": "Impairs prion propagation, but does not affect thermotolerance.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "17367387", "url": "https://pubmed.ncbi.nlm.nih.gov/17367387" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 557, "end_pos": 557, "sequence_org": "P", "sequence_mut": "L", "comment": "Impairs prion propagation, but does not affect thermotolerance.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "17367387", "url": "https://pubmed.ncbi.nlm.nih.gov/17367387" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 704, "end_pos": 704, "sequence_org": "D", "sequence_mut": "N", "comment": "Impairs prion propagation, but does not affect thermotolerance.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "17367387", "url": "https://pubmed.ncbi.nlm.nih.gov/17367387" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.17367387", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Processing of proteins by the molecular chaperone Hsp104.", "journal": "Journal of molecular biology", "date": "2007-07-20", "authors": "Schaupp Andreas, Marcinowski Moritz, Grimminger Valerie, B\u00f6sl Benjamin, Walter Stefan", "reference": { "type": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 218, "end_pos": 218, "sequence_org": "K", "sequence_mut": "T", "comment": "Abolishes substrate binding. Unable to confer thermotolerance. Reduces ATP hydrolysis by 98%; when associated with T-315. Completely abolishes ATPase activity; when associated with T-620.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 285, "end_pos": 285, "sequence_org": "E", "sequence_mut": "Q", "comment": "In HSP104(TRAP); completely abolishes ATP hydrolysis, but does not affect nucleotide binding, thus keeping HSP104 in an ATP-bound state; when associated with Q-687.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 620, "end_pos": 620, "sequence_org": "K", "sequence_mut": "T", "comment": "Impairs oligomerization at low protein concentrations. Reduces ATP hydrolysis rate. Unable to confer thermotolerance. Completely abolishes ATPase activity; when associated with T-218.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 687, "end_pos": 687, "sequence_org": "E", "sequence_mut": "Q", "comment": "In HSP104(TRAP); completely abolishes ATP hydrolysis, but does not affect nucleotide binding, thus keeping HSP104 in an ATP-bound state; when associated with Q-285.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.17543332", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleocytoplasmic trafficking of the molecular chaperone Hsp104 in unstressed and heat-shocked cells.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2008-01", "authors": "Tkach Johnny M, Glover John R", "reference": { "type": "PubMed", "id": "17973656", "url": "https://pubmed.ncbi.nlm.nih.gov/17973656" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 778, "end_pos": 778, "sequence_org": "K", "sequence_mut": "A", "comment": "In NLS17KA; fails to concentrate in the nucleus; when associated with A-782 and A-789.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "17973656", "url": "https://pubmed.ncbi.nlm.nih.gov/17973656" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 782, "end_pos": 782, "sequence_org": "K", "sequence_mut": "A", "comment": "In NLS17KA; fails to concentrate in the nucleus; when associated with A-778 and A-789.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "17973656", "url": "https://pubmed.ncbi.nlm.nih.gov/17973656" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 789, "end_pos": 789, "sequence_org": "K", "sequence_mut": "A", "comment": "In NLS17KA; fails to concentrate in the nucleus; when associated with A-778 and A-782.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "17973656", "url": "https://pubmed.ncbi.nlm.nih.gov/17973656" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.17973656", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Atypical AAA+ subunit packing creates an expanded cavity for disaggregation by the protein-remodeling factor Hsp104.", "journal": "Cell", "date": "2007-12-28", "authors": "Wendler Petra, Shorter James, Plisson Celia, Cashikar Anil G, Lindquist Susan, Saibil Helen R", "reference": { "type": "PubMed", "id": "18160044", "url": "https://pubmed.ncbi.nlm.nih.gov/18160044" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 334, "end_pos": 334, "sequence_org": "R", "sequence_mut": "M", "comment": "Reduces ATPase activity by 80%. Impairs oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "18160044", "url": "https://pubmed.ncbi.nlm.nih.gov/18160044" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 419, "end_pos": 419, "sequence_org": "R", "sequence_mut": "M", "comment": "Reduces ATPase activity by 80%.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "18160044", "url": "https://pubmed.ncbi.nlm.nih.gov/18160044" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 444, "end_pos": 444, "sequence_org": "R", "sequence_mut": "M", "comment": "Reduces ATPase activity by 80%.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "18160044", "url": "https://pubmed.ncbi.nlm.nih.gov/18160044" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 495, "end_pos": 495, "sequence_org": "R", "sequence_mut": "M", "comment": "Increases ATPase activity 3-fold.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "18160044", "url": "https://pubmed.ncbi.nlm.nih.gov/18160044" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 728, "end_pos": 728, "sequence_org": "N", "sequence_mut": "A", "comment": "Almost completely abolishes ATP hydrolysis at NBD2, but does not affect nucleotide binding, thus keeping NBD2 in an ATP-bound state. Reduces stimulation of ATP hydrolysis upon substrate binding.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "18160044", "url": "https://pubmed.ncbi.nlm.nih.gov/18160044" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "11782421", "url": "https://pubmed.ncbi.nlm.nih.gov/11782421" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 765, "end_pos": 765, "sequence_org": "R", "sequence_mut": "M", "comment": "Can oligomerize in the absence of nucleotides.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "18160044", "url": "https://pubmed.ncbi.nlm.nih.gov/18160044" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.18160044", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The C-terminal extension of Saccharomyces cerevisiae Hsp104 plays a role in oligomer assembly.", "journal": "Biochemistry", "date": "2008", "authors": "Mackay Ryder G, Helsen Christopher W, Tkach Johnny M, Glover John R", "reference": { "type": "PubMed", "id": "18197703", "url": "https://pubmed.ncbi.nlm.nih.gov/18197703" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18197703", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Substrate threading through the central pore of the Hsp104 chaperone as a common mechanism for protein disaggregation and prion propagation.", "journal": "Molecular microbiology", "date": "2008-04", "authors": "Tessarz Peter, Mogk Axel, Bukau Bernd", "reference": { "type": "PubMed", "id": "18312264", "url": "https://pubmed.ncbi.nlm.nih.gov/18312264" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18312264", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Misfolded proteins partition between two distinct quality control compartments.", "journal": "Nature", "date": "2008", "authors": "Kaganovich Daniel, Kopito Ron, Frydman Judith", "reference": { "type": "PubMed", "id": "18756251", "url": "https://pubmed.ncbi.nlm.nih.gov/18756251" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18756251", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hsp104 is a highly conserved protein with two essential nucleotide-binding sites.", "journal": "Nature", "date": "1991", "authors": "Parsell DA, Sanchez Y, Stitzel JD, Lindquist S", "reference": { "type": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31539-1", "protein_name": "Heat shock protein 104", "gene_name": "HSP104", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 218, "end_pos": 218, "sequence_org": "K", "sequence_mut": "T", "comment": "Abolishes substrate binding. Unable to confer thermotolerance. Reduces ATP hydrolysis by 98%; when associated with T-315. Completely abolishes ATPase activity; when associated with T-620.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "11983167", "url": "https://pubmed.ncbi.nlm.nih.gov/11983167" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" }, { "start_pos": 620, "end_pos": 620, "sequence_org": "K", "sequence_mut": "T", "comment": "Impairs oligomerization at low protein concentrations. Reduces ATP hydrolysis rate. Unable to confer thermotolerance. Completely abolishes ATPase activity; when associated with T-218.", "evidence": [ { "database": "UniProtKB", "id": "P31539", "url": "https://www.uniprot.org/uniprotkb/P31539" }, { "database": "PubMed", "id": "8308017", "url": "https://pubmed.ncbi.nlm.nih.gov/8308017" }, { "database": "PubMed", "id": "16135516", "url": "https://pubmed.ncbi.nlm.nih.gov/16135516" }, { "database": "PubMed", "id": "11158570", "url": "https://pubmed.ncbi.nlm.nih.gov/11158570" }, { "database": "PubMed", "id": "17543332", "url": "https://pubmed.ncbi.nlm.nih.gov/17543332" }, { "database": "PubMed", "id": "11442834", "url": "https://pubmed.ncbi.nlm.nih.gov/11442834" }, { "database": "PubMed", "id": "12101251", "url": "https://pubmed.ncbi.nlm.nih.gov/12101251" }, { "database": "PubMed", "id": "1896074", "url": "https://pubmed.ncbi.nlm.nih.gov/1896074" }, { "database": "PubMed", "id": "17259993", "url": "https://pubmed.ncbi.nlm.nih.gov/17259993" }, { "database": "PubMed", "id": "9624144", "url": "https://pubmed.ncbi.nlm.nih.gov/9624144" } ], "uniprot_canonical_ac": "P31539-1" } ], "record_id": "pubmed.1896074", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]