[ { "title": "Molecular requirements for actin-based lamella formation in Drosophila S2 cells.", "journal": "The Journal of cell biology", "date": "2003-09-15", "authors": "Rogers Stephen L, Wiedemann Ursula, Stuurman Nico, Vale Ronald D", "reference": { "type": "PubMed", "id": "12975351", "url": "https://pubmed.ncbi.nlm.nih.gov/12975351" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VU84-1", "protein_name": "Drebrin-like protein", "gene_name": "Abp1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VU84", "url": "https://www.uniprot.org/uniprotkb/Q9VU84" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12975351", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Toll receptors instruct axon and dendrite targeting and participate in synaptic partner matching in a Drosophila olfactory circuit.", "journal": "Neuron", "date": "2015-03-04", "authors": "Ward Alex, Hong Weizhe, Favaloro Vincenzo, Luo Liqun", "reference": { "type": "PubMed", "id": "25741726", "url": "https://pubmed.ncbi.nlm.nih.gov/25741726" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VUN0-1", "protein_name": "Toll-like receptor 6", "gene_name": "Toll-6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7KIN0-1", "protein_name": "Toll-like receptor 7", "gene_name": "Toll-7", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VUN0", "url": "https://www.uniprot.org/uniprotkb/Q9VUN0" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.25741726", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning, genomic organization, and expression of a B-type (cricket-type) allatostatin preprohormone from Drosophila melanogaster.", "journal": "Biochemical and biophysical research communications", "date": "2001-02-23", "authors": "Williamson M, Lenz C, Winther A M, N\u00e4ssel D R, Grimmelikhuijzen C J, Winther M E", "reference": { "type": "PubMed", "id": "11181081", "url": "https://pubmed.ncbi.nlm.nih.gov/11181081" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VVF7-1", "protein_name": "Allatostatins MIP", "gene_name": "Mip", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VVF7", "url": "https://www.uniprot.org/uniprotkb/Q9VVF7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11181081", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peptidergic paracrine and endocrine cells in the midgut of the fruit fly maggot.", "journal": "Cell Tissue Res.", "date": "2009", "authors": "Veenstra Jan A", "reference": { "type": "PubMed", "id": "19319573", "url": "https://pubmed.ncbi.nlm.nih.gov/19319573" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VVF7-1", "protein_name": "Allatostatins MIP", "gene_name": "Mip", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VVF7", "url": "https://www.uniprot.org/uniprotkb/Q9VVF7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.19319573", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel wide-field neuron with branches in the lamina of the Drosophila visual system expresses myoinhibitory peptide and may be associated with the clock.", "journal": "Cell Tissue Res.", "date": "2011", "authors": "Kolodziejczyk Agata, N\u00e4ssel Dick R", "reference": { "type": "PubMed", "id": "21174124", "url": "https://pubmed.ncbi.nlm.nih.gov/21174124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VVF7-1", "protein_name": "Allatostatins MIP", "gene_name": "Mip", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VVF7", "url": "https://www.uniprot.org/uniprotkb/Q9VVF7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.21174124", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gram-negative bacteria-binding protein, a pattern recognition receptor for lipopolysaccharide and beta-1,3-glucan that mediates the signaling for the induction of innate immune genes in Drosophila melanogaster cells.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Kim Y S, Ryu J H, Han S J, Choi K H, Nam K B, Jang I H, Lemaitre B, Brey P T, Lee W J", "reference": { "type": "PubMed", "id": "10827089", "url": "https://pubmed.ncbi.nlm.nih.gov/10827089" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VVR4-1", "protein_name": "Gram-negative bacteria-binding protein 2", "gene_name": "GNBP2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NHA8-1", "protein_name": "Gram-negative bacteria-binding protein 3", "gene_name": "GNBP3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NHB0-1", "protein_name": "Gram-negative bacteria-binding protein 1", "gene_name": "GNBP1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VVR4", "url": "https://www.uniprot.org/uniprotkb/Q9VVR4" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10827089", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Contrasting evolutionary patterns in Drosophila immune receptors.", "journal": "J. Mol. Evol.", "date": "2006", "authors": "Jiggins Francis M, Kim Kang-Wook", "reference": { "type": "PubMed", "id": "17103056", "url": "https://pubmed.ncbi.nlm.nih.gov/17103056" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VVR4-1", "protein_name": "Gram-negative bacteria-binding protein 2", "gene_name": "GNBP2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NHA8-1", "protein_name": "Gram-negative bacteria-binding protein 3", "gene_name": "GNBP3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NHB0-1", "protein_name": "Gram-negative bacteria-binding protein 1", "gene_name": "GNBP1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VVR4", "url": "https://www.uniprot.org/uniprotkb/Q9VVR4" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.17103056", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Drosophila model for the Zellweger spectrum of peroxisome biogenesis disorders.", "journal": "Disease models & mechanisms", "date": "2011-09", "authors": "Mast Fred D, Li Jing, Virk Maninder K, Hughes Sarah C, Simmonds Andrew J, Rachubinski Richard A", "reference": { "type": "PubMed", "id": "21669930", "url": "https://pubmed.ncbi.nlm.nih.gov/21669930" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VWB0-1", "protein_name": "Tectonin beta-propeller repeat-containing protein", "gene_name": "Pex23", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VPT5-1", "protein_name": "Peroxisome assembly protein 12", "gene_name": "Pex12", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VWB0", "url": "https://www.uniprot.org/uniprotkb/Q9VWB0" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.21669930", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Narya, a RING finger domain-containing protein, is required for meiotic DNA double-strand break formation and crossover maturation in Drosophila melanogaster.", "journal": "PLoS genetics", "date": "2019", "authors": "Lake CM, Nielsen RJ, Bonner AM, Eche S, White-Brown S, McKim KS, Hawley RS", "reference": { "type": "PubMed", "id": "30615609", "url": "https://pubmed.ncbi.nlm.nih.gov/30615609" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VWI4-1", "protein_name": "RING finger protein narya", "gene_name": "narya", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O76908-1", "protein_name": "RING finger protein vilya", "gene_name": "vilya", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8IMM9-1", "protein_name": "RING finger protein nenya", "gene_name": "nenya", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VWI4", "url": "https://www.uniprot.org/uniprotkb/Q9VWI4" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 46, "end_pos": 50, "sequence_org": "LCGQV", "sequence_mut": "", "comment": "Disrupts the RING finger domain. During meiosis, DNA double-strand break formation is normal but their conversion into cross-overs fails.", "evidence": [ { "database": "UniProtKB", "id": "Q9VWI4", "url": "https://www.uniprot.org/uniprotkb/Q9VWI4" }, { "database": "PubMed", "id": "30615609", "url": "https://pubmed.ncbi.nlm.nih.gov/30615609" } ], "uniprot_canonical_ac": "Q9VWI4-1" } ], "record_id": "pubmed.30615609", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phantom encodes the 25-hydroxylase of Drosophila melanogaster and Bombyx mori: a P450 enzyme critical in ecdysone biosynthesis.", "journal": "Insect biochemistry and molecular biology", "date": "2004-09", "authors": "Warren James T, Petryk Anna, Marqu\u00e9s Guillermo, Parvy Jean-Philippe, Shinoda Tetsuro, Itoyama Kyo, Kobayashi Jun, Jarcho Michael, Li Yutai, O'Connor Michael B, Dauphin-Villemant Chantal, Gilbert Lawrence I", "reference": { "type": "PubMed", "id": "15350618", "url": "https://pubmed.ncbi.nlm.nih.gov/15350618" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VWR5-1", "protein_name": "Cytochrome P450 306a1", "gene_name": "phtm", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VWR5", "url": "https://www.uniprot.org/uniprotkb/Q9VWR5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15350618", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a physiological E2 module for the human anaphase-promoting complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Williamson A, Wickliffe KE, Mellone BG, Song L, Karpen GH, Rape M", "reference": { "type": "PubMed", "id": "19822757", "url": "https://pubmed.ncbi.nlm.nih.gov/19822757" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VX25-1", "protein_name": "Ubiquitin-conjugating enzyme E2 S", "gene_name": "Ube2S", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q16763-1", "protein_name": "Ubiquitin-conjugating enzyme E2 S", "gene_name": "UBE2S", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00762-1", "protein_name": "Ubiquitin-conjugating enzyme E2 C", "gene_name": "UBE2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9VTY6-1", "protein_name": "Ubiquitin-conjugating enzyme E2 C", "gene_name": "vih", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VX25", "url": "https://www.uniprot.org/uniprotkb/Q9VX25" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 95, "end_pos": 95, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q16763", "url": "https://www.uniprot.org/uniprotkb/Q16763" }, { "database": "PubMed", "id": "20622874", "url": "https://pubmed.ncbi.nlm.nih.gov/20622874" }, { "database": "PubMed", "id": "19822757", "url": "https://pubmed.ncbi.nlm.nih.gov/19822757" } ], "uniprot_canonical_ac": "Q16763-1" } ], "record_id": "pubmed.19822757", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The MARVEL domain protein, Singles Bar, is required for progression past the pre-fusion complex stage of myoblast fusion.", "journal": "Developmental biology", "date": "2007", "authors": "Estrada B, Maeland AD, Gisselbrecht SS, Bloor JW, Brown NH, Michelson AM", "reference": { "type": "PubMed", "id": "17537424", "url": "https://pubmed.ncbi.nlm.nih.gov/17537424" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VXD1-1", "protein_name": "Protein singles bar", "gene_name": "sing", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VXD1", "url": "https://www.uniprot.org/uniprotkb/Q9VXD1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 142, "end_pos": 176, "sequence_org": "WAYPAMTACYYMGYAAGILHALDAYLAFRHFRGAR", "sequence_mut": "", "comment": "In sing-23; myoblast fusion is abolished and consequently multinucleated myofibers fail to form during embryonic muscle development.", "evidence": [ { "database": "UniProtKB", "id": "Q9VXD1", "url": "https://www.uniprot.org/uniprotkb/Q9VXD1" }, { "database": "PubMed", "id": "17537424", "url": "https://pubmed.ncbi.nlm.nih.gov/17537424" } ], "uniprot_canonical_ac": "Q9VXD1-1" }, { "start_pos": 160, "end_pos": 176, "sequence_org": "LHALDAYLAFRHFRGAR", "sequence_mut": "", "comment": "In sing-27; myoblast fusion is abolished and consequently multinucleated myofibers fail to form during embryonic muscle development.", "evidence": [ { "database": "UniProtKB", "id": "Q9VXD1", "url": "https://www.uniprot.org/uniprotkb/Q9VXD1" }, { "database": "PubMed", "id": "17537424", "url": "https://pubmed.ncbi.nlm.nih.gov/17537424" } ], "uniprot_canonical_ac": "Q9VXD1-1" }, { "start_pos": 46, "end_pos": 46, "sequence_org": "A", "sequence_mut": "V", "comment": "In sing-22; myoblast fusion is abolished and consequently multinucleated myofibers fail to form during embryonic muscle development.", "evidence": [ { "database": "UniProtKB", "id": "Q9VXD1", "url": "https://www.uniprot.org/uniprotkb/Q9VXD1" }, { "database": "PubMed", "id": "17537424", "url": "https://pubmed.ncbi.nlm.nih.gov/17537424" } ], "uniprot_canonical_ac": "Q9VXD1-1" } ], "record_id": "pubmed.17537424", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of singles bar as a direct transcriptional target of Drosophila Myocyte enhancer factor-2 and a regulator of adult myoblast fusion.", "journal": "Developmental biology", "date": "2015-05-15", "authors": "Brunetti Tonya M, Fremin Brayon J, Cripps Richard M", "reference": { "type": "PubMed", "id": "25797154", "url": "https://pubmed.ncbi.nlm.nih.gov/25797154" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VXD1-1", "protein_name": "Protein singles bar", "gene_name": "sing", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P40791-1", "protein_name": "Myocyte-specific enhancer factor 2", "gene_name": "Mef2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VXD1", "url": "https://www.uniprot.org/uniprotkb/Q9VXD1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.25797154", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and RNA expression of a novel Drosophila calpain, Calpain C.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2003", "authors": "Spadoni Cesare, Farkas Attila, Sinka Rita, Tompa Peter, Friedrich Peter", "reference": { "type": "PubMed", "id": "12646209", "url": "https://pubmed.ncbi.nlm.nih.gov/12646209" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VXH6-1", "protein_name": "Calpain-C", "gene_name": "CalpC", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VXH6", "url": "https://www.uniprot.org/uniprotkb/Q9VXH6" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12646209", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The endogenous ligand Stunted of the GPCR Methuselah extends lifespan in Drosophila.", "journal": "Nature cell biology", "date": "2004-06", "authors": "Cvejic Svetlana, Zhu Zheng, Felice Sarah J, Berman Yemiliya, Huang Xin-Yun", "reference": { "type": "PubMed", "id": "15133470", "url": "https://pubmed.ncbi.nlm.nih.gov/15133470" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VXN2-1", "protein_name": "Protein stunted", "gene_name": "sun", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O97148-1", "protein_name": "G protein-coupled receptor Mth", "gene_name": "mth", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VXN2", "url": "https://www.uniprot.org/uniprotkb/Q9VXN2" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15133470", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila G protein-coupled receptor, Methuselah, exhibits a promiscuous response to peptides.", "journal": "Protein science : a publication of the Protein Society", "date": "2009", "authors": "Ja WW, Carvalho GB, Madrigal M, Roberts RW, Benzer S", "reference": { "type": "PubMed", "id": "19672878", "url": "https://pubmed.ncbi.nlm.nih.gov/19672878" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VXN2-1", "protein_name": "Protein stunted", "gene_name": "sun", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O97148-1", "protein_name": "G protein-coupled receptor Mth", "gene_name": "mth", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VXN2", "url": "https://www.uniprot.org/uniprotkb/Q9VXN2" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 3, "end_pos": 3, "sequence_org": "A", "sequence_mut": "S", "comment": "Abolishes ability to activate mth.", "evidence": [ { "database": "UniProtKB", "id": "Q9VXN2", "url": "https://www.uniprot.org/uniprotkb/Q9VXN2" }, { "database": "PubMed", "id": "19672878", "url": "https://pubmed.ncbi.nlm.nih.gov/19672878" } ], "uniprot_canonical_ac": "Q9VXN2-1" }, { "start_pos": 4, "end_pos": 4, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes ability to activate mth.", "evidence": [ { "database": "UniProtKB", "id": "Q9VXN2", "url": "https://www.uniprot.org/uniprotkb/Q9VXN2" }, { "database": "PubMed", "id": "19672878", "url": "https://pubmed.ncbi.nlm.nih.gov/19672878" } ], "uniprot_canonical_ac": "Q9VXN2-1" }, { "start_pos": 6, "end_pos": 6, "sequence_org": "A", "sequence_mut": "S", "comment": "Strongly reduces ability to activate mth.", "evidence": [ { "database": "UniProtKB", "id": "Q9VXN2", "url": "https://www.uniprot.org/uniprotkb/Q9VXN2" }, { "database": "PubMed", "id": "19672878", "url": "https://pubmed.ncbi.nlm.nih.gov/19672878" } ], "uniprot_canonical_ac": "Q9VXN2-1" } ], "record_id": "pubmed.19672878", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effects of X-linkage and sex-biased gene expression on the rate of adaptive protein evolution in Drosophila.", "journal": "Molecular biology and evolution", "date": "2008", "authors": "Baines JF, Sawyer SA, Hartl DL, Parsch J", "reference": { "type": "PubMed", "id": "18477586", "url": "https://pubmed.ncbi.nlm.nih.gov/18477586" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VXV9-1", "protein_name": "WSCD family member CG9164", "gene_name": "CG9164", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VYY3-1", "protein_name": "Ubiquitin-like modifier-activating enzyme 5", "gene_name": "Uba5", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O77277-1", "protein_name": "Torsin-like protein", "gene_name": "Torsin", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VZ21-1", "protein_name": "UPAR/Ly6 domain-containing protein rtv", "gene_name": "rtv", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VXV9", "url": "https://www.uniprot.org/uniprotkb/Q9VXV9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.18477586", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The expression of CG9940 affects the adaptation of cardiac function, mobility, and lifespan to exercise in aging Drosophila.", "journal": "Experimental gerontology", "date": "2016-10", "authors": "Wen Deng-Tai, Zheng Lan, Ni Liu, Wang Hui, Feng Yue, Zhang Min", "reference": { "type": "PubMed", "id": "27448710", "url": "https://pubmed.ncbi.nlm.nih.gov/27448710" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VYA0-1", "protein_name": "Glutamine-dependent NAD(+) synthetase", "gene_name": "Nadsyn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VYA0", "url": "https://www.uniprot.org/uniprotkb/Q9VYA0" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.27448710", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nonsense-mediated mRNA decay in Drosophila: at the intersection of the yeast and mammalian pathways.", "journal": "The EMBO journal", "date": "2003", "authors": "Gatfield D, Unterholzner L, Ciccarelli FD, Bork P, Izaurralde E", "reference": { "type": "PubMed", "id": "12881430", "url": "https://pubmed.ncbi.nlm.nih.gov/12881430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VYS3-1", "protein_name": "Regulator of nonsense transcripts 1 homolog", "gene_name": "Upf1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q70PP2-1", "protein_name": "Serine/threonine-protein kinase Smg1", "gene_name": "nonC", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VYS3", "url": "https://www.uniprot.org/uniprotkb/Q9VYS3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12881430", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nonsense-mediated mRNA decay factors act in concert to regulate common mRNA targets.", "journal": "RNA (New York, N.Y.)", "date": "2005", "authors": "Rehwinkel J, Letunic I, Raes J, Bork P, Izaurralde E", "reference": { "type": "PubMed", "id": "16199763", "url": "https://pubmed.ncbi.nlm.nih.gov/16199763" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VYS3-1", "protein_name": "Regulator of nonsense transcripts 1 homolog", "gene_name": "Upf1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q70PP2-1", "protein_name": "Serine/threonine-protein kinase Smg1", "gene_name": "nonC", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VYS3", "url": "https://www.uniprot.org/uniprotkb/Q9VYS3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16199763", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Apoptosis-dependent externalization and involvement in apoptotic cell clearance of DmCaBP1, an endoplasmic reticulum protein of Drosophila.", "journal": "J. Biol. Chem.", "date": "2012", "authors": "Okada Ryo, Nagaosa Kaz, Kuraishi Takayuki, Nakayama Hiroshi, Yamamoto Naoko, Nakagawa Yukiko, Dohmae Naoshi, Shiratsuchi Akiko, Nakanishi Yoshinobu", "reference": { "type": "PubMed", "id": "22158613", "url": "https://pubmed.ncbi.nlm.nih.gov/22158613" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VYV3-1", "protein_name": "Thioredoxin domain-containing protein 5 homolog", "gene_name": "prtp", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V438-1", "protein_name": "Protein disulfide-isomerase A6 homolog", "gene_name": "CaBP1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VYV3", "url": "https://www.uniprot.org/uniprotkb/Q9VYV3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.22158613", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of NPxY motif in Draper-mediated apoptotic cell clearance in Drosophila.", "journal": "Drug discoveries & therapeutics", "date": "2012", "authors": "Fujita Y, Nagaosa K, Shiratsuchi A, Nakanishi Y", "reference": { "type": "PubMed", "id": "23337816", "url": "https://pubmed.ncbi.nlm.nih.gov/23337816" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VYV3-1", "protein_name": "Thioredoxin domain-containing protein 5 homolog", "gene_name": "prtp", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W0A0-1", "protein_name": "Protein draper", "gene_name": "drpr", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VYV3", "url": "https://www.uniprot.org/uniprotkb/Q9VYV3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 858, "end_pos": 858, "sequence_org": "Y", "sequence_mut": "F", "comment": "Protein still undergoes tyrosine phosphorylation but fails to rescue the defective phagocytosis caused by a loss of endogenous drpr.", "evidence": [ { "database": "UniProtKB", "id": "Q9W0A0", "url": "https://www.uniprot.org/uniprotkb/Q9W0A0" }, { "database": "PubMed", "id": "23337816", "url": "https://pubmed.ncbi.nlm.nih.gov/23337816" } ], "uniprot_canonical_ac": "Q9W0A0-1" }, { "start_pos": 949, "end_pos": 949, "sequence_org": "Y", "sequence_mut": "F", "comment": "Markedly reduced interaction with shark. In contrast to the wild-type, does not rescue the ability of macrophages to migrate to a wound when expressed in drpr mutants. Protein still undergoes tyrosine phosphorylation and rescues the defective phagocytosis caused by a loss of endogenous drpr.", "evidence": [ { "database": "UniProtKB", "id": "Q9W0A0", "url": "https://www.uniprot.org/uniprotkb/Q9W0A0" }, { "database": "PubMed", "id": "18432193", "url": "https://pubmed.ncbi.nlm.nih.gov/18432193" }, { "database": "PubMed", "id": "26028435", "url": "https://pubmed.ncbi.nlm.nih.gov/26028435" }, { "database": "PubMed", "id": "23337816", "url": "https://pubmed.ncbi.nlm.nih.gov/23337816" } ], "uniprot_canonical_ac": "Q9W0A0-1" } ], "record_id": "pubmed.23337816", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The novel transcription factor e(y)2 interacts with TAF(II)40 and potentiates transcription activation on chromatin templates.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Georgieva S, Nabirochkina E, Dilworth FJ, Eickhoff H, Becker P, Tora L, Georgiev P, Soldatov A", "reference": { "type": "PubMed", "id": "11438676", "url": "https://pubmed.ncbi.nlm.nih.gov/11438676" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VYX1-1", "protein_name": "Enhancer of yellow 2 transcription factor", "gene_name": "e(y)2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VI60-1", "protein_name": "Enhancer of yellow 2b transcription factor", "gene_name": "e(y)2b", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9JIX0-1", "protein_name": "Transcription and mRNA export factor ENY2", "gene_name": "Eny2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NPA8-1", "protein_name": "Transcription and mRNA export factor ENY2", "gene_name": "ENY2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q27272-1", "protein_name": "Transcription initiation factor TFIID subunit 9", "gene_name": "Taf9", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VYX1", "url": "https://www.uniprot.org/uniprotkb/Q9VYX1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11438676", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evolutionarily conserved E(y)2/Sus1 protein is essential for the barrier activity of Su(Hw)-dependent insulators in Drosophila.", "journal": "Molecular cell", "date": "2007", "authors": "Kurshakova M, Maksimenko O, Golovnin A, Pulina M, Georgieva S, Georgiev P, Krasnov A", "reference": { "type": "PubMed", "id": "17643381", "url": "https://pubmed.ncbi.nlm.nih.gov/17643381" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VYX1-1", "protein_name": "Enhancer of yellow 2 transcription factor", "gene_name": "e(y)2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9JIX0-1", "protein_name": "Transcription and mRNA export factor ENY2", "gene_name": "Eny2", "tax_name": "Mouse" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VYX1", "url": "https://www.uniprot.org/uniprotkb/Q9VYX1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.17643381", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Conservative E(y)2/Sus1 protein is the member of SAGA complex and new nuclear pore-associated complex in Drosophila].", "journal": "Genetika", "date": "2009-10", "authors": "Kurshakova M M, Kopytova D V, Nabirochkina E N, Nikolenko Iu V, Shidlovski\u012d Iu V, Georgieva S G, Krasnov A N", "reference": { "type": "PubMed", "id": "19947544", "url": "https://pubmed.ncbi.nlm.nih.gov/19947544" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VYX1-1", "protein_name": "Enhancer of yellow 2 transcription factor", "gene_name": "e(y)2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VYX1", "url": "https://www.uniprot.org/uniprotkb/Q9VYX1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.19947544", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multifunctional factor ENY2 is associated with the THO complex and promotes its recruitment onto nascent mRNA.", "journal": "Genes & development", "date": "2010-01-01", "authors": "Kopytova Daria V, Orlova Anastasija V, Krasnov Alexey N, Gurskiy Dmitriy Ya, Nikolenko Julia V, Nabirochkina Elena N, Shidlovskii Yulii V, Georgieva Sofia G", "reference": { "type": "PubMed", "id": "20048002", "url": "https://pubmed.ncbi.nlm.nih.gov/20048002" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VYX1-1", "protein_name": "Enhancer of yellow 2 transcription factor", "gene_name": "e(y)2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VYX1", "url": "https://www.uniprot.org/uniprotkb/Q9VYX1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.20048002", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ENY2 protein forms a part of the THO complex of Drosophila melanogaster.", "journal": "Doklady. Biochemistry and biophysics", "date": "2010", "authors": "Gurskiy D Ya, Nabirochkina E N, Kopytova D V, Nikolenko Yu V, Ilyin Yu V, Georgieva S G, Shidlovskii Yu V", "reference": { "type": "PubMed", "id": "20714859", "url": "https://pubmed.ncbi.nlm.nih.gov/20714859" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VYX1-1", "protein_name": "Enhancer of yellow 2 transcription factor", "gene_name": "e(y)2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VYX1", "url": "https://www.uniprot.org/uniprotkb/Q9VYX1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.20714859", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zinc Finger Protein CG9890 - New Component of ENY2-Containing Complexes of Drosophila.", "journal": "Acta Naturae", "date": "2018", "authors": "Fursova N A, Nikolenko J V, Soshnikova N V, Mazina M Y, Vorobyova N E, Krasnov A N", "reference": { "type": "PubMed", "id": "30713769", "url": "https://pubmed.ncbi.nlm.nih.gov/30713769" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VYX1-1", "protein_name": "Enhancer of yellow 2 transcription factor", "gene_name": "e(y)2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W1F4-1", "protein_name": "THO complex subunit 5", "gene_name": "thoc5", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W1V7-1", "protein_name": "Zinc finger protein 277", "gene_name": "CG9890", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24168-1", "protein_name": "Origin recognition complex subunit 2", "gene_name": "Orc2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VYX1", "url": "https://www.uniprot.org/uniprotkb/Q9VYX1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.30713769", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential regulation of dendritic and axonal development by the novel Kr\u00fcppel-like factor Dar1.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2011-03-02", "authors": "Ye Bing, Kim Jung Hwan, Yang Limin, McLachlan Ian, Younger Susan, Jan Lily Yeh, Jan Yuh Nung", "reference": { "type": "PubMed", "id": "21368042", "url": "https://pubmed.ncbi.nlm.nih.gov/21368042" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VZN4-1", "protein_name": "Dendritic arbor reduction protein 1", "gene_name": "dar1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VZN4", "url": "https://www.uniprot.org/uniprotkb/Q9VZN4" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.21368042", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Kr\u00fcppel-Like Factor Dar1 Determines Multipolar Neuron Morphology.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2015-10-21", "authors": "Wang Xin, Zhang Macy W, Kim Jung Hwan, Macara Ann Marie, Sterne Gabriella, Yang Tao, Ye Bing", "reference": { "type": "PubMed", "id": "26490864", "url": "https://pubmed.ncbi.nlm.nih.gov/26490864" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VZN4-1", "protein_name": "Dendritic arbor reduction protein 1", "gene_name": "dar1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VVA6-1", "protein_name": "Nuclear migration protein nudC", "gene_name": "nudC", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VT70-1", "protein_name": "Nuclear distribution protein nudE homolog", "gene_name": "nudE", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VZN4", "url": "https://www.uniprot.org/uniprotkb/Q9VZN4" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.26490864", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The C8ORF38 homologue Sicily is a cytosolic chaperone for a mitochondrial complex I subunit.", "journal": "J. Cell Biol.", "date": "2013", "authors": "Zhang K, Li Z, Jaiswal M, Bayat V, Xiong B, Sandoval H, Charng WL, David G, Haueter C, Yamamoto S, Graham BH, Bellen HJ", "reference": { "type": "PubMed", "id": "23509070", "url": "https://pubmed.ncbi.nlm.nih.gov/23509070" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VZU4-1", "protein_name": "NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial", "gene_name": "ND-30", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P02828-1", "protein_name": "Heat shock protein 83", "gene_name": "Hsp83", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P91929-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial", "gene_name": "ND-42", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VYS5-1", "protein_name": "NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog", "gene_name": "sicily", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VZU4", "url": "https://www.uniprot.org/uniprotkb/Q9VZU4" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 1, "end_pos": 47, "sequence_org": "MTAVFRVGLVRLVSRATQSPNLLQAQTNALPAAFQQRCSISGKTMRG", "sequence_mut": "", "comment": "Localizes to cytoplasm.", "evidence": [ { "database": "UniProtKB", "id": "P91929", "url": "https://www.uniprot.org/uniprotkb/P91929" }, { "database": "PubMed", "id": "23509070", "url": "https://pubmed.ncbi.nlm.nih.gov/23509070" } ], "uniprot_canonical_ac": "P91929-1" }, { "start_pos": 1, "end_pos": 11, "sequence_org": "MRRLVRNWNCR", "sequence_mut": "", "comment": "Mostly localized to cytoplasm. Does not affect interaction with and protein level stabilization of ND-42.", "evidence": [ { "database": "UniProtKB", "id": "Q9VYS5", "url": "https://www.uniprot.org/uniprotkb/Q9VYS5" }, { "database": "PubMed", "id": "23509070", "url": "https://pubmed.ncbi.nlm.nih.gov/23509070" } ], "uniprot_canonical_ac": "Q9VYS5-1" } ], "record_id": "pubmed.23509070", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MISTERMINATE Mechanistically Links Mitochondrial Dysfunction with Proteostasis Failure.", "journal": "Mol. Cell", "date": "2019", "authors": "Wu Zhihao, Tantray Ishaq, Lim Junghyun, Chen Songjie, Li Yu, Davis Zoe, Sitron Cole, Dong Jason, Gispert Suzana, Auburger Georg, Brandman Onn, Bi Xiaolin, Snyder Michael, Lu Bingwei", "reference": { "type": "PubMed", "id": "31378462", "url": "https://pubmed.ncbi.nlm.nih.gov/31378462" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VZU4-1", "protein_name": "NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial", "gene_name": "ND-30", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VBX1-1", "protein_name": "Ribosome quality control complex subunit NEMF homolog", "gene_name": "Clbn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VZU4", "url": "https://www.uniprot.org/uniprotkb/Q9VZU4" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.31378462", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peroxidasin: a novel enzyme-matrix protein of Drosophila development.", "journal": "The EMBO journal", "date": "1994-08-01", "authors": "Nelson R E, Fessler L I, Takagi Y, Blumberg B, Keene D R, Olson P F, Parker C G, Fessler J H", "reference": { "type": "PubMed", "id": "8062820", "url": "https://pubmed.ncbi.nlm.nih.gov/8062820" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VZZ4-1", "protein_name": "Peroxidasin", "gene_name": "Pxn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VZZ4", "url": "https://www.uniprot.org/uniprotkb/Q9VZZ4" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8062820", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A migrating ciliary gate compartmentalizes the site of axoneme assembly in Drosophila spermatids.", "journal": "Current biology : CB", "date": "2014", "authors": "Basiri ML, Ha A, Chadha A, Clark NM, Polyanovsky A, Cook B, Avidor-Reiss T", "reference": { "type": "PubMed", "id": "25447994", "url": "https://pubmed.ncbi.nlm.nih.gov/25447994" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W0M1-1", "protein_name": "Centrosomal protein Cep290", "gene_name": "Cep290", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "M9MRD5-1", "protein_name": "B9 domain-containing protein 2", "gene_name": "B9d2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VF59-1", "protein_name": "B9 domain-containing protein 1", "gene_name": "B9d1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VYM3-1", "protein_name": "Tectonic-like complex member Mks1", "gene_name": "Mks1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 1472, "end_pos": 1978, "sequence_org": "LKNFHDDQQRYIKDTSNFSEDQIAKLAADLNRTEATNKIYHTQMEALRRQLANVTQREKQARDLSQSLRQQLLKRPVVSIKTELNARVKNENQLKRIQQLELDLDEARGQLQRQQTLLEAKRTRSANEVQLWEKQKRYQQQAEKTKARLEETELALEKTRALLQAARTTIARLEKDKQILESKLGRNGPPSNSSGGNNLKCCRTPSCPNLQHVGVSKFAPSPSESPETYTGPSSECSSPAHHHTQIFDQSQLDLIEALKSRIELQQRKIIAMELEGRGSNALTTELEKLQERCQAIEAQNIRLEARNLQLQLDSDLLRQGDSSDRLQKRIKHLEDYIMALKEEMARNESRRELGSGLKVSTNQGQSAEQTILSLRNLVEKLRSENKFLKDGRRSTESRSSMDSTPAEAARLQQQHAEALEKISALQQELQKRTTKCSQCGGRSKDAANEELKFIKEQLVKKTQLLQKAKVLLTRAAAKEKVLREQLALWKRKCSELQNVPVIDEISE", "sequence_mut": "", "comment": "Results in motor defects including crossed legs and inability to stand or hold wings erect. In sensory neurons, results in failure to form a transition zone. In cilia, shows severe proprioception defects including defective mechanoreceptor current (MRC) but normal transepithelial potential (TEP). In germ cells, results in defective transition zone assembly and ciliary cap structure; the defects include increased distance between microtubules (MT) and between MT and membrane and it is associated with longer cilium basal body. This leads to ultrastructural axoneme defects without compromising the attachment of spermatocyte centrioles to the membrane.", "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" }, { "database": "PubMed", "id": "25447994", "url": "https://pubmed.ncbi.nlm.nih.gov/25447994" }, { "database": "PubMed", "id": "30013109", "url": "https://pubmed.ncbi.nlm.nih.gov/30013109" } ], "uniprot_canonical_ac": "Q9W0M1-1" } ], "record_id": "pubmed.25447994", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila sensory cilia lacking MKS proteins exhibit striking defects in development but only subtle defects in adults.", "journal": "J. Cell Sci.", "date": "2016", "authors": "Pratt Metta B, Titlow Joshua S, Davis Ilan, Barker Amy R, Dawe Helen R, Raff Jordan W, Roque Helio", "reference": { "type": "PubMed", "id": "27577095", "url": "https://pubmed.ncbi.nlm.nih.gov/27577095" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W0M1-1", "protein_name": "Centrosomal protein Cep290", "gene_name": "Cep290", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1ZAV1-1", "protein_name": "Coiled-coil and C2 domain-containing protein 2A", "gene_name": "Cc2d2a", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "M9MRD5-1", "protein_name": "B9 domain-containing protein 2", "gene_name": "B9d2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VF59-1", "protein_name": "B9 domain-containing protein 1", "gene_name": "B9d1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VYM3-1", "protein_name": "Tectonic-like complex member Mks1", "gene_name": "Mks1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.27577095", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transition zone assembly and its contribution to axoneme formation in Drosophila male germ cells.", "journal": "J. Cell Biol.", "date": "2016", "authors": "Vieillard Jennifer, Paschaki Marie, Duteyrat Jean-Luc, Augi\u00e8re C\u00e9line, Cortier Elisabeth, Lapart Jean-Andr\u00e9, Thomas Jo\u00eblle, Durand B\u00e9n\u00e9dicte", "reference": { "type": "PubMed", "id": "27646273", "url": "https://pubmed.ncbi.nlm.nih.gov/27646273" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W0M1-1", "protein_name": "Centrosomal protein Cep290", "gene_name": "Cep290", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1Z7Z9-1", "protein_name": "Centrosomal protein of 131 kDa", "gene_name": "dila", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1ZAV1-1", "protein_name": "Coiled-coil and C2 domain-containing protein 2A", "gene_name": "Cc2d2a", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "M9MRD5-1", "protein_name": "B9 domain-containing protein 2", "gene_name": "B9d2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VF59-1", "protein_name": "B9 domain-containing protein 1", "gene_name": "B9d1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VMH0-1", "protein_name": "Tectonic", "gene_name": "tctn", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VYM3-1", "protein_name": "Tectonic-like complex member Mks1", "gene_name": "Mks1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.27646273", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential regulation of transition zone and centriole proteins contributes to ciliary base diversity.", "journal": "Nature cell biology", "date": "2018", "authors": "Jana SC, Mendonca S, Machado P, Werner S, Rocha J, Pereira A, Maiato H, Bettencourt-Dias M", "reference": { "type": "PubMed", "id": "30013109", "url": "https://pubmed.ncbi.nlm.nih.gov/30013109" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W0M1-1", "protein_name": "Centrosomal protein Cep290", "gene_name": "Cep290", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VF59-1", "protein_name": "B9 domain-containing protein 1", "gene_name": "B9d1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VAC8-1", "protein_name": "Spindle assembly abnormal protein 6 homolog", "gene_name": "Sas-6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VYM3-1", "protein_name": "Tectonic-like complex member Mks1", "gene_name": "Mks1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 1472, "end_pos": 1978, "sequence_org": "LKNFHDDQQRYIKDTSNFSEDQIAKLAADLNRTEATNKIYHTQMEALRRQLANVTQREKQARDLSQSLRQQLLKRPVVSIKTELNARVKNENQLKRIQQLELDLDEARGQLQRQQTLLEAKRTRSANEVQLWEKQKRYQQQAEKTKARLEETELALEKTRALLQAARTTIARLEKDKQILESKLGRNGPPSNSSGGNNLKCCRTPSCPNLQHVGVSKFAPSPSESPETYTGPSSECSSPAHHHTQIFDQSQLDLIEALKSRIELQQRKIIAMELEGRGSNALTTELEKLQERCQAIEAQNIRLEARNLQLQLDSDLLRQGDSSDRLQKRIKHLEDYIMALKEEMARNESRRELGSGLKVSTNQGQSAEQTILSLRNLVEKLRSENKFLKDGRRSTESRSSMDSTPAEAARLQQQHAEALEKISALQQELQKRTTKCSQCGGRSKDAANEELKFIKEQLVKKTQLLQKAKVLLTRAAAKEKVLREQLALWKRKCSELQNVPVIDEISE", "sequence_mut": "", "comment": "Results in motor defects including crossed legs and inability to stand or hold wings erect. In sensory neurons, results in failure to form a transition zone. In cilia, shows severe proprioception defects including defective mechanoreceptor current (MRC) but normal transepithelial potential (TEP). In germ cells, results in defective transition zone assembly and ciliary cap structure; the defects include increased distance between microtubules (MT) and between MT and membrane and it is associated with longer cilium basal body. This leads to ultrastructural axoneme defects without compromising the attachment of spermatocyte centrioles to the membrane.", "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" }, { "database": "PubMed", "id": "25447994", "url": "https://pubmed.ncbi.nlm.nih.gov/25447994" }, { "database": "PubMed", "id": "30013109", "url": "https://pubmed.ncbi.nlm.nih.gov/30013109" } ], "uniprot_canonical_ac": "Q9W0M1-1" } ], "record_id": "pubmed.30013109", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dzip1 and Fam92 form a ciliary transition zone complex with cell type specific roles in Drosophila.", "journal": "eLife", "date": "2019", "authors": "Lapart JA, Gottardo M, Cortier E, Duteyrat JL, Augiere C, Mange A, Jerber J, Solassol J, Gopalakrishnan J, Thomas J, Durand B", "reference": { "type": "PubMed", "id": "31821146", "url": "https://pubmed.ncbi.nlm.nih.gov/31821146" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W0M1-1", "protein_name": "Centrosomal protein Cep290", "gene_name": "Cep290", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VC70-1", "protein_name": "Cilium assembly protein DZIP1L", "gene_name": "DZIP1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VK91-1", "protein_name": "CBY1-interacting BAR domain-containing protein homolog", "gene_name": "Fam92", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 1, "end_pos": 65, "sequence_org": "MGFKGKYPQMVRETGFKLRQYRDGPLDWRLMGSYETERILREQNFELVDKALTHLSEAPLGTVLE", "sequence_mut": "", "comment": "Viable but displays adherent transition zone (TZ) assembly in sensory neurons and spermatocytes. Consequently, adults display defects associated with ciliary dysfunction and disorganization, such as severe uncoordination and axonemal defects and dispersed nuclei in the testes. Cilia are essentially absent in antennal chordotonal organs, transition zones are disorganized and microtubules fail to elongate.", "evidence": [ { "database": "UniProtKB", "id": "Q9VC70", "url": "https://www.uniprot.org/uniprotkb/Q9VC70" }, { "database": "PubMed", "id": "31821146", "url": "https://pubmed.ncbi.nlm.nih.gov/31821146" } ], "uniprot_canonical_ac": "Q9VC70-1" } ], "record_id": "pubmed.31821146", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CEP290 is essential for the initiation of ciliary transition zone assembly.", "journal": "PLoS biology", "date": "2020", "authors": "Wu Z, Pang N, Zhang Y, Chen H, Peng Y, Fu J, Wei Q", "reference": { "type": "PubMed", "id": "33370260", "url": "https://pubmed.ncbi.nlm.nih.gov/33370260" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W0M1-1", "protein_name": "Centrosomal protein Cep290", "gene_name": "Cep290", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VC70-1", "protein_name": "Cilium assembly protein DZIP1L", "gene_name": "DZIP1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VK91-1", "protein_name": "CBY1-interacting BAR domain-containing protein homolog", "gene_name": "Fam92", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 1385, "end_pos": 1978, "sequence_org": "GEEEKQDTEELKEVPTLHKQIKDLKDKLEYSERSLKTREEEVDILKEKLKLCQEREKSVESTVNPELDQLRIFLDEKDKHIKDLMDTLKNFHDDQQRYIKDTSNFSEDQIAKLAADLNRTEATNKIYHTQMEALRRQLANVTQREKQARDLSQSLRQQLLKRPVVSIKTELNARVKNENQLKRIQQLELDLDEARGQLQRQQTLLEAKRTRSANEVQLWEKQKRYQQQAEKTKARLEETELALEKTRALLQAARTTIARLEKDKQILESKLGRNGPPSNSSGGNNLKCCRTPSCPNLQHVGVSKFAPSPSESPETYTGPSSECSSPAHHHTQIFDQSQLDLIEALKSRIELQQRKIIAMELEGRGSNALTTELEKLQERCQAIEAQNIRLEARNLQLQLDSDLLRQGDSSDRLQKRIKHLEDYIMALKEEMARNESRRELGSGLKVSTNQGQSAEQTILSLRNLVEKLRSENKFLKDGRRSTESRSSMDSTPAEAARLQQQHAEALEKISALQQELQKRTTKCSQCGGRSKDAANEELKFIKEQLVKKTQLLQKAKVLLTRAAAKEKVLREQLALWKRKCSELQNVPVIDEISE", "sequence_mut": "", "comment": "In CEP290-N+M; no effect on cilium basal body localization. In CEP290-M; abolishes cilium basal body localization; when associated with 1-M--E-650.", "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" }, { "database": "PubMed", "id": "33370260", "url": "https://pubmed.ncbi.nlm.nih.gov/33370260" } ], "uniprot_canonical_ac": "Q9W0M1-1" }, { "start_pos": 1386, "end_pos": 1978, "sequence_org": "EEEKQDTEELKEVPTLHKQIKDLKDKLEYSERSLKTREEEVDILKEKLKLCQEREKSVESTVNPELDQLRIFLDEKDKHIKDLMDTLKNFHDDQQRYIKDTSNFSEDQIAKLAADLNRTEATNKIYHTQMEALRRQLANVTQREKQARDLSQSLRQQLLKRPVVSIKTELNARVKNENQLKRIQQLELDLDEARGQLQRQQTLLEAKRTRSANEVQLWEKQKRYQQQAEKTKARLEETELALEKTRALLQAARTTIARLEKDKQILESKLGRNGPPSNSSGGNNLKCCRTPSCPNLQHVGVSKFAPSPSESPETYTGPSSECSSPAHHHTQIFDQSQLDLIEALKSRIELQQRKIIAMELEGRGSNALTTELEKLQERCQAIEAQNIRLEARNLQLQLDSDLLRQGDSSDRLQKRIKHLEDYIMALKEEMARNESRRELGSGLKVSTNQGQSAEQTILSLRNLVEKLRSENKFLKDGRRSTESRSSMDSTPAEAARLQQQHAEALEKISALQQELQKRTTKCSQCGGRSKDAANEELKFIKEQLVKKTQLLQKAKVLLTRAAAKEKVLREQLALWKRKCSELQNVPVIDEISE", "sequence_mut": "", "comment": "In olfactory and auditory neurons, transition zones (TZ) fail to form, ciliary axonemes are lost and DZIP1 expression is significantly reduced resulting in uncoordination and severe defects in touch and hearing. No effect on connection between the basal bodies and plasma membrane. Mild defects in spermatid development and male fertility. In spermatocyte cilia there is no significant reduction in DZIP1 expression.", "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" }, { "database": "PubMed", "id": "33370260", "url": "https://pubmed.ncbi.nlm.nih.gov/33370260" } ], "uniprot_canonical_ac": "Q9W0M1-1" }, { "start_pos": 157, "end_pos": 1978, "sequence_org": "KRLLKEIETLQNQNIAQSKTIVLHERELQTIKANLVQLSQDITKVEQERKSLKQKEQQQALEITRLEGNLTFLEVEREKQEVEMRQFLDKYEAKSLGWRQALDDRDKEVERLKKQLEGKSISSGQTNSSNSQSQQEEEHAKLRQLLESREQRIEKLEEKIKSMAEEMVSSTRAMNQLCQEKERAHDPEQPRACCQMIEERLREATARCQQLSEMLEAAEQDNVLKSQQALHAISALEAYKRDEDGLIPALRRCSGLEQKVAARDKQLRAYIQELNSLHEVVQENELLRRKLHIPDDVVIMAKNVHSKQRNKDKQIERLTLKLRTSEELRLQLKLEKSELRRKLLELQQDSPQTLNESLQAPSEVGEVPHSVHLENSPRRGQGDGAASSEMQNRYDEVLAENETLRSGMYEILEKLREYDATSEHITIDSDLLRRLIEALPGGTTTPQRLQGQLLELKAREEALRQLLEQQNYSDSETGELSSVHSLCEVPEIAEEHPVEEDAVLNTATRPSSPTEATMGLRRPTVPDPEEKPTNEALAELSILRKHYDELRLHMSADGSDLMNRNQELHDQMIALELQLEQQRNSYSYMRRDYDQLLTETRKQELRFIDDKASLARQLEHSKSELCEAREELEQVNRRNLYTAEEQQKLEHRNAILSMQLGQAMEQLLGELKPTEICAEYGIIRENYQLDYITAQDFEEQQQELLTWRSKQAELQRETKQLEGLLHVANEQIHSQQRLLNEITDNHINLRHLVADLQSSSDEKLMLAKVQRDLDSVKAECSRLETEREKLQLKADCLQTQLEASELSLKQTQQDFQQERTNSDIKHKFLQHSLFMLKDKYAKFTPLVFLTNFVFAYQKFQRRLEEEQVQQRHRDHTALIDEVTAVVQAKIGLNEESSQQLVKLIKSETQTRLLEQRCEILQAKQEELVRELGELRMSQATDTEHWSTIQALFGEGEPRSQLKVDAETNTDAVAPNLAMRRAVQLIDRESSPIGSPLRKHPHLDTATQTLEAQVEFSETAVQTNGILSQQNQAVQTADAVEDNRRDSRAELQKMQETLQEANQRIEILGKQLEASRSESRESASPQGGVVEKTILSFHTLLLEKDQSIQKYQDLLQTERDQSQQALSKQVAENESLRATVNNLNFNIKTKDAEIQGLKEKLRQKPEVPVERNPSTDSRSSSSSDSSVNELTDEKIEELFESSSVERPPQEELEVPVEAGPENIVTEEPEGEEEKQDTEELKEVPTLHKQIKDLKDKLEYSERSLKTREEEVDILKEKLKLCQEREKSVESTVNPELDQLRIFLDEKDKHIKDLMDTLKNFHDDQQRYIKDTSNFSEDQIAKLAADLNRTEATNKIYHTQMEALRRQLANVTQREKQARDLSQSLRQQLLKRPVVSIKTELNARVKNENQLKRIQQLELDLDEARGQLQRQQTLLEAKRTRSANEVQLWEKQKRYQQQAEKTKARLEETELALEKTRALLQAARTTIARLEKDKQILESKLGRNGPPSNSSGGNNLKCCRTPSCPNLQHVGVSKFAPSPSESPETYTGPSSECSSPAHHHTQIFDQSQLDLIEALKSRIELQQRKIIAMELEGRGSNALTTELEKLQERCQAIEAQNIRLEARNLQLQLDSDLLRQGDSSDRLQKRIKHLEDYIMALKEEMARNESRRELGSGLKVSTNQGQSAEQTILSLRNLVEKLRSENKFLKDGRRSTESRSSMDSTPAEAARLQQQHAEALEKISALQQELQKRTTKCSQCGGRSKDAANEELKFIKEQLVKKTQLLQKAKVLLTRAAAKEKVLREQLALWKRKCSELQNVPVIDEISE", "sequence_mut": "", "comment": "In CEP290-1; in olfactory and auditory neurons, transition zones (TZ) fail to form leading to the disassociation of the basal bodies from plasma membrane at later stages cliliogenesis, abnormal elongation of the axoneme and consequently complete loss of cilia. As a consequence, adults are uncoordinated and have severe defects in touch and hearing. In testes, flagellar axonemes are almost completely lost and sperm cyst elongation is severely defective. As a consequence, mature sperms do not develop and so males are completely infertile.", "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" }, { "database": "PubMed", "id": "33370260", "url": "https://pubmed.ncbi.nlm.nih.gov/33370260" } ], "uniprot_canonical_ac": "Q9W0M1-1" }, { "start_pos": 1, "end_pos": 1384, "sequence_org": "MSMDIPETVSLRKFRDFSARQKQELYETLLELAESIDELPKKSLRKTLELTLAVLEYKGEQVQQLQESAAGGLSSDRRLQDENEKLKRMLQKLEDERDGLKSKAKELGEEIRQLELRLQEAAQQAEISDKDSSDPLSELDKQEQLLQNIDSKNKHIKRLLKEIETLQNQNIAQSKTIVLHERELQTIKANLVQLSQDITKVEQERKSLKQKEQQQALEITRLEGNLTFLEVEREKQEVEMRQFLDKYEAKSLGWRQALDDRDKEVERLKKQLEGKSISSGQTNSSNSQSQQEEEHAKLRQLLESREQRIEKLEEKIKSMAEEMVSSTRAMNQLCQEKERAHDPEQPRACCQMIEERLREATARCQQLSEMLEAAEQDNVLKSQQALHAISALEAYKRDEDGLIPALRRCSGLEQKVAARDKQLRAYIQELNSLHEVVQENELLRRKLHIPDDVVIMAKNVHSKQRNKDKQIERLTLKLRTSEELRLQLKLEKSELRRKLLELQQDSPQTLNESLQAPSEVGEVPHSVHLENSPRRGQGDGAASSEMQNRYDEVLAENETLRSGMYEILEKLREYDATSEHITIDSDLLRRLIEALPGGTTTPQRLQGQLLELKAREEALRQLLEQQNYSDSETGELSSVHSLCEVPEIAEEHPVEEDAVLNTATRPSSPTEATMGLRRPTVPDPEEKPTNEALAELSILRKHYDELRLHMSADGSDLMNRNQELHDQMIALELQLEQQRNSYSYMRRDYDQLLTETRKQELRFIDDKASLARQLEHSKSELCEAREELEQVNRRNLYTAEEQQKLEHRNAILSMQLGQAMEQLLGELKPTEICAEYGIIRENYQLDYITAQDFEEQQQELLTWRSKQAELQRETKQLEGLLHVANEQIHSQQRLLNEITDNHINLRHLVADLQSSSDEKLMLAKVQRDLDSVKAECSRLETEREKLQLKADCLQTQLEASELSLKQTQQDFQQERTNSDIKHKFLQHSLFMLKDKYAKFTPLVFLTNFVFAYQKFQRRLEEEQVQQRHRDHTALIDEVTAVVQAKIGLNEESSQQLVKLIKSETQTRLLEQRCEILQAKQEELVRELGELRMSQATDTEHWSTIQALFGEGEPRSQLKVDAETNTDAVAPNLAMRRAVQLIDRESSPIGSPLRKHPHLDTATQTLEAQVEFSETAVQTNGILSQQNQAVQTADAVEDNRRDSRAELQKMQETLQEANQRIEILGKQLEASRSESRESASPQGGVVEKTILSFHTLLLEKDQSIQKYQDLLQTERDQSQQALSKQVAENESLRATVNNLNFNIKTKDAEIQGLKEKLRQKPEVPVERNPSTDSRSSSSSDSSVNELTDEKIEELFESSSVERPPQEELEVPVEAGPENIVTEEPE", "sequence_mut": "", "comment": "In CEP290-C; no effect on cilium basal body localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" }, { "database": "PubMed", "id": "33370260", "url": "https://pubmed.ncbi.nlm.nih.gov/33370260" } ], "uniprot_canonical_ac": "Q9W0M1-1" }, { "start_pos": 1, "end_pos": 650, "sequence_org": "MSMDIPETVSLRKFRDFSARQKQELYETLLELAESIDELPKKSLRKTLELTLAVLEYKGEQVQQLQESAAGGLSSDRRLQDENEKLKRMLQKLEDERDGLKSKAKELGEEIRQLELRLQEAAQQAEISDKDSSDPLSELDKQEQLLQNIDSKNKHIKRLLKEIETLQNQNIAQSKTIVLHERELQTIKANLVQLSQDITKVEQERKSLKQKEQQQALEITRLEGNLTFLEVEREKQEVEMRQFLDKYEAKSLGWRQALDDRDKEVERLKKQLEGKSISSGQTNSSNSQSQQEEEHAKLRQLLESREQRIEKLEEKIKSMAEEMVSSTRAMNQLCQEKERAHDPEQPRACCQMIEERLREATARCQQLSEMLEAAEQDNVLKSQQALHAISALEAYKRDEDGLIPALRRCSGLEQKVAARDKQLRAYIQELNSLHEVVQENELLRRKLHIPDDVVIMAKNVHSKQRNKDKQIERLTLKLRTSEELRLQLKLEKSELRRKLLELQQDSPQTLNESLQAPSEVGEVPHSVHLENSPRRGQGDGAASSEMQNRYDEVLAENETLRSGMYEILEKLREYDATSEHITIDSDLLRRLIEALPGGTTTPQRLQGQLLELKAREEALRQLLEQQNYSDSETGELSSVHSLCEVPEIAE", "sequence_mut": "", "comment": "In CEP290-M; abolishes cilium basal body localization; when associated with 1385-G--E-1978.", "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" }, { "database": "PubMed", "id": "33370260", "url": "https://pubmed.ncbi.nlm.nih.gov/33370260" } ], "uniprot_canonical_ac": "Q9W0M1-1" }, { "start_pos": 651, "end_pos": 1978, "sequence_org": "EHPVEEDAVLNTATRPSSPTEATMGLRRPTVPDPEEKPTNEALAELSILRKHYDELRLHMSADGSDLMNRNQELHDQMIALELQLEQQRNSYSYMRRDYDQLLTETRKQELRFIDDKASLARQLEHSKSELCEAREELEQVNRRNLYTAEEQQKLEHRNAILSMQLGQAMEQLLGELKPTEICAEYGIIRENYQLDYITAQDFEEQQQELLTWRSKQAELQRETKQLEGLLHVANEQIHSQQRLLNEITDNHINLRHLVADLQSSSDEKLMLAKVQRDLDSVKAECSRLETEREKLQLKADCLQTQLEASELSLKQTQQDFQQERTNSDIKHKFLQHSLFMLKDKYAKFTPLVFLTNFVFAYQKFQRRLEEEQVQQRHRDHTALIDEVTAVVQAKIGLNEESSQQLVKLIKSETQTRLLEQRCEILQAKQEELVRELGELRMSQATDTEHWSTIQALFGEGEPRSQLKVDAETNTDAVAPNLAMRRAVQLIDRESSPIGSPLRKHPHLDTATQTLEAQVEFSETAVQTNGILSQQNQAVQTADAVEDNRRDSRAELQKMQETLQEANQRIEILGKQLEASRSESRESASPQGGVVEKTILSFHTLLLEKDQSIQKYQDLLQTERDQSQQALSKQVAENESLRATVNNLNFNIKTKDAEIQGLKEKLRQKPEVPVERNPSTDSRSSSSSDSSVNELTDEKIEELFESSSVERPPQEELEVPVEAGPENIVTEEPEGEEEKQDTEELKEVPTLHKQIKDLKDKLEYSERSLKTREEEVDILKEKLKLCQEREKSVESTVNPELDQLRIFLDEKDKHIKDLMDTLKNFHDDQQRYIKDTSNFSEDQIAKLAADLNRTEATNKIYHTQMEALRRQLANVTQREKQARDLSQSLRQQLLKRPVVSIKTELNARVKNENQLKRIQQLELDLDEARGQLQRQQTLLEAKRTRSANEVQLWEKQKRYQQQAEKTKARLEETELALEKTRALLQAARTTIARLEKDKQILESKLGRNGPPSNSSGGNNLKCCRTPSCPNLQHVGVSKFAPSPSESPETYTGPSSECSSPAHHHTQIFDQSQLDLIEALKSRIELQQRKIIAMELEGRGSNALTTELEKLQERCQAIEAQNIRLEARNLQLQLDSDLLRQGDSSDRLQKRIKHLEDYIMALKEEMARNESRRELGSGLKVSTNQGQSAEQTILSLRNLVEKLRSENKFLKDGRRSTESRSSMDSTPAEAARLQQQHAEALEKISALQQELQKRTTKCSQCGGRSKDAANEELKFIKEQLVKKTQLLQKAKVLLTRAAAKEKVLREQLALWKRKCSELQNVPVIDEISE", "sequence_mut": "", "comment": "In CEP290-N; no effect on cilium basal body localization however expression in more restricted within the transition zone of auditory cilia. When overexpressed in CEP290-1 mutants, rescues defects in ciliogenesis, basal body docking, transition zone (TZ) assembly, and recruitment of DZP1 and Mks1 to the TZ. It does not rescue uncoordination.", "evidence": [ { "database": "UniProtKB", "id": "Q9W0M1", "url": "https://www.uniprot.org/uniprotkb/Q9W0M1" }, { "database": "PubMed", "id": "33370260", "url": "https://pubmed.ncbi.nlm.nih.gov/33370260" } ], "uniprot_canonical_ac": "Q9W0M1-1" }, { "start_pos": 357, "end_pos": 737, "sequence_org": "LEEGYKEKLGALERELKQLSVQKVQPEPVQTVPVASKIPKPVVRKEETNIDRIRKQVESEFLKQKHDDDTYSIEEAPRKGSEKPFPQLVTQVQVVEKEQPSAGSSDSNPTYTKSPREPAPNKQETKEATDVSDSLSQEETENEEERSLTEEEGTDVPTSGSEAAREDPTPKTIKPSGRIIKSPQKPLTRKDARKMVNRKLMSHGFDMKSKGISHNSLKRVNSELTEHRNKLKLQHPHFYATRNRIRKFVEKLCSAKFSERAEMLLKHKSPLKPMEVPGKGIPRSAISEKSEEDIASSQGEEQTDEQTDSSEQQTRSPSPQRLVSRDFKARLEEILVKPAATIRGASKSSLSSRPVPLPRKRVMFNTTEDGKSFNDSDDNLK", "sequence_mut": "", "comment": "Adults display adherent transition zone (TZ) assembly and cilia are almost completely lost in auditory neurons. Consequently, adults display defects associated with ciliary dysfunction and disorganization, such as uncoordination, inability to stand, and severely deficient in touch and hearing. In spermatocytes, ciliary axonemes extend aberrantly and the basal body and plasma membrane separate at later stages of spermatogenesis.", "evidence": [ { "database": "UniProtKB", "id": "Q9VC70", "url": "https://www.uniprot.org/uniprotkb/Q9VC70" }, { "database": "PubMed", "id": "33370260", "url": "https://pubmed.ncbi.nlm.nih.gov/33370260" } ], "uniprot_canonical_ac": "Q9VC70-1" } ], "record_id": "pubmed.33370260", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Spliceosomal Protein SF3B5 is a Novel Component of Drosophila SAGA that Functions in Gene Expression Independent of Splicing.", "journal": "J. Mol. Biol.", "date": "2016", "authors": "Stegeman Rachel, Spreacker Peyton J, Swanson Selene K, Stephenson Robert, Florens Laurence, Washburn Michael P, Weake Vikki M", "reference": { "type": "PubMed", "id": "27185460", "url": "https://pubmed.ncbi.nlm.nih.gov/27185460" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W0M7-1", "protein_name": "Splicing factor 3B subunit 3", "gene_name": "Sf3b3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VHI4-1", "protein_name": "Splicing factor 3B subunit 5", "gene_name": "Sf3b5", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W0M7", "url": "https://www.uniprot.org/uniprotkb/Q9W0M7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.27185460", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differing requirements for Augmin in male meiotic and mitotic spindle formation in Drosophila.", "journal": "Open biology", "date": "2014-05", "authors": "Savoian Matthew S, Glover David M", "reference": { "type": "PubMed", "id": "24829288", "url": "https://pubmed.ncbi.nlm.nih.gov/24829288" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W0S8-1", "protein_name": "Augmin complex subunit wac", "gene_name": "wac", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7K4B4-1", "protein_name": "Augmin complex subunit dgt5", "gene_name": "dgt5", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VAP2-1", "protein_name": "Augmin complex subunit dgt6", "gene_name": "dgt6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P52304-1", "protein_name": "Serine/threonine-protein kinase polo", "gene_name": "polo", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W0S8", "url": "https://www.uniprot.org/uniprotkb/Q9W0S8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.24829288", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of Drosophila melanogaster BRCA2 in DNA repair.", "journal": "DNA repair", "date": "2008-01-01", "authors": "Brough Rachel, Wei Debbie, Leulier Sophie, Lord Christopher J, Rong Yikang S, Ashworth Alan", "reference": { "type": "PubMed", "id": "17822964", "url": "https://pubmed.ncbi.nlm.nih.gov/17822964" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W157-1", "protein_name": "Breast cancer type 2 susceptibility protein homolog", "gene_name": "Brca2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W157", "url": "https://www.uniprot.org/uniprotkb/Q9W157" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.17822964", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila brca2 is required for mitotic and meiotic DNA repair and efficient activation of the meiotic recombination checkpoint.", "journal": "PLoS genetics", "date": "2008-02", "authors": "Klovstad Martha, Abdu Uri, Sch\u00fcpbach Trudi", "reference": { "type": "PubMed", "id": "18266476", "url": "https://pubmed.ncbi.nlm.nih.gov/18266476" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W157-1", "protein_name": "Breast cancer type 2 susceptibility protein homolog", "gene_name": "Brca2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O96533-1", "protein_name": "Cell cycle checkpoint control protein Rad9", "gene_name": "Rad9", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W157", "url": "https://www.uniprot.org/uniprotkb/Q9W157" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.18266476", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila hus1 gene is required for homologous recombination repair during meiosis.", "journal": "Mech. Dev.", "date": "2009", "authors": "Peretz Gabriella, Arie Lihi Gur, Bakhrat Anna, Abdu Uri", "reference": { "type": "PubMed", "id": "19501158", "url": "https://pubmed.ncbi.nlm.nih.gov/19501158" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W157-1", "protein_name": "Breast cancer type 2 susceptibility protein homolog", "gene_name": "Brca2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VN60-1", "protein_name": "Checkpoint protein Hus1-like", "gene_name": "Hus1-like", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W157", "url": "https://www.uniprot.org/uniprotkb/Q9W157" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.19501158", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cyclin G is involved in meiotic recombination repair in Drosophila melanogaster.", "journal": "J. Cell Sci.", "date": "2012", "authors": "Nagel Anja C, Fischer Patrick, Szawinski Jutta, La Rosa Martina K, Preiss Anette", "reference": { "type": "PubMed", "id": "22976300", "url": "https://pubmed.ncbi.nlm.nih.gov/22976300" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W157-1", "protein_name": "Breast cancer type 2 susceptibility protein homolog", "gene_name": "Brca2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q95TJ9-1", "protein_name": "Cyclin G", "gene_name": "CycG", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W157", "url": "https://www.uniprot.org/uniprotkb/Q9W157" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.22976300", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "System identification of Drosophila olfactory sensory neurons.", "journal": "Journal of computational neuroscience", "date": "2011-02", "authors": "Kim Anmo J, Lazar Aurel A, Slutskiy Yevgeniy B", "reference": { "type": "PubMed", "id": "20730480", "url": "https://pubmed.ncbi.nlm.nih.gov/20730480" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W1P8-1", "protein_name": "Odorant receptor 59b", "gene_name": "Or59b", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W1P8", "url": "https://www.uniprot.org/uniprotkb/Q9W1P8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.20730480", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A natural polymorphism alters odour and DEET sensitivity in an insect odorant receptor.", "journal": "Nature", "date": "2011-09-21", "authors": "Pellegrino Maurizio, Steinbach Nicole, Stensmyr Marcus C, Hansson Bill S, Vosshall Leslie B", "reference": { "type": "PubMed", "id": "21937991", "url": "https://pubmed.ncbi.nlm.nih.gov/21937991" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W1P8-1", "protein_name": "Odorant receptor 59b", "gene_name": "Or59b", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VNB5-1", "protein_name": "Odorant receptor coreceptor", "gene_name": "Orco", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W1P8", "url": "https://www.uniprot.org/uniprotkb/Q9W1P8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.21937991", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila windpipe codes for a leucine-rich repeat protein expressed in the developing trachea.", "journal": "Mech. Dev.", "date": "2002", "authors": "Huff Janice L, Kingsley Karl L, Miller Jennell M, Hoshizaki Deborah K", "reference": { "type": "PubMed", "id": "11804792", "url": "https://pubmed.ncbi.nlm.nih.gov/11804792" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W266-1", "protein_name": "Protein windpipe", "gene_name": "wdp", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W266", "url": "https://www.uniprot.org/uniprotkb/Q9W266" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11804792", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Windpipe controls Drosophila intestinal homeostasis by regulating JAK/STAT pathway via promoting receptor endocytosis and lysosomal degradation.", "journal": "PLoS genetics", "date": "2015", "authors": "Ren W, Zhang Y, Li M, Wu L, Wang G, Baeg GH, You J, Li Z, Lin X", "reference": { "type": "PubMed", "id": "25923769", "url": "https://pubmed.ncbi.nlm.nih.gov/25923769" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W266-1", "protein_name": "Protein windpipe", "gene_name": "wdp", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VWE0-1", "protein_name": "Cytokine receptor", "gene_name": "dome", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W266", "url": "https://www.uniprot.org/uniprotkb/Q9W266" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.25923769", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sleep fragmentation and motor restlessness in a Drosophila model of Restless Legs Syndrome.", "journal": "Current biology : CB", "date": "2012-06-19", "authors": "Freeman Amanda, Pranski Elaine, Miller R Daniel, Radmard Sara, Bernhard Doug, Jinnah H A, Betarbet Ranjita, Rye David B, Sanyal Subhabrata", "reference": { "type": "PubMed", "id": "22658601", "url": "https://pubmed.ncbi.nlm.nih.gov/22658601" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W2S3-1", "protein_name": "BTB/POZ domain-containing protein 9", "gene_name": "BTBD9", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q5PQR3-1", "protein_name": "BTB/POZ domain-containing protein 9", "gene_name": "Btbd9", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q8C726-1", "protein_name": "BTB/POZ domain-containing protein 9", "gene_name": "Btbd9", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96Q07-1", "protein_name": "BTB/POZ domain-containing protein 9", "gene_name": "BTBD9", "tax_name": "Human" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W2S3", "url": "https://www.uniprot.org/uniprotkb/Q9W2S3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.22658601", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Frameshift mutations of YPEL3 alter the sensory circuit function in Drosophila.", "journal": "Disease models & mechanisms", "date": "2020-06-03", "authors": "Kim Jung Hwan, Singh Monika, Pan Geng, Lopez Adrian, Zito Nicholas, Bosse Benjamin, Ye Bing", "reference": { "type": "PubMed", "id": "32461240", "url": "https://pubmed.ncbi.nlm.nih.gov/32461240" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W2X7-1", "protein_name": "Protein yippee-like", "gene_name": "Ypel", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W2X7", "url": "https://www.uniprot.org/uniprotkb/Q9W2X7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.32461240", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila Ric-8 regulates Galphai cortical localization to promote Galphai-dependent planar orientation of the mitotic spindle during asymmetric cell division.", "journal": "Nature cell biology", "date": "2005-11", "authors": "David Nicolas B, Martin Charlotte A, Segalen Marion, Rosenfeld Fran\u00e7ois, Schweisguth Fran\u00e7ois, Bella\u00efche Yohanns", "reference": { "type": "PubMed", "id": "16228010", "url": "https://pubmed.ncbi.nlm.nih.gov/16228010" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W358-1", "protein_name": "Chaperone Ric-8", "gene_name": "ric8a", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W358", "url": "https://www.uniprot.org/uniprotkb/Q9W358" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16228010", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila Ric-8 is essential for plasma-membrane localization of heterotrimeric G proteins.", "journal": "Nature cell biology", "date": "2005-11", "authors": "Hampoelz Bernhard, Hoeller Oliver, Bowman Sarah K, Dunican Dara, Knoblich Juergen A", "reference": { "type": "PubMed", "id": "16228011", "url": "https://pubmed.ncbi.nlm.nih.gov/16228011" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W358-1", "protein_name": "Chaperone Ric-8", "gene_name": "ric8a", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W358", "url": "https://www.uniprot.org/uniprotkb/Q9W358" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16228011", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ric-8 controls Drosophila neural progenitor asymmetric division by regulating heterotrimeric G proteins.", "journal": "Nature cell biology", "date": "2005-11", "authors": "Wang Hongyan, Ng Kian Hong, Qian Hongliang, Siderovski David P, Chia William, Yu Fengwei", "reference": { "type": "PubMed", "id": "16228012", "url": "https://pubmed.ncbi.nlm.nih.gov/16228012" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W358-1", "protein_name": "Chaperone Ric-8", "gene_name": "ric8a", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W358", "url": "https://www.uniprot.org/uniprotkb/Q9W358" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16228012", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crag regulates epithelial architecture and polarized deposition of basement membrane proteins in Drosophila.", "journal": "Developmental cell", "date": "2008", "authors": "Denef N, Chen Y, Weeks SD, Barcelo G, Schupbach T", "reference": { "type": "PubMed", "id": "18331716", "url": "https://pubmed.ncbi.nlm.nih.gov/18331716" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W3D3-1", "protein_name": "DENN domain-containing protein Crag", "gene_name": "Crag", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P62152-1", "protein_name": "Calmodulin", "gene_name": "Cam", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W3D3", "url": "https://www.uniprot.org/uniprotkb/Q9W3D3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 161, "end_pos": 1671, "sequence_org": "QSKGERAPHAFCLIYKTLNKGYVGSDVYLCYKKSMYRPKHISYKPEILLRYPTFDHTDFPLNLCPSVPLFCLPMGASLEAWPHVNGTEKRKPISPVFSTFVLTVSDGTYKVYGSALTFYEDYDESKLSAEQKELLGWDEEFGAQHSLHMIKAICLLSHHPFGDTFDKWLKYLHRMVLYDVNIPIPVERYITQLLDEVPFPAPSIHLQLSSESNDRILLTQPEDSPLPRSGAGFHILLQNLGTDNCLHVLLLALTEQKILIHSLRPATLTAVAEAIVSLLFPFKWQCPYIPLCPLGLAEVLHAPLPYLIGVDSRFFDLYEPPTDVTCIDLDTNNISLCESQRHLSPKLLPKRAARLLRQTLTELENAKPISYDSTNSLDRDIRKRKRELVLEQRIQEAFLLFMASILRGYRDFLVPISKAPSVGATDPSALFQLKAFLRSRDKSHQKFFELMMKTQMFIRFIEERSFVSDGDHGLSFFDECAEKVGNYDETPAQLHLVDWDTGQNSERTKYIFPPDSVTPAGSQPGGGGGGLAYNYENFTLQPELLQSTKKTALSKFLQLQLNASLSPGSPIARRTKHEIKLSQKMASRCQQHPEAWSKYLLATCYSLYFLILPSMVLDPRHAGKEPEILRAAYDVLVRASRLKITCDEFCYRIMMQLCGIHNLPVLAVRLHYLMKRSGVQANALTYGFYNRCVLESQWPQDSTTISQIRWNRIKNVVLGAAQFRKAGKQRAASKVNKSLSASQDQNLSTLETVDGQSRTSLASSSGDGGGHGLLDFAAFDRLRNKLGSIVRQTVTGGNNETMGDAVNNTGLLIPGELSAPNTPTYGGDTEILAKALQQQQPRKQIMSIGGGDDDDEDEDEDEYTAGSPSTPQKQLEAGADDLEYAGGGDYEADEEDEDEVDEHVAAQRARQRVQSPTKISPRTPVTQNDPLGALNEEESAASATPTQETQQEQQHSQSQIDSSIYSDKPILFRGQRSATFDESTQIGKSMHRSETMPVASSGVTNSLANIGSSLKFTFGRYSPARLSLKKDLKLPANIIENISSISPSLTGKKSNELIQGSLSSIKSAANSLTKKFDEIKGVISANSTPTKTNNGHHPHGLHHGHHHPHHHHHHHSQHGNAEQEEHDAAVHEEGKLRRVSSDLDPWGRLSESRKSSYNNLVPLGENSSTGALHMHAFPAVPDNLYSLTSENAADRDCDVLIQLTTCSQCHNCSVLVYDEEIMSGWTAEDSNLNTTCHACNKLTVPFLSVQIERQVEESEQSDPLQDGKEQIANGNSHKTSLTVPYLNPLVLRKELENILTQEGDIALIKPEFVDEHPIIYWNLLWLMERIESKTHLPELCLPVPSDKEHIDPLSKVKTVHIQCLWDNLSLHTEASGPPMYLLYRETQPTSPLIKALLTDQAQLNKNVIQQIISAIRCNDFATPLKRLANERHKLKSNGVERSHSFYRDILFLALTAIGRSNVDLATFHREYAAVFDKLTERECNMYYRNQDLPPSASTIFCRAYFRPLLLP", "sequence_mut": "", "comment": "In GG43; larvae lethal.", "evidence": [ { "database": "UniProtKB", "id": "Q9W3D3", "url": "https://www.uniprot.org/uniprotkb/Q9W3D3" }, { "database": "PubMed", "id": "18331716", "url": "https://pubmed.ncbi.nlm.nih.gov/18331716" } ], "uniprot_canonical_ac": "Q9W3D3-1" }, { "start_pos": 367, "end_pos": 1671, "sequence_org": "QLSSESNDRILLTQPEDSPLPRSGAGFHILLQNLGTDNCLHVLLLALTEQKILIHSLRPATLTAVAEAIVSLLFPFKWQCPYIPLCPLGLAEVLHAPLPYLIGVDSRFFDLYEPPTDVTCIDLDTNNISLCESQRHLSPKLLPKRAARLLRQTLTELENAKPISYDSTNSLDRDIRKRKRELVLEQRIQEAFLLFMASILRGYRDFLVPISKAPSVGATDPSALFQLKAFLRSRDKSHQKFFELMMKTQMFIRFIEERSFVSDGDHGLSFFDECAEKVGNYDETPAQLHLVDWDTGQNSERTKYIFPPDSVTPAGSQPGGGGGGLAYNYENFTLQPELLQSTKKTALSKFLQLQLNASLSPGSPIARRTKHEIKLSQKMASRCQQHPEAWSKYLLATCYSLYFLILPSMVLDPRHAGKEPEILRAAYDVLVRASRLKITCDEFCYRIMMQLCGIHNLPVLAVRLHYLMKRSGVQANALTYGFYNRCVLESQWPQDSTTISQIRWNRIKNVVLGAAQFRKAGKQRAASKVNKSLSASQDQNLSTLETVDGQSRTSLASSSGDGGGHGLLDFAAFDRLRNKLGSIVRQTVTGGNNETMGDAVNNTGLLIPGELSAPNTPTYGGDTEILAKALQQQQPRKQIMSIGGGDDDDEDEDEDEYTAGSPSTPQKQLEAGADDLEYAGGGDYEADEEDEDEVDEHVAAQRARQRVQSPTKISPRTPVTQNDPLGALNEEESAASATPTQETQQEQQHSQSQIDSSIYSDKPILFRGQRSATFDESTQIGKSMHRSETMPVASSGVTNSLANIGSSLKFTFGRYSPARLSLKKDLKLPANIIENISSISPSLTGKKSNELIQGSLSSIKSAANSLTKKFDEIKGVISANSTPTKTNNGHHPHGLHHGHHHPHHHHHHHSQHGNAEQEEHDAAVHEEGKLRRVSSDLDPWGRLSESRKSSYNNLVPLGENSSTGALHMHAFPAVPDNLYSLTSENAADRDCDVLIQLTTCSQCHNCSVLVYDEEIMSGWTAEDSNLNTTCHACNKLTVPFLSVQIERQVEESEQSDPLQDGKEQIANGNSHKTSLTVPYLNPLVLRKELENILTQEGDIALIKPEFVDEHPIIYWNLLWLMERIESKTHLPELCLPVPSDKEHIDPLSKVKTVHIQCLWDNLSLHTEASGPPMYLLYRETQPTSPLIKALLTDQAQLNKNVIQQIISAIRCNDFATPLKRLANERHKLKSNGVERSHSFYRDILFLALTAIGRSNVDLATFHREYAAVFDKLTERECNMYYRNQDLPPSASTIFCRAYFRPLLLP", "sequence_mut": "", "comment": "In CJ101; larvae lethal. In egg chambers, follicle cells (FC) display abnormal localization of various apical, junctional and basolateral proteins, and loss of epithelial integrity. In follicle epithelium (FE) cells, the basal membrane proteins, trol, Lam and vkg display abnormal localization; accumulating on the apical side of the cell in addition to the normal basal accumulation. Expression of strat in the FE is reduced. In egg chambers, trol also shows abnormal apical localization at the posterior pole. Many FCs appear irregularly shaped at the poles, form multiple layers and are often found in the germline cluster. FCs on the lateral side however, appear normal.", "evidence": [ { "database": "UniProtKB", "id": "Q9W3D3", "url": "https://www.uniprot.org/uniprotkb/Q9W3D3" }, { "database": "PubMed", "id": "24828534", "url": "https://pubmed.ncbi.nlm.nih.gov/24828534" }, { "database": "PubMed", "id": "18331716", "url": "https://pubmed.ncbi.nlm.nih.gov/18331716" }, { "database": "PubMed", "id": "28228250", "url": "https://pubmed.ncbi.nlm.nih.gov/28228250" } ], "uniprot_canonical_ac": "Q9W3D3-1" }, { "start_pos": 659, "end_pos": 1671, "sequence_org": "WDTGQNSERTKYIFPPDSVTPAGSQPGGGGGGLAYNYENFTLQPELLQSTKKTALSKFLQLQLNASLSPGSPIARRTKHEIKLSQKMASRCQQHPEAWSKYLLATCYSLYFLILPSMVLDPRHAGKEPEILRAAYDVLVRASRLKITCDEFCYRIMMQLCGIHNLPVLAVRLHYLMKRSGVQANALTYGFYNRCVLESQWPQDSTTISQIRWNRIKNVVLGAAQFRKAGKQRAASKVNKSLSASQDQNLSTLETVDGQSRTSLASSSGDGGGHGLLDFAAFDRLRNKLGSIVRQTVTGGNNETMGDAVNNTGLLIPGELSAPNTPTYGGDTEILAKALQQQQPRKQIMSIGGGDDDDEDEDEDEYTAGSPSTPQKQLEAGADDLEYAGGGDYEADEEDEDEVDEHVAAQRARQRVQSPTKISPRTPVTQNDPLGALNEEESAASATPTQETQQEQQHSQSQIDSSIYSDKPILFRGQRSATFDESTQIGKSMHRSETMPVASSGVTNSLANIGSSLKFTFGRYSPARLSLKKDLKLPANIIENISSISPSLTGKKSNELIQGSLSSIKSAANSLTKKFDEIKGVISANSTPTKTNNGHHPHGLHHGHHHPHHHHHHHSQHGNAEQEEHDAAVHEEGKLRRVSSDLDPWGRLSESRKSSYNNLVPLGENSSTGALHMHAFPAVPDNLYSLTSENAADRDCDVLIQLTTCSQCHNCSVLVYDEEIMSGWTAEDSNLNTTCHACNKLTVPFLSVQIERQVEESEQSDPLQDGKEQIANGNSHKTSLTVPYLNPLVLRKELENILTQEGDIALIKPEFVDEHPIIYWNLLWLMERIESKTHLPELCLPVPSDKEHIDPLSKVKTVHIQCLWDNLSLHTEASGPPMYLLYRETQPTSPLIKALLTDQAQLNKNVIQQIISAIRCNDFATPLKRLANERHKLKSNGVERSHSFYRDILFLALTAIGRSNVDLATFHREYAAVFDKLTERECNMYYRNQDLPPSASTIFCRAYFRPLLLP", "sequence_mut": "", "comment": "In CZ085; larvae lethal.", "evidence": [ { "database": "UniProtKB", "id": "Q9W3D3", "url": "https://www.uniprot.org/uniprotkb/Q9W3D3" }, { "database": "PubMed", "id": "18331716", "url": "https://pubmed.ncbi.nlm.nih.gov/18331716" } ], "uniprot_canonical_ac": "Q9W3D3-1" } ], "record_id": "pubmed.18331716", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Rab10-dependent mechanism for polarized basement membrane secretion during organ morphogenesis.", "journal": "Developmental cell", "date": "2013", "authors": "Lerner DW, McCoy D, Isabella AJ, Mahowald AP, Gerlach GF, Chaudhry TA, Horne-Badovinac S", "reference": { "type": "PubMed", "id": "23369713", "url": "https://pubmed.ncbi.nlm.nih.gov/23369713" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W3D3-1", "protein_name": "DENN domain-containing protein Crag", "gene_name": "Crag", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VW71-1", "protein_name": "Fat-like cadherin-related tumor suppressor homolog", "gene_name": "kug", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VMA7-1", "protein_name": "Transport and Golgi organization protein 1", "gene_name": "Tango1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VTH0-1", "protein_name": "Procollagen-lysine,2-oxoglutarate 5-dioxygenase", "gene_name": "Plod", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W3D3", "url": "https://www.uniprot.org/uniprotkb/Q9W3D3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 75, "end_pos": 75, "sequence_org": "G", "sequence_mut": "D", "comment": "Forms round eggs. Intracellular vkg accumulates at the basal surface of follicle cells, and vkg levels are reduced in the basal membrane.", "evidence": [ { "database": "UniProtKB", "id": "Q9VTH0", "url": "https://www.uniprot.org/uniprotkb/Q9VTH0" }, { "database": "PubMed", "id": "23369713", "url": "https://pubmed.ncbi.nlm.nih.gov/23369713" } ], "uniprot_canonical_ac": "Q9VTH0-1" } ], "record_id": "pubmed.23369713", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polarized deposition of basement membrane proteins depends on Phosphatidylinositol synthase and the levels of Phosphatidylinositol 4,5-bisphosphate.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Devergne O, Tsung K, Barcelo G, Schupbach T", "reference": { "type": "PubMed", "id": "24828534", "url": "https://pubmed.ncbi.nlm.nih.gov/24828534" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W3D3-1", "protein_name": "DENN domain-containing protein Crag", "gene_name": "Crag", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8SX37-1", "protein_name": "CDP-diacylglycerol--inositol 3-phosphatidyltransferase", "gene_name": "Pis", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W3D3", "url": "https://www.uniprot.org/uniprotkb/Q9W3D3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 367, "end_pos": 1671, "sequence_org": "QLSSESNDRILLTQPEDSPLPRSGAGFHILLQNLGTDNCLHVLLLALTEQKILIHSLRPATLTAVAEAIVSLLFPFKWQCPYIPLCPLGLAEVLHAPLPYLIGVDSRFFDLYEPPTDVTCIDLDTNNISLCESQRHLSPKLLPKRAARLLRQTLTELENAKPISYDSTNSLDRDIRKRKRELVLEQRIQEAFLLFMASILRGYRDFLVPISKAPSVGATDPSALFQLKAFLRSRDKSHQKFFELMMKTQMFIRFIEERSFVSDGDHGLSFFDECAEKVGNYDETPAQLHLVDWDTGQNSERTKYIFPPDSVTPAGSQPGGGGGGLAYNYENFTLQPELLQSTKKTALSKFLQLQLNASLSPGSPIARRTKHEIKLSQKMASRCQQHPEAWSKYLLATCYSLYFLILPSMVLDPRHAGKEPEILRAAYDVLVRASRLKITCDEFCYRIMMQLCGIHNLPVLAVRLHYLMKRSGVQANALTYGFYNRCVLESQWPQDSTTISQIRWNRIKNVVLGAAQFRKAGKQRAASKVNKSLSASQDQNLSTLETVDGQSRTSLASSSGDGGGHGLLDFAAFDRLRNKLGSIVRQTVTGGNNETMGDAVNNTGLLIPGELSAPNTPTYGGDTEILAKALQQQQPRKQIMSIGGGDDDDEDEDEDEYTAGSPSTPQKQLEAGADDLEYAGGGDYEADEEDEDEVDEHVAAQRARQRVQSPTKISPRTPVTQNDPLGALNEEESAASATPTQETQQEQQHSQSQIDSSIYSDKPILFRGQRSATFDESTQIGKSMHRSETMPVASSGVTNSLANIGSSLKFTFGRYSPARLSLKKDLKLPANIIENISSISPSLTGKKSNELIQGSLSSIKSAANSLTKKFDEIKGVISANSTPTKTNNGHHPHGLHHGHHHPHHHHHHHSQHGNAEQEEHDAAVHEEGKLRRVSSDLDPWGRLSESRKSSYNNLVPLGENSSTGALHMHAFPAVPDNLYSLTSENAADRDCDVLIQLTTCSQCHNCSVLVYDEEIMSGWTAEDSNLNTTCHACNKLTVPFLSVQIERQVEESEQSDPLQDGKEQIANGNSHKTSLTVPYLNPLVLRKELENILTQEGDIALIKPEFVDEHPIIYWNLLWLMERIESKTHLPELCLPVPSDKEHIDPLSKVKTVHIQCLWDNLSLHTEASGPPMYLLYRETQPTSPLIKALLTDQAQLNKNVIQQIISAIRCNDFATPLKRLANERHKLKSNGVERSHSFYRDILFLALTAIGRSNVDLATFHREYAAVFDKLTERECNMYYRNQDLPPSASTIFCRAYFRPLLLP", "sequence_mut": "", "comment": "In CJ101; larvae lethal. In egg chambers, follicle cells (FC) display abnormal localization of various apical, junctional and basolateral proteins, and loss of epithelial integrity. In follicle epithelium (FE) cells, the basal membrane proteins, trol, Lam and vkg display abnormal localization; accumulating on the apical side of the cell in addition to the normal basal accumulation. Expression of strat in the FE is reduced. In egg chambers, trol also shows abnormal apical localization at the posterior pole. Many FCs appear irregularly shaped at the poles, form multiple layers and are often found in the germline cluster. FCs on the lateral side however, appear normal.", "evidence": [ { "database": "UniProtKB", "id": "Q9W3D3", "url": "https://www.uniprot.org/uniprotkb/Q9W3D3" }, { "database": "PubMed", "id": "24828534", "url": "https://pubmed.ncbi.nlm.nih.gov/24828534" }, { "database": "PubMed", "id": "18331716", "url": "https://pubmed.ncbi.nlm.nih.gov/18331716" }, { "database": "PubMed", "id": "28228250", "url": "https://pubmed.ncbi.nlm.nih.gov/28228250" } ], "uniprot_canonical_ac": "Q9W3D3-1" }, { "start_pos": 107, "end_pos": 107, "sequence_org": "C", "sequence_mut": "W", "comment": "In follicle epithelial cells, apical accumulation of the basal membrane protein vkg as apical extracellular aggregates. Crag levels decrease and Crag no longer accumulates at the plasma membrane, instead it has a diffuse cytoplasmic distribution. No direct effect on maintenance of apical-basal polarity in follicle cells.", "evidence": [ { "database": "UniProtKB", "id": "Q8SX37", "url": "https://www.uniprot.org/uniprotkb/Q8SX37" }, { "database": "PubMed", "id": "24828534", "url": "https://pubmed.ncbi.nlm.nih.gov/24828534" } ], "uniprot_canonical_ac": "Q8SX37-1" }, { "start_pos": 75, "end_pos": 75, "sequence_org": "D", "sequence_mut": "N", "comment": "In follicle epithelial cells, decreases extracellular PtdInsP2 on apical and lateral sides of the plasma membrane resulting in the abnormal apical accumulation of basal membrane proteins such as vkg. As a consequence the follicle cells display multiple layers or gaps in the epithelium.", "evidence": [ { "database": "UniProtKB", "id": "Q8SX37", "url": "https://www.uniprot.org/uniprotkb/Q8SX37" }, { "database": "PubMed", "id": "24828534", "url": "https://pubmed.ncbi.nlm.nih.gov/24828534" } ], "uniprot_canonical_ac": "Q8SX37-1" } ], "record_id": "pubmed.24828534", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stratum, a Homolog of the Human GEF Mss4, Partnered with Rab8, Controls the Basal Restriction of Basement Membrane Proteins in Epithelial Cells.", "journal": "Cell reports", "date": "2017", "authors": "Devergne O, Sun GH, Schupbach T", "reference": { "type": "PubMed", "id": "28228250", "url": "https://pubmed.ncbi.nlm.nih.gov/28228250" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W3D3-1", "protein_name": "DENN domain-containing protein Crag", "gene_name": "Crag", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8SX37-1", "protein_name": "CDP-diacylglycerol--inositol 3-phosphatidyltransferase", "gene_name": "Pis", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VLP3-1", "protein_name": "Guanine nucleotide exchange factor MSS4 homolog", "gene_name": "strat", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W3D3", "url": "https://www.uniprot.org/uniprotkb/Q9W3D3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 367, "end_pos": 1671, "sequence_org": "QLSSESNDRILLTQPEDSPLPRSGAGFHILLQNLGTDNCLHVLLLALTEQKILIHSLRPATLTAVAEAIVSLLFPFKWQCPYIPLCPLGLAEVLHAPLPYLIGVDSRFFDLYEPPTDVTCIDLDTNNISLCESQRHLSPKLLPKRAARLLRQTLTELENAKPISYDSTNSLDRDIRKRKRELVLEQRIQEAFLLFMASILRGYRDFLVPISKAPSVGATDPSALFQLKAFLRSRDKSHQKFFELMMKTQMFIRFIEERSFVSDGDHGLSFFDECAEKVGNYDETPAQLHLVDWDTGQNSERTKYIFPPDSVTPAGSQPGGGGGGLAYNYENFTLQPELLQSTKKTALSKFLQLQLNASLSPGSPIARRTKHEIKLSQKMASRCQQHPEAWSKYLLATCYSLYFLILPSMVLDPRHAGKEPEILRAAYDVLVRASRLKITCDEFCYRIMMQLCGIHNLPVLAVRLHYLMKRSGVQANALTYGFYNRCVLESQWPQDSTTISQIRWNRIKNVVLGAAQFRKAGKQRAASKVNKSLSASQDQNLSTLETVDGQSRTSLASSSGDGGGHGLLDFAAFDRLRNKLGSIVRQTVTGGNNETMGDAVNNTGLLIPGELSAPNTPTYGGDTEILAKALQQQQPRKQIMSIGGGDDDDEDEDEDEYTAGSPSTPQKQLEAGADDLEYAGGGDYEADEEDEDEVDEHVAAQRARQRVQSPTKISPRTPVTQNDPLGALNEEESAASATPTQETQQEQQHSQSQIDSSIYSDKPILFRGQRSATFDESTQIGKSMHRSETMPVASSGVTNSLANIGSSLKFTFGRYSPARLSLKKDLKLPANIIENISSISPSLTGKKSNELIQGSLSSIKSAANSLTKKFDEIKGVISANSTPTKTNNGHHPHGLHHGHHHPHHHHHHHSQHGNAEQEEHDAAVHEEGKLRRVSSDLDPWGRLSESRKSSYNNLVPLGENSSTGALHMHAFPAVPDNLYSLTSENAADRDCDVLIQLTTCSQCHNCSVLVYDEEIMSGWTAEDSNLNTTCHACNKLTVPFLSVQIERQVEESEQSDPLQDGKEQIANGNSHKTSLTVPYLNPLVLRKELENILTQEGDIALIKPEFVDEHPIIYWNLLWLMERIESKTHLPELCLPVPSDKEHIDPLSKVKTVHIQCLWDNLSLHTEASGPPMYLLYRETQPTSPLIKALLTDQAQLNKNVIQQIISAIRCNDFATPLKRLANERHKLKSNGVERSHSFYRDILFLALTAIGRSNVDLATFHREYAAVFDKLTERECNMYYRNQDLPPSASTIFCRAYFRPLLLP", "sequence_mut": "", "comment": "In CJ101; larvae lethal. In egg chambers, follicle cells (FC) display abnormal localization of various apical, junctional and basolateral proteins, and loss of epithelial integrity. In follicle epithelium (FE) cells, the basal membrane proteins, trol, Lam and vkg display abnormal localization; accumulating on the apical side of the cell in addition to the normal basal accumulation. Expression of strat in the FE is reduced. In egg chambers, trol also shows abnormal apical localization at the posterior pole. Many FCs appear irregularly shaped at the poles, form multiple layers and are often found in the germline cluster. FCs on the lateral side however, appear normal.", "evidence": [ { "database": "UniProtKB", "id": "Q9W3D3", "url": "https://www.uniprot.org/uniprotkb/Q9W3D3" }, { "database": "PubMed", "id": "24828534", "url": "https://pubmed.ncbi.nlm.nih.gov/24828534" }, { "database": "PubMed", "id": "18331716", "url": "https://pubmed.ncbi.nlm.nih.gov/18331716" }, { "database": "PubMed", "id": "28228250", "url": "https://pubmed.ncbi.nlm.nih.gov/28228250" } ], "uniprot_canonical_ac": "Q9W3D3-1" } ], "record_id": "pubmed.28228250", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retinal targets for calmodulin include proteins implicated in synaptic transmission.", "journal": "The Journal of biological chemistry", "date": "1998-11-20", "authors": "Xu X Z, Wes P D, Chen H, Li H S, Yu M, Morgan S, Liu Y, Montell C", "reference": { "type": "PubMed", "id": "9813038", "url": "https://pubmed.ncbi.nlm.nih.gov/9813038" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W3D3-1", "protein_name": "DENN domain-containing protein Crag", "gene_name": "Crag", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P62152-1", "protein_name": "Calmodulin", "gene_name": "Cam", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VLT5-1", "protein_name": "Protein purity of essence", "gene_name": "poe", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O97790-1", "protein_name": "TBC1 domain family member 1", "gene_name": "TBC1D1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "Q9VBY8-1", "protein_name": "Protein unc-13 homolog 4B", "gene_name": "stac", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W3D3", "url": "https://www.uniprot.org/uniprotkb/Q9W3D3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9813038", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "G protein-coupled receptor kinase 2 is required for rhythmic olfactory responses in Drosophila.", "journal": "Curr. Biol.", "date": "2008", "authors": "Tanoue Shintaro, Krishnan Parthasarathy, Chatterjee Abhishek, Hardin Paul E", "reference": { "type": "PubMed", "id": "18499458", "url": "https://pubmed.ncbi.nlm.nih.gov/18499458" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W3I5-1", "protein_name": "Odorant receptor 7a", "gene_name": "Or7a", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W3I5", "url": "https://www.uniprot.org/uniprotkb/Q9W3I5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.18499458", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bombykol receptors in the silkworm moth and the fruit fly.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010-05-18", "authors": "Syed Zainulabeuddin, Kopp Artyom, Kimbrell Deborah A, Leal Walter S", "reference": { "type": "PubMed", "id": "20439725", "url": "https://pubmed.ncbi.nlm.nih.gov/20439725" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W3I5-1", "protein_name": "Odorant receptor 7a", "gene_name": "Or7a", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W3I5", "url": "https://www.uniprot.org/uniprotkb/Q9W3I5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.20439725", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Double-sieving-defective aminoacyl-tRNA synthetase causes protein mistranslation and affects cellular physiology and development.", "journal": "Nature communications", "date": "2014", "authors": "Lu J, Bergert M, Walther A, Suter B", "reference": { "type": "PubMed", "id": "25427601", "url": "https://pubmed.ncbi.nlm.nih.gov/25427601" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W3J5-1", "protein_name": "Phenylalanine--tRNA ligase alpha subunit", "gene_name": "alpha-PheRS", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCA5-1", "protein_name": "Phenylalanine--tRNA ligase beta subunit", "gene_name": "beta-PheRS", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W3J5", "url": "https://www.uniprot.org/uniprotkb/Q9W3J5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 456, "end_pos": 456, "sequence_org": "A", "sequence_mut": "G", "comment": "Decreased aminoacylation, increased misacylation of non-cognate Tyr, increased amino acid misincorporation, ommatidia defects, neurodegeneration, impaired locomotive performance, reduced lifespan, smaller organ size due to reduced cell proliferation and increased ER stress. Similar but stronger phenotypes except that smaller organ size is due primarily to apoptosis; when associated with 'W-158' in beta subunit.", "evidence": [ { "database": "UniProtKB", "id": "Q9W3J5", "url": "https://www.uniprot.org/uniprotkb/Q9W3J5" }, { "database": "PubMed", "id": "25427601", "url": "https://pubmed.ncbi.nlm.nih.gov/25427601" } ], "uniprot_canonical_ac": "Q9W3J5-1" }, { "start_pos": 158, "end_pos": 158, "sequence_org": "A", "sequence_mut": "W", "comment": "Reduced survival rate after 50 days of age. Decreased aminoacylation, increased misacylation of non-cognate Tyr, increased amino acid misincorporation, ommatidia defects, neurodegeneration, impaired locomotive performance, reduced lifespan, smaller organ size due to apoptosis and increased ER stress; when associated with 'G-456' in alpha subunit.", "evidence": [ { "database": "UniProtKB", "id": "Q9VCA5", "url": "https://www.uniprot.org/uniprotkb/Q9VCA5" }, { "database": "PubMed", "id": "25427601", "url": "https://pubmed.ncbi.nlm.nih.gov/25427601" } ], "uniprot_canonical_ac": "Q9VCA5-1" } ], "record_id": "pubmed.25427601", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two neuronal peptides encoded from a single transcript regulate mitochondrial complex III in Drosophila.", "journal": "eLife", "date": "2022-11-08", "authors": "Bosch Justin A, Ugur Berrak, Pichardo-Casas Israel, Rabasco Jordan, Escobedo Felipe, Zuo Zhongyuan, Brown Ben, Celniker Susan, Sinclair David A, Bellen Hugo J, Perrimon Norbert", "reference": { "type": "PubMed", "id": "36346220", "url": "https://pubmed.ncbi.nlm.nih.gov/36346220" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W3T5-1", "protein_name": "Ubiquinol-cytochrome c reductase complex assembly factor 5", "gene_name": "sloth1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "B7Z0X7-1", "protein_name": "Ubiquinol-cytochrome c reductase complex assembly factor 6", "gene_name": "sloth2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W3T5", "url": "https://www.uniprot.org/uniprotkb/Q9W3T5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.36346220", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparative characterization of Aedes 3-hydroxykynurenine transaminase/alanine glyoxylate transaminase and Drosophila serine pyruvate aminotransferase.", "journal": "FEBS letters", "date": "2002-09-11", "authors": "Han Qian, Li Jianyong", "reference": { "type": "PubMed", "id": "12220660", "url": "https://pubmed.ncbi.nlm.nih.gov/12220660" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W3Z3-1", "protein_name": "Alanine--glyoxylate aminotransferase", "gene_name": "Agxt", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W3Z3", "url": "https://www.uniprot.org/uniprotkb/Q9W3Z3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12220660", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Efficacy of Hydroxy-L-proline (HYP) analogs in the treatment of primary hyperoxaluria in Drosophila Melanogaster.", "journal": "BMC Nephrol.", "date": "2018", "authors": "Yang Huan, Male Musa, Li Yang, Wang Ning, Zhao Chenming, Jin Shan, Hu Juncheng, Chen Zhiqiang, Ye Zhangqun, Xu Hua", "reference": { "type": "PubMed", "id": "29980178", "url": "https://pubmed.ncbi.nlm.nih.gov/29980178" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9W3Z3-1", "protein_name": "Alanine--glyoxylate aminotransferase", "gene_name": "Agxt", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9W3Z3", "url": "https://www.uniprot.org/uniprotkb/Q9W3Z3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.29980178", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamin Binding Protein (Tuba) Deficiency Inhibits Ciliogenesis and Nephrogenesis in Vitro and in Vivo.", "journal": "The Journal of biological chemistry", "date": "2016-04-15", "authors": "Baek Jeong-In, Kwon Sang-Ho, Zuo Xiaofeng, Choi Soo Young, Kim Seok-Hyung, Lipschutz Joshua H", "reference": { "type": "PubMed", "id": "26895965", "url": "https://pubmed.ncbi.nlm.nih.gov/26895965" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "E7F1U2-1", "protein_name": "Dynamin-binding protein", "gene_name": "dnmbp", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "E7F1U2", "url": "https://www.uniprot.org/uniprotkb/E7F1U2" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.26895965", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The 'definitive' (and 'primitive') guide to zebrafish hematopoiesis.", "journal": "Oncogene", "date": "2004", "authors": "Davidson Alan J, Zon Leonard I", "reference": { "type": "PubMed", "id": "15378083", "url": "https://pubmed.ncbi.nlm.nih.gov/15378083" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O73715-1", "protein_name": "LIM domain-binding protein 1-A", "gene_name": "ldb1a; ldb1b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A2BG67-1", "protein_name": "Krueppel-like factor 3", "gene_name": "klf3", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F1QGF8-1", "protein_name": "Paired box protein Pax-5", "gene_name": "pax5", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O73715", "url": "https://www.uniprot.org/uniprotkb/O73715" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.15378083", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spliced isoforms of LIM-domain-binding protein (CLIM/NLI/Ldb) lacking the LIM-interaction domain.", "journal": "J. Biochem.", "date": "2006", "authors": "Tran YH, Xu Z, Kato A, Mistry AC, Goya Y, Taira M, Brandt SJ, Hirose S", "reference": { "type": "PubMed", "id": "16815859", "url": "https://pubmed.ncbi.nlm.nih.gov/16815859" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O73715-1", "protein_name": "LIM domain-binding protein 1-A", "gene_name": "ldb1a; ldb1b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q86U70-1", "protein_name": "LIM domain-binding protein 1", "gene_name": "LDB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P70662-1", "protein_name": "LIM domain-binding protein 1", "gene_name": "Ldb1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O55203-1", "protein_name": "LIM domain-binding protein 2", "gene_name": "Ldb2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O42252-1", "protein_name": "LIM domain-binding protein 1", "gene_name": "LDB1", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "Q9W676-1", "protein_name": "LIM domain-binding protein 2", "gene_name": "LDB2", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "O43679-1", "protein_name": "LIM domain-binding protein 2", "gene_name": "LDB2", "tax_name": "Human" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O73715", "url": "https://www.uniprot.org/uniprotkb/O73715" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.16815859", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel binding partners of Ldb1 are required for haematopoietic development.", "journal": "Development", "date": "2006", "authors": "Meier Natalia, Krpic Sanja, Rodriguez Patrick, Strouboulis John, Monti Maria, Krijgsveld Jeroen, Gering Martin, Patient Roger, Hostert Arnd, Grosveld Frank", "reference": { "type": "PubMed", "id": "17108004", "url": "https://pubmed.ncbi.nlm.nih.gov/17108004" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O73715-1", "protein_name": "LIM domain-binding protein 1-A", "gene_name": "ldb1a; ldb1b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0AB13A7B7-1", "protein_name": "Protein CBFA2T2", "gene_name": "cbfa2t2", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O73715", "url": "https://www.uniprot.org/uniprotkb/O73715" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.17108004", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Centrosome movements in vivo correlate with specific neurite formation downstream of LIM homeodomain transcription factor activity.", "journal": "Development", "date": "2012", "authors": "Andersen Erica F, Halloran Mary C", "reference": { "type": "PubMed", "id": "22899847", "url": "https://pubmed.ncbi.nlm.nih.gov/22899847" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O73715-1", "protein_name": "LIM domain-binding protein 1-A", "gene_name": "ldb1a; ldb1b", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O73715", "url": "https://www.uniprot.org/uniprotkb/O73715" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.22899847", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of LIM-domain binding protein (ldb) genes during zebrafish embryogenesis.", "journal": "Mech. Dev.", "date": "1998", "authors": "Toyama R, Kobayashi M, Tomita T, Dawid I B", "reference": { "type": "PubMed", "id": "9507128", "url": "https://pubmed.ncbi.nlm.nih.gov/9507128" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O73715-1", "protein_name": "LIM domain-binding protein 1-A", "gene_name": "ldb1a; ldb1b", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O73715", "url": "https://www.uniprot.org/uniprotkb/O73715" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.9507128", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ube3d, a New Gene Associated with Age-Related Macular Degeneration, Induces Functional Changes in Both In Vivo and In Vitro Studies.", "journal": "Mol. Ther. Nucleic Acids", "date": "2020", "authors": "Xia Huika, Zhang Qi, Shen Yan, Bai Yujing, Ma Xiaoyun, Zhang Bo, Qi Yun, Zhang Jingjing, Hu Qinrui, Du Wei, Zhu Li, Zhou Peng, Wang Bin, Xu Hui, Huang Lvzhen, Li Xiaoxin", "reference": { "type": "PubMed", "id": "32200270", "url": "https://pubmed.ncbi.nlm.nih.gov/32200270" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F1Q7U1-1", "protein_name": "E3 ubiquitin-protein ligase E3D", "gene_name": "ube3d", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "F1Q7U1", "url": "https://www.uniprot.org/uniprotkb/F1Q7U1" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.32200270", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic landscape of T cells identifies synthetic lethality for T-ALL.", "journal": "Commun. Biol.", "date": "2021", "authors": "O'Meara Connor P, Guerri Lucia, Lawir Divine-Fondzenyuy, Mateos Fernando, Iconomou Mary, Iwanami Norimasa, Soza-Ried Cristian, Sikora Katarzyna, Siamishi Iliana, Giorgetti Orlando, Peter Sarah, Schorpp Michael, Boehm Thomas", "reference": { "type": "PubMed", "id": "34671088", "url": "https://pubmed.ncbi.nlm.nih.gov/34671088" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F1Q7U1-1", "protein_name": "E3 ubiquitin-protein ligase E3D", "gene_name": "ube3d", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "B0V351-1", "protein_name": "DNA polymerase epsilon catalytic subunit", "gene_name": "pole", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "E7EZ02-1", "protein_name": "U6 snRNA-associated Sm-like protein LSm8", "gene_name": "lsm8", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q5TZ15-1", "protein_name": "Proline-rich nuclear receptor coactivator 1", "gene_name": "pnrc1", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F1QIB2-1", "protein_name": "Cleavage stimulation factor subunit 3", "gene_name": "cstf3", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q6DEH7-1", "protein_name": "NEK6-subfamily protein kinase", "gene_name": "nek7", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "F1Q7U1", "url": "https://www.uniprot.org/uniprotkb/F1Q7U1" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.34671088", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zebrafish mitotic kinesin-like protein 1 (Mklp1) functions in embryonic cytokinesis.", "journal": "Physiol. Genomics", "date": "2002", "authors": "Chen Ming-Chyuan, Zhou Yi, Detrich H William", "reference": { "type": "PubMed", "id": "11842131", "url": "https://pubmed.ncbi.nlm.nih.gov/11842131" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O13166-1", "protein_name": "Transducin-like enhancer protein 3-A", "gene_name": "tle3a", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O13166", "url": "https://www.uniprot.org/uniprotkb/O13166" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.11842131", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A homeobox gene, pnx, is involved in the formation of posterior neurons in zebrafish.", "journal": "Development (Cambridge, England)", "date": "2003-05", "authors": "Bae Young-Ki, Shimizu Takashi, Yabe Taijiro, Kim Cheol-Hee, Hirata Tsutomu, Nojima Hideaki, Muraoka Osamu, Hirano Toshio, Hibi Masahiko", "reference": { "type": "PubMed", "id": "12642490", "url": "https://pubmed.ncbi.nlm.nih.gov/12642490" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O13166-1", "protein_name": "Transducin-like enhancer protein 3-A", "gene_name": "tle3a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F1R2J1-1", "protein_name": "Homeobox protein pnx", "gene_name": "pnx", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "B8A4P8-1", "protein_name": "NK1 transcription factor related 2-like,a", "gene_name": "nkx1.2la", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O13166", "url": "https://www.uniprot.org/uniprotkb/O13166" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.12642490", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Duplicated members of the Groucho/Tle gene family in fish.", "journal": "Dev. Dyn.", "date": "2005", "authors": "Aghaallaei Narges, Bajoghli Baubak, Walter Ingrid, Czerny Thomas", "reference": { "type": "PubMed", "id": "16059907", "url": "https://pubmed.ncbi.nlm.nih.gov/16059907" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O13166-1", "protein_name": "Transducin-like enhancer protein 3-A", "gene_name": "tle3a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M3B7Z7-1", "protein_name": "TLE family member 2, transcriptional corepressor c isoform X1", "gene_name": "tle2c", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O13166", "url": "https://www.uniprot.org/uniprotkb/O13166" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.16059907", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Groucho-associated transcriptional repressor ripply1 is required for proper transition from the presomitic mesoderm to somites.", "journal": "Dev. Cell", "date": "2005", "authors": "Kawamura A, Koshida S, Hijikata H, Ohbayashi A, Kondoh H, Takada S", "reference": { "type": "PubMed", "id": "16326386", "url": "https://pubmed.ncbi.nlm.nih.gov/16326386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O13166-1", "protein_name": "Transducin-like enhancer protein 3-A", "gene_name": "tle3a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q2WG77-1", "protein_name": "Protein ripply1", "gene_name": "Ripply1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q2WG76-1", "protein_name": "Protein ripply2", "gene_name": "Ripply2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q5TAB7-1", "protein_name": "Protein ripply2", "gene_name": "RIPPLY2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2WG78-1", "protein_name": "Protein ripply3", "gene_name": "ripply3", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q2WG79-1", "protein_name": "Protein ripply2", "gene_name": "ripply2", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q924S9-1", "protein_name": "Protein ripply3", "gene_name": "Ripply3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P57055-1", "protein_name": "Protein ripply3", "gene_name": "RIPPLY3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0D2K3-1", "protein_name": "Protein ripply1", "gene_name": "RIPPLY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2WG80-1", "protein_name": "Protein ripply1", "gene_name": "ripply1", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O13166", "url": "https://www.uniprot.org/uniprotkb/O13166" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "mutagenesis": [ { "start_pos": 28, "end_pos": 31, "sequence_org": "WRPW", "sequence_mut": "", "comment": "Disrupts gro2-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q2WG80", "url": "https://www.uniprot.org/uniprotkb/Q2WG80" }, { "database": "PubMed", "id": "16326386", "url": "https://pubmed.ncbi.nlm.nih.gov/16326386" } ], "uniprot_canonical_ac": "Q2WG80-1" } ], "record_id": "pubmed.16326386", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tissue-specific derepression of TCF/LEF controls the activity of the Wnt/beta-catenin pathway.", "journal": "Nat. Commun.", "date": "2014", "authors": "Lu Fu-I, Sun Yong-Hua, Wei Chang-Yong, Thisse Christine, Thisse Bernard", "reference": { "type": "PubMed", "id": "25371059", "url": "https://pubmed.ncbi.nlm.nih.gov/25371059" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O13166-1", "protein_name": "Transducin-like enhancer protein 3-A", "gene_name": "tle3a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F1QGH7-1", "protein_name": "Catenin beta-1", "gene_name": "ctnnb1", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q804R0-1", "protein_name": "Transcription factor LBX2", "gene_name": "lbx2", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q9YHE8-1", "protein_name": "Transcription factor 7-like 1-A", "gene_name": "tcf7l1a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "P51028-1", "protein_name": "Protein Wnt-8a", "gene_name": "wnt8a", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O13166", "url": "https://www.uniprot.org/uniprotkb/O13166" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "mutagenesis": [ { "start_pos": 42, "end_pos": 48, "sequence_org": "FSIEDIL", "sequence_mut": "ICLQEFI", "comment": "Abolishes maternal ctnnb1 signaling resulting in a loss of chd expression.", "evidence": [ { "database": "UniProtKB", "id": "Q804R0", "url": "https://www.uniprot.org/uniprotkb/Q804R0" }, { "database": "PubMed", "id": "25371059", "url": "https://pubmed.ncbi.nlm.nih.gov/25371059" } ], "uniprot_canonical_ac": "Q804R0-1" } ], "record_id": "pubmed.25371059", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two zebrafish homologues of the Drosophila neurogenic gene groucho and their pattern of transcription during early embryogenesis.", "journal": "Dev. Genes Evol.", "date": "1997", "authors": "W\u00fclbeck Corinna, Campos-Ortega J A", "reference": { "type": "PubMed", "id": "27747413", "url": "https://pubmed.ncbi.nlm.nih.gov/27747413" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O13166-1", "protein_name": "Transducin-like enhancer protein 3-A", "gene_name": "tle3a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "O13168-1", "protein_name": "Transducin-like enhancer protein 3-B", "gene_name": "tle3b", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O13166", "url": "https://www.uniprot.org/uniprotkb/O13166" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.27747413", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TALE factors use two distinct functional modes to control an essential zebrafish gene expression program.", "journal": "Elife", "date": "2018", "authors": "Ladam Franck, Stanney William, Donaldson Ian J, Yildiz Ozge, Bobola Nicoletta, Sagerstr\u00f6m Charles G", "reference": { "type": "PubMed", "id": "29911973", "url": "https://pubmed.ncbi.nlm.nih.gov/29911973" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O13166-1", "protein_name": "Transducin-like enhancer protein 3-A", "gene_name": "tle3a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M9P2N6-1", "protein_name": "Ephrin type-A receptor 7", "gene_name": "epha7", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F1R9F5-1", "protein_name": "Class E basic helix-loop-helix protein 22", "gene_name": "bhlhe22", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O13166", "url": "https://www.uniprot.org/uniprotkb/O13166" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.29911973", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phenotypic Landscape of Schizophrenia-Associated Genes Defines Candidates and Their Shared Functions.", "journal": "Cell", "date": "2019", "authors": "Thyme Summer B, Pieper Lindsey M, Li Eric H, Pandey Shristi, Wang Yiqun, Morris Nathan S, Sha Carrie, Choi Joo Won, Herrera Kristian J, Soucy Edward R, Zimmerman Steve, Randlett Owen, Greenwood Joel, McCarroll Steven A, Schier Alexander F", "reference": { "type": "PubMed", "id": "30929901", "url": "https://pubmed.ncbi.nlm.nih.gov/30929901" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O13166-1", "protein_name": "Transducin-like enhancer protein 3-A", "gene_name": "tle3a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "B8JHS7-1", "protein_name": "non-specific serine/threonine protein kinase", "gene_name": "vrk2", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A0R4IVS5-1", "protein_name": "Alpha-mannosidase", "gene_name": "man2a1", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A2R8Q8A6-1", "protein_name": "BAF chromatin remodeling complex subunit BCL11B a isoform 1", "gene_name": "bcl11ba", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "B0R111-1", "protein_name": "Zinc finger protein 804A", "gene_name": "znf804a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M3B7Z7-1", "protein_name": "TLE family member 2, transcriptional corepressor c isoform X1", "gene_name": "tle2c", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F1QLR3-1", "protein_name": "RNA-binding protein FXR1", "gene_name": "fxr1", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1PAP8-1", "protein_name": "Phosphoinositide phospholipase C", "gene_name": "plch2a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1NXK4-1", "protein_name": "Protein strawberry notch homolog 1", "gene_name": "sbno1", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1P6S6-1", "protein_name": "BMP/retinoic acid-inducible neural-specific protein 2", "gene_name": "brinp2", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0AB13ABH3-1", "protein_name": "Voltage-dependent L-type calcium channel subunit beta-2b isoform 1", "gene_name": "cacnb2b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F1QXM3-1", "protein_name": "TBC1 domain family member 5", "gene_name": "tbc1d5", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F1QSV4-1", "protein_name": "2.7.7.30; Fucose-1-phosphate guanylyltransferase", "gene_name": "fpgt", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1N588-1", "protein_name": "Carbonic anhydrase-related protein", "gene_name": "ca8", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0AB32TUG0-1", "protein_name": "Voltage-dependent L-type calcium channel subunit beta-2", "gene_name": "cacnb2a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "B8A5M9-1", "protein_name": "Cytochrome c oxidase assembly factor 8", "gene_name": "coa8", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q5TYS4-1", "protein_name": "Signal-induced proliferation-associated 1-like protein 1", "gene_name": "sipa1l1", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "E7FH58-1", "protein_name": "Neurotrimin isoform 1 precursor", "gene_name": "ntm", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F6NTK8-1", "protein_name": "Forkhead box protein G1", "gene_name": "foxg1b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "B8JK76-1", "protein_name": "Serologically defined colon cancer antigen 8 homolog", "gene_name": "Sdccag8; sdccag8", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A2R8Q7T0-1", "protein_name": "Tyrosine-protein kinase", "gene_name": "fes", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A2R8QL27-1", "protein_name": "Carbohydrate sulfotransferase", "gene_name": "chst12a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1NGN8-1", "protein_name": "Kinesin-like protein", "gene_name": "kif5c", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M2B5C5-1", "protein_name": "SATB homeobox 1b isoform X1", "gene_name": "satb1b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M2BHT5-1", "protein_name": "Hyaluronan and proteoglycan link protein 4", "gene_name": "hapln4", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "B8A5N0-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "bag5", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A5PEY8-1", "protein_name": "non-specific serine/threonine protein kinase", "gene_name": "pak6b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1P444-1", "protein_name": "Solute carrier family 35 member G2a", "gene_name": "slc35g2a", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O13166", "url": "https://www.uniprot.org/uniprotkb/O13166" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.30929901", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Medroxyprogesterone acetate affects eye growth and the transcription of associated genes in zebrafish.", "journal": "Ecotoxicol. Environ. Saf.", "date": "2020", "authors": "Shi Wen-Jun, Huang Guo-Yong, Jiang Yu-Xia, Ma Dong-Dong, Chen Hong-Xing, Huang Ming-Zhi, Hou Ling-Ping, Xie Lingtian, Ying Guang-Guo", "reference": { "type": "PubMed", "id": "32114246", "url": "https://pubmed.ncbi.nlm.nih.gov/32114246" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O13166-1", "protein_name": "Transducin-like enhancer protein 3-A", "gene_name": "tle3a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M3AVG1-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "ncor2", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A0R4IXF6-1", "protein_name": "Histone acetyltransferase KAT2A", "gene_name": "kat2a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1PBY6-1", "protein_name": "C-terminal-binding protein 1", "gene_name": "ctbp1l", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0AB32T658-1", "protein_name": "C-terminal-binding protein 2", "gene_name": "ctbp2a", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O13166", "url": "https://www.uniprot.org/uniprotkb/O13166" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.32114246", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nanog safeguards early embryogenesis against global activation of maternal beta-catenin activity by interfering with TCF factors.", "journal": "PLoS Biol.", "date": "2020", "authors": "He Mudan, Zhang Ru, Jiao Shengbo, Zhang Fenghua, Ye Ding, Wang Houpeng, Sun Yonghua", "reference": { "type": "PubMed", "id": "32702011", "url": "https://pubmed.ncbi.nlm.nih.gov/32702011" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O13166-1", "protein_name": "Transducin-like enhancer protein 3-A", "gene_name": "tle3a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0AB32TAA1-1", "protein_name": "Transcription factor 7 isoform X1", "gene_name": "tcf7", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1P9H5-1", "protein_name": "Anti-dorsalizing morphogenic protein precursor", "gene_name": "admp", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O13166", "url": "https://www.uniprot.org/uniprotkb/O13166" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.32702011", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A permissive epigenetic landscape facilitates distinct transcriptional signatures of activating transcription factor 6 in the liver.", "journal": "Genomics", "date": "2022", "authors": "Ramdas Nair A, Lakhiani P, Zhang C, Macchi F, Sadler KC", "reference": { "type": "PubMed", "id": "34863900", "url": "https://pubmed.ncbi.nlm.nih.gov/34863900" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O13166-1", "protein_name": "Transducin-like enhancer protein 3-A", "gene_name": "tle3a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1PA47-1", "protein_name": "DnaJ homolog subfamily B member 1b", "gene_name": "dnajb1b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F1Q4W3-1", "protein_name": "Derlin", "gene_name": "derl1", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M2BBB3-1", "protein_name": "GTP-binding protein 1", "gene_name": "gtpbp1", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "O13166", "url": "https://www.uniprot.org/uniprotkb/O13166" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.34863900", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparison of the expression patterns of newly identified zebrafish retinoic acid and retinoid X receptors.", "journal": "Dev. Dyn.", "date": "2007", "authors": "Waxman Joshua S, Yelon Deborah", "reference": { "type": "PubMed", "id": "17195188", "url": "https://pubmed.ncbi.nlm.nih.gov/17195188" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A2T929-1", "protein_name": "Retinoic acid receptor RXR-alpha-A", "gene_name": "rxraa", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q6DHP9-1", "protein_name": "Retinoic acid receptor RXR-gamma-B", "gene_name": "rxrgb", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q90415-1", "protein_name": "Retinoic acid receptor RXR-alpha-B", "gene_name": "rxrab", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q90416-1", "protein_name": "Retinoic acid receptor RXR-gamma-A", "gene_name": "rxrga", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q91392-1", "protein_name": "Retinoic acid receptor gamma-A", "gene_name": "rarga", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A2T928-1", "protein_name": "Retinoic acid receptor gamma-B", "gene_name": "rargb", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A2T929", "url": "https://www.uniprot.org/uniprotkb/A2T929" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.17195188", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome wide screens in yeast to identify potential binding sites and target genes of DNA-binding proteins.", "journal": "Nucleic Acids Res.", "date": "2008", "authors": "Zeng Jue, Yan Jizhou, Wang Ting, Mosbrook-Davis Deborah, Dolan Kyle T, Christensen Ryan, Stormo Gary D, Haussler David, Lathrop Richard H, Brachmann Rainer K, Burgess Shawn M", "reference": { "type": "PubMed", "id": "18086703", "url": "https://pubmed.ncbi.nlm.nih.gov/18086703" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A2T929-1", "protein_name": "Retinoic acid receptor RXR-alpha-A", "gene_name": "rxraa", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A0R4IMZ8-1", "protein_name": "Importin subunit beta-1", "gene_name": "kpnb1", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1N8I4-1", "protein_name": "G-protein coupled receptor 55a", "gene_name": "gpr55a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1NAI0-1", "protein_name": "Krueppel-like factor 11b", "gene_name": "klf11b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q801V3-1", "protein_name": "Antizyme inhibitor 1b", "gene_name": "azin1b", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A2T929", "url": "https://www.uniprot.org/uniprotkb/A2T929" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.18086703", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sonic hedgehog is a polarized signal for motor neuron regeneration in adult zebrafish.", "journal": "J. Neurosci.", "date": "2009", "authors": "Reimer Michell M, Kuscha Veronika, Wyatt Cameron, S\u00f6rensen Inga, Frank Rebecca E, Kn\u00fcwer Martin, Becker Thomas, Becker Catherina G", "reference": { "type": "PubMed", "id": "19955358", "url": "https://pubmed.ncbi.nlm.nih.gov/19955358" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A2T929-1", "protein_name": "Retinoic acid receptor RXR-alpha-A", "gene_name": "rxraa", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A2T929", "url": "https://www.uniprot.org/uniprotkb/A2T929" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.19955358", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retinoic acid production by endocardium and epicardium is an injury response essential for zebrafish heart regeneration.", "journal": "Dev. Cell", "date": "2011", "authors": "Kikuchi Kazu, Holdway Jennifer E, Major Robert J, Blum Nicola, Dahn Randall D, Begemann Gerrit, Poss Kenneth D", "reference": { "type": "PubMed", "id": "21397850", "url": "https://pubmed.ncbi.nlm.nih.gov/21397850" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A2T929-1", "protein_name": "Retinoic acid receptor RXR-alpha-A", "gene_name": "rxraa", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A2T929", "url": "https://www.uniprot.org/uniprotkb/A2T929" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.21397850", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retinoid X receptor alpha is a spatiotemporally predominant therapeutic target for anthracycline-induced cardiotoxicity.", "journal": "Sci. Adv.", "date": "2020", "authors": "Ma X, Zhu P, Ding Y, Zhang H, Qiu Q, Dvornikov AV, Wang Z, Kim M, Wang Y, Lowerison M, Yu Y, Norton N, Herrmann J, Ekker SC, Hsiai TK, Lin X, Xu X", "reference": { "type": "PubMed", "id": "32064346", "url": "https://pubmed.ncbi.nlm.nih.gov/32064346" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A2T929-1", "protein_name": "Retinoic acid receptor RXR-alpha-A", "gene_name": "rxraa", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M1N882-1", "protein_name": "Alpha-actinin-2b", "gene_name": "actn2b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F8W3I2-1", "protein_name": "Nuclear receptor subfamily 0 group B member 2", "gene_name": "nr0b2a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "B8A4D7-1", "protein_name": "Ribosome-binding protein 1a", "gene_name": "rrbp1a", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A2T929", "url": "https://www.uniprot.org/uniprotkb/A2T929" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.32064346", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Environmental relevant concentrations of benzophenone-3 induced developmental neurotoxicity in zebrafish.", "journal": "Sci. Total Environ.", "date": "2020", "authors": "Tao Junyan, Bai Chenglian, Chen Yuanhong, Zhou Huanhuan, Liu Yahui, Shi Qingyu, Pan Wenhao, Dong Haojia, Li Luyi, Xu Hui, Tanguay Robyn, Huang Changjiang, Dong Qiaoxiang", "reference": { "type": "PubMed", "id": "32169642", "url": "https://pubmed.ncbi.nlm.nih.gov/32169642" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A2T929-1", "protein_name": "Retinoic acid receptor RXR-alpha-A", "gene_name": "rxraa", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A2T929", "url": "https://www.uniprot.org/uniprotkb/A2T929" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.32169642", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Norfluoxetine and venlafaxine in zebrafish larvae: Single and combined toxicity of two pharmaceutical products relevant for risk assessment.", "journal": "J. Hazard. Mater.", "date": "2020", "authors": "Rodrigues P, Cunha V, Oliva-Teles L, Ferreira M, Guimar\u00e3es L", "reference": { "type": "PubMed", "id": "32593945", "url": "https://pubmed.ncbi.nlm.nih.gov/32593945" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A2T929-1", "protein_name": "Retinoic acid receptor RXR-alpha-A", "gene_name": "rxraa", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q90WY4-1", "protein_name": "Alpha-2A adrenergic receptor", "gene_name": "adra2a", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A2T929", "url": "https://www.uniprot.org/uniprotkb/A2T929" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.32593945", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neurobehavioral effects of cyanobacterial biomass field extracts on zebrafish embryos and potential role of retinoids.", "journal": "Aquat. Toxicol.", "date": "2020", "authors": "P\u00edpal Marek, Legradi Jessica, Smutn\u00e1 Marie, Ko\u010d\u00ed Tereza, Priebojov\u00e1 Jana, Bl\u00e1hov\u00e1 Lucie, Krauss Martin, Hilscherov\u00e1 Kl\u00e1ra", "reference": { "type": "PubMed", "id": "32949975", "url": "https://pubmed.ncbi.nlm.nih.gov/32949975" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A2T929-1", "protein_name": "Retinoic acid receptor RXR-alpha-A", "gene_name": "rxraa", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A2T929", "url": "https://www.uniprot.org/uniprotkb/A2T929" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.32949975", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for specific cleavage of Lys6-linked polyubiquitin chains by USP30.", "journal": "Nature structural & molecular biology", "date": "2017-11", "authors": "Sato Yusuke, Okatsu Kei, Saeki Yasushi, Yamano Koji, Matsuda Noriyuki, Kaiho Ai, Yamagata Atsushi, Goto-Ito Sakurako, Ishikawa Minoru, Hashimoto Yuichi, Tanaka Keiji, Fukai Shuya", "reference": { "type": "PubMed", "id": "28945247", "url": "https://pubmed.ncbi.nlm.nih.gov/28945247" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A2BGT0-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 30", "gene_name": "usp30", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "A2BGT0", "url": "https://www.uniprot.org/uniprotkb/A2BGT0" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.28945247", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C2orf62 and TTC17 are involved in actin organization and ciliogenesis in zebrafish and human.", "journal": "PloS one", "date": "2014", "authors": "Bontems Franck, Fish Richard J, Borlat Irene, Lembo Fr\u00e9d\u00e9rique, Chocu Sophie, Chalmel Fr\u00e9d\u00e9ric, Borg Jean-Paul, Pineau Charles, Neerman-Arbez Marguerite, Bairoch Amos, Lane Lydie", "reference": { "type": "PubMed", "id": "24475127", "url": "https://pubmed.ncbi.nlm.nih.gov/24475127" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08CH6-1", "protein_name": "Ciliogenesis-associated TTC17-interacting protein", "gene_name": "catip", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "E7F211-1", "protein_name": "Tetratricopeptide repeat protein 17", "gene_name": "ttc17", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "M0RAU5-1", "protein_name": "Ciliogenesis-associated TTC17-interacting protein", "gene_name": "Catip", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q96AE7-1", "protein_name": "Tetratricopeptide repeat protein 17", "gene_name": "TTC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7H3-1", "protein_name": "Ciliogenesis-associated TTC17-interacting protein", "gene_name": "CATIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "B5DEL3-1", "protein_name": "Tetratricopeptide repeat protein 17", "gene_name": "Ttc17", "tax_name": "Rat" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "Q08CH6", "url": "https://www.uniprot.org/uniprotkb/Q08CH6" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.24475127", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and developmental expression of zebrafish pdzrn3.", "journal": "Int. J. Dev. Biol.", "date": "2011", "authors": "Dente Luciana, Gestri Gaia, Tsang Michael, Kudoh Tetsuhiro, Wilson Stephen W, Dawid Igor B, Andreazzoli Massimiliano", "reference": { "type": "PubMed", "id": "22252497", "url": "https://pubmed.ncbi.nlm.nih.gov/22252497" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "E7FDW2-1", "protein_name": "E3 ubiquitin-protein ligase PDZRN3-B", "gene_name": "pdzrn3b", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "E7FDW2", "url": "https://www.uniprot.org/uniprotkb/E7FDW2" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.22252497", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kidins220/ARMS interacts with Pdzrn3, a protein containing multiple binding domains.", "journal": "Biochimie", "date": "2012", "authors": "Andreazzoli M, Gestri G, Landi E, D'Orsi B, Barilari M, Iervolino A, Vitiello M, Wilson SW, Dente L", "reference": { "type": "PubMed", "id": "22609016", "url": "https://pubmed.ncbi.nlm.nih.gov/22609016" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "E7FDW2-1", "protein_name": "E3 ubiquitin-protein ligase PDZRN3-B", "gene_name": "pdzrn3b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q7T163-1", "protein_name": "Kinase D-interacting substrate of 220 kDa B", "gene_name": "kidins220b", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "E7FDW2", "url": "https://www.uniprot.org/uniprotkb/E7FDW2" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.22609016", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Light Intermediate Chain 2 Subpopulation of Dynein Regulates Mitotic Spindle Orientation.", "journal": "Sci. Rep.", "date": "2016", "authors": "Mahale S, Kumar M, Sharma A, Babu A, Ranjan S, Sachidanandan C, Mylavarapu SVS", "reference": { "type": "PubMed", "id": "28003657", "url": "https://pubmed.ncbi.nlm.nih.gov/28003657" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F1RB89-1", "protein_name": "Dynein light intermediate chain", "gene_name": "dync1li2", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q1LUM9-1", "protein_name": "Dynein light intermediate chain", "gene_name": "dync1li1", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "F1RB89", "url": "https://www.uniprot.org/uniprotkb/F1RB89" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.28003657", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of mitochondria-dynactin interaction and mitochondrial retrograde transport in axons.", "journal": "Elife", "date": "2017", "authors": "Drerup Catherine M, Herbert Amy L, Monk Kelly R, Nechiporuk Alex V", "reference": { "type": "PubMed", "id": "28414272", "url": "https://pubmed.ncbi.nlm.nih.gov/28414272" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F1RB89-1", "protein_name": "Dynein light intermediate chain", "gene_name": "dync1li2", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "F1RB89", "url": "https://www.uniprot.org/uniprotkb/F1RB89" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.28414272", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polarized endosome dynamics engage cytoplasmic Par-3 that recruits dynein during asymmetric cell division.", "journal": "Sci. Adv.", "date": "2021", "authors": "Zhao Xiang, Garcia Jason Q, Tong Kai, Chen Xingye, Yang Bin, Li Qi, Dai Zhipeng, Shi Xiaoyu, Seiple Ian B, Huang Bo, Guo Su", "reference": { "type": "PubMed", "id": "34117063", "url": "https://pubmed.ncbi.nlm.nih.gov/34117063" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F1RB89-1", "protein_name": "Dynein light intermediate chain", "gene_name": "dync1li2", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0AB13A9K4-1", "protein_name": "Par-3 family cell polarity regulator alpha, b isoform 1", "gene_name": "pard3ab", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q1LUM9-1", "protein_name": "Dynein light intermediate chain", "gene_name": "dync1li1", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "F1RB89", "url": "https://www.uniprot.org/uniprotkb/F1RB89" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.34117063", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alk and Ltk ligands are essential for iridophore development in zebrafish mediated by the receptor tyrosine kinase Ltk.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2017-11-07", "authors": "Mo Elizabeth S, Cheng Qianni, Reshetnyak Andrey V, Schlessinger Joseph, Nicoli Stefania", "reference": { "type": "PubMed", "id": "29078341", "url": "https://pubmed.ncbi.nlm.nih.gov/29078341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F8W2C9-1", "protein_name": "ALK and LTK ligand 1", "gene_name": "alkal1", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "E7F5F0-1", "protein_name": "ALK and LTK ligand 2a", "gene_name": "alkal2a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "E7FAP8-1", "protein_name": "ALK and LTK ligand 2b", "gene_name": "alkal2b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F1QVU0-1", "protein_name": "Tyrosine-protein kinase receptor", "gene_name": "ltk", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "F8W3R9-1", "protein_name": "ALK tyrosine kinase receptor", "gene_name": "alk", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0AB13A9Z6-1", "protein_name": "ALK and LTK ligand 2a isoform X1; ALK and LTK ligand 2a precursor", "gene_name": "alkal2a", "tax_name": "Zebrafish" } ], "species": [ { "name": "Danio rerio", "taxid": 7955, "evidence": [ { "database": "UniProtKB", "id": "F8W2C9", "url": "https://www.uniprot.org/uniprotkb/F8W2C9" } ], "common_name": "Zebrafish", "glygen_name": "Zebrafish", "reference_species": "Danio rerio [7955]" } ], "record_id": "pubmed.29078341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]