[ { "title": "The BLOC-1 Subunit Pallidin Facilitates Activity-Dependent Synaptic Vesicle Recycling.", "journal": "eNeuro", "date": "2017", "authors": "Chen Xun, Ma Wenpei, Zhang Shixing, Paluch Jeremy, Guo Wanlin, Dickman Dion K", "reference": { "type": "PubMed", "id": "28317021", "url": "https://pubmed.ncbi.nlm.nih.gov/28317021" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VVT5-1", "protein_name": "Dysbindin protein homolog", "gene_name": "Dysb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1Z9S1-1", "protein_name": "Biogenesis of lysosome-related organelles complex 1 subunit 1", "gene_name": "Blos1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VTM0-1", "protein_name": "Biogenesis of lysosome-related organelles complex 1 subunit 6", "gene_name": "Pldn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VVT5", "url": "https://www.uniprot.org/uniprotkb/Q9VVT5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.28317021", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activating transcription factor 3 regulates immune and metabolic homeostasis.", "journal": "Molecular and cellular biology", "date": "2012-10", "authors": "Rynes Jan, Donohoe Colin D, Frommolt Peter, Brodesser Susanne, Jindra Marek, Uhlirova Mirka", "reference": { "type": "PubMed", "id": "22851689", "url": "https://pubmed.ncbi.nlm.nih.gov/22851689" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9XZS8-1", "protein_name": "Activating transcription factor 3", "gene_name": "Atf3", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9XZS8", "url": "https://www.uniprot.org/uniprotkb/Q9XZS8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.22851689", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An accelerated miRNA-based screen implicates Atf-3 in Drosophila odorant receptor expression.", "journal": "Scientific reports", "date": "2016-02-05", "authors": "Bhat Shreelatha, Jones Walton D", "reference": { "type": "PubMed", "id": "26848073", "url": "https://pubmed.ncbi.nlm.nih.gov/26848073" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9XZS8-1", "protein_name": "Activating transcription factor 3", "gene_name": "Atf3", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9XZS8", "url": "https://www.uniprot.org/uniprotkb/Q9XZS8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.26848073", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila melanogaster homologue of an insect calcitonin-like diuretic peptide stimulates V-ATPase activity in fruit fly Malpighian tubules.", "journal": "The Journal of experimental biology", "date": "2001-05", "authors": "Coast G M, Webster S G, Schegg K M, Tobe S S, Schooley D A", "reference": { "type": "PubMed", "id": "11316500", "url": "https://pubmed.ncbi.nlm.nih.gov/11316500" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VLK4-1", "protein_name": "Diuretic hormone class 2", "gene_name": "Dh31", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VLK4", "url": "https://www.uniprot.org/uniprotkb/Q9VLK4" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11316500", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peptidomics and peptide hormone processing in the Drosophila midgut.", "journal": "Journal of proteome research", "date": "2011", "authors": "Reiher W, Shirras C, Kahnt J, Baumeister S, Isaac RE, Wegener C", "reference": { "type": "PubMed", "id": "21214272", "url": "https://pubmed.ncbi.nlm.nih.gov/21214272" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VLK4-1", "protein_name": "Diuretic hormone class 2", "gene_name": "Dh31", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VIQ0-1", "protein_name": "Short neuropeptide F", "gene_name": "sNPF", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VVF7-1", "protein_name": "Allatostatins MIP", "gene_name": "Mip", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O96690-1", "protein_name": "Protein PDF", "gene_name": "Pdf", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VGE8-1", "protein_name": "Tachykinins", "gene_name": "Tk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q4V4I9-1", "protein_name": "Neuropeptide CCHamide-1", "gene_name": "CCHa1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8SXL2-1", "protein_name": "Neuropeptide CCHamide-2", "gene_name": "CCHa2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VC44-1", "protein_name": "Allatostatin-A", "gene_name": "AstA", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VLK4", "url": "https://www.uniprot.org/uniprotkb/Q9VLK4" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.21214272", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAX inhibitor-1 is a negative regulator of the ER stress sensor IRE1alpha.", "journal": "Molecular cell", "date": "2009-03-27", "authors": "Lisbona Fernanda, Rojas-Rivera Diego, Thielen Peter, Zamorano Sebastian, Todd Derrick, Martinon Fabio, Glavic Alvaro, Kress Christina, Lin Jonathan H, Walter Peter, Reed John C, Glimcher Laurie H, Hetz Claudio", "reference": { "type": "PubMed", "id": "19328063", "url": "https://pubmed.ncbi.nlm.nih.gov/19328063" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VSH3-1", "protein_name": "Bax inhibitor 1", "gene_name": "BI-1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P55061-1", "protein_name": "Bax inhibitor 1", "gene_name": "TMBIM6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75460-1", "protein_name": "Serine/threonine-protein kinase/endoribonuclease IRE1", "gene_name": "ERN1", "tax_name": "Human" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VSH3", "url": "https://www.uniprot.org/uniprotkb/Q9VSH3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.19328063", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAX inhibitor-1 regulates autophagy by controlling the IRE1\u03b1 branch of the unfolded protein response.", "journal": "The EMBO journal", "date": "2011-09-16", "authors": "Castillo Karen, Rojas-Rivera Diego, Lisbona Fernanda, Caballero Benjam\u00edn, Nassif Melissa, Court Felipe A, Schuck Sebastian, Ibar Consuelo, Walter Peter, Sierralta Jimena, Glavic Alvaro, Hetz Claudio", "reference": { "type": "PubMed", "id": "21926971", "url": "https://pubmed.ncbi.nlm.nih.gov/21926971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VSH3-1", "protein_name": "Bax inhibitor 1", "gene_name": "BI-1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48558-1", "protein_name": "Bax inhibitor 1", "gene_name": "BXI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9D2C7-1", "protein_name": "Bax inhibitor 1", "gene_name": "Tmbim6", "tax_name": "Mouse" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VSH3", "url": "https://www.uniprot.org/uniprotkb/Q9VSH3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.21926971", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A subset of Drosophila integrator proteins is essential for efficient U7 snRNA and spliceosomal snRNA 3'-end formation.", "journal": "Molecular and cellular biology", "date": "2011-01", "authors": "Ezzeddine Nader, Chen Jiandong, Waltenspiel Bernhard, Burch Brandon, Albrecht Todd, Zhuo Ming, Warren William D, Marzluff William F, Wagner Eric J", "reference": { "type": "PubMed", "id": "21078872", "url": "https://pubmed.ncbi.nlm.nih.gov/21078872" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q95TS5-1", "protein_name": "Integrator complex subunit 9", "gene_name": "IntS9", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VFS6-1", "protein_name": "Integrator complex subunit 5", "gene_name": "omd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VT41-1", "protein_name": "Integrator complex subunit 7", "gene_name": "defl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1ZAK1-1", "protein_name": "Integrator complex subunit 8", "gene_name": "IntS8", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7PLS8-1", "protein_name": "Integrator complex subunit 3", "gene_name": "IntS3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VBB3-1", "protein_name": "Integrator complex subunit 12", "gene_name": "IntS12", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VE51-1", "protein_name": "Cleavage and polyadenylation specificity factor 73", "gene_name": "Cpsf73", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VX31-1", "protein_name": "Integrator complex subunit 2", "gene_name": "IntS2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VZM7-1", "protein_name": "Integrator complex subunit 10", "gene_name": "IntS10", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W3E1-1", "protein_name": "Integrator complex subunit 4", "gene_name": "IntS4", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W485-1", "protein_name": "Integrator complex subunit 6", "gene_name": "IntS6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VAH9-1", "protein_name": "Integrator complex subunit 11", "gene_name": "IntS11", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W1C5-1", "protein_name": "Integrator complex subunit 1", "gene_name": "IntS1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q95TS5", "url": "https://www.uniprot.org/uniprotkb/Q95TS5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.21078872", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An RNAi screen identifies additional members of the Drosophila Integrator complex and a requirement for cyclin C/Cdk8 in snRNA 3'-end formation.", "journal": "RNA (New York, N.Y.)", "date": "2012-12", "authors": "Chen Jiandong, Ezzeddine Nader, Waltenspiel Bernhard, Albrecht Todd R, Warren William D, Marzluff William F, Wagner Eric J", "reference": { "type": "PubMed", "id": "23097424", "url": "https://pubmed.ncbi.nlm.nih.gov/23097424" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q95TS5-1", "protein_name": "Integrator complex subunit 9", "gene_name": "IntS9", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VFS6-1", "protein_name": "Integrator complex subunit 5", "gene_name": "omd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VT41-1", "protein_name": "Integrator complex subunit 7", "gene_name": "defl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1ZAK1-1", "protein_name": "Integrator complex subunit 8", "gene_name": "IntS8", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7PLS8-1", "protein_name": "Integrator complex subunit 3", "gene_name": "IntS3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VBB3-1", "protein_name": "Integrator complex subunit 12", "gene_name": "IntS12", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VX31-1", "protein_name": "Integrator complex subunit 2", "gene_name": "IntS2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VZM7-1", "protein_name": "Integrator complex subunit 10", "gene_name": "IntS10", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W3E1-1", "protein_name": "Integrator complex subunit 4", "gene_name": "IntS4", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W485-1", "protein_name": "Integrator complex subunit 6", "gene_name": "IntS6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VPY0-1", "protein_name": "Integrator complex subunit 14", "gene_name": "IntS14", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VAH9-1", "protein_name": "Integrator complex subunit 11", "gene_name": "IntS11", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W1C5-1", "protein_name": "Integrator complex subunit 1", "gene_name": "IntS1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VEX5-1", "protein_name": "Protein asunder", "gene_name": "Asun", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q95TS5", "url": "https://www.uniprot.org/uniprotkb/Q95TS5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.23097424", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of the integrator subunit 12 identifies a microdomain that mediates activation of the Drosophila integrator complex.", "journal": "J. Biol. Chem.", "date": "2013", "authors": "Chen Jiandong, Waltenspiel Bernhard, Warren William D, Wagner Eric J", "reference": { "type": "PubMed", "id": "23288851", "url": "https://pubmed.ncbi.nlm.nih.gov/23288851" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q95TS5-1", "protein_name": "Integrator complex subunit 9", "gene_name": "IntS9", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VBB3-1", "protein_name": "Integrator complex subunit 12", "gene_name": "IntS12", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W1C5-1", "protein_name": "Integrator complex subunit 1", "gene_name": "IntS1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q95TS5", "url": "https://www.uniprot.org/uniprotkb/Q95TS5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.23288851", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Integrator complex cleaves nascent mRNAs to attenuate transcription.", "journal": "Genes Dev.", "date": "2019", "authors": "Tatomer Deirdre C, Elrod Nathan D, Liang Dongming, Xiao Mei-Sheng, Jiang Jeffrey Z, Jonathan Michael, Huang Kai-Lieh, Wagner Eric J, Cherry Sara, Wilusz Jeremy E", "reference": { "type": "PubMed", "id": "31530651", "url": "https://pubmed.ncbi.nlm.nih.gov/31530651" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q95TS5-1", "protein_name": "Integrator complex subunit 9", "gene_name": "IntS9", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VFS6-1", "protein_name": "Integrator complex subunit 5", "gene_name": "omd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VT41-1", "protein_name": "Integrator complex subunit 7", "gene_name": "defl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1ZAK1-1", "protein_name": "Integrator complex subunit 8", "gene_name": "IntS8", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7PLS8-1", "protein_name": "Integrator complex subunit 3", "gene_name": "IntS3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VBB3-1", "protein_name": "Integrator complex subunit 12", "gene_name": "IntS12", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VX31-1", "protein_name": "Integrator complex subunit 2", "gene_name": "IntS2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VZM7-1", "protein_name": "Integrator complex subunit 10", "gene_name": "IntS10", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W3E1-1", "protein_name": "Integrator complex subunit 4", "gene_name": "IntS4", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W485-1", "protein_name": "Integrator complex subunit 6", "gene_name": "IntS6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VPY0-1", "protein_name": "Integrator complex subunit 14", "gene_name": "IntS14", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VAH9-1", "protein_name": "Integrator complex subunit 11", "gene_name": "IntS11", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W1C5-1", "protein_name": "Integrator complex subunit 1", "gene_name": "IntS1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VEX5-1", "protein_name": "Protein asunder", "gene_name": "Asun", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q95TS5", "url": "https://www.uniprot.org/uniprotkb/Q95TS5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 203, "end_pos": 203, "sequence_org": "E", "sequence_mut": "Q", "comment": "Abolished RNA endonuclease activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9VAH9", "url": "https://www.uniprot.org/uniprotkb/Q9VAH9" }, { "database": "PubMed", "id": "31809743", "url": "https://pubmed.ncbi.nlm.nih.gov/31809743" }, { "database": "PubMed", "id": "31530651", "url": "https://pubmed.ncbi.nlm.nih.gov/31530651" } ], "uniprot_canonical_ac": "Q9VAH9-1" } ], "record_id": "pubmed.31530651", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Integrator complex attenuates promoter-proximal transcription at protein-coding genes.", "journal": "Mol. Cell", "date": "2019", "authors": "Elrod Nathan D, Henriques Telmo, Huang Kai-Lieh, Tatomer Deirdre C, Wilusz Jeremy E, Wagner Eric J, Adelman Karen", "reference": { "type": "PubMed", "id": "31809743", "url": "https://pubmed.ncbi.nlm.nih.gov/31809743" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q95TS5-1", "protein_name": "Integrator complex subunit 9", "gene_name": "IntS9", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VAH9-1", "protein_name": "Integrator complex subunit 11", "gene_name": "IntS11", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q95TS5", "url": "https://www.uniprot.org/uniprotkb/Q95TS5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 203, "end_pos": 203, "sequence_org": "E", "sequence_mut": "Q", "comment": "Abolished RNA endonuclease activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9VAH9", "url": "https://www.uniprot.org/uniprotkb/Q9VAH9" }, { "database": "PubMed", "id": "31809743", "url": "https://pubmed.ncbi.nlm.nih.gov/31809743" }, { "database": "PubMed", "id": "31530651", "url": "https://pubmed.ncbi.nlm.nih.gov/31530651" } ], "uniprot_canonical_ac": "Q9VAH9-1" } ], "record_id": "pubmed.31809743", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inositol hexakisphosphate is required for Integrator function.", "journal": "Nature communications", "date": "2022-09-30", "authors": "Lin Min-Han, Jensen Madeline K, Elrod Nathan D, Huang Kai-Lieh, Welle Kevin A, Wagner Eric J, Tong Liang", "reference": { "type": "PubMed", "id": "36180473", "url": "https://pubmed.ncbi.nlm.nih.gov/36180473" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q95TS5-1", "protein_name": "Integrator complex subunit 9", "gene_name": "IntS9", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W3E1-1", "protein_name": "Integrator complex subunit 4", "gene_name": "IntS4", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VAH9-1", "protein_name": "Integrator complex subunit 11", "gene_name": "IntS11", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q95TS5", "url": "https://www.uniprot.org/uniprotkb/Q95TS5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 504, "end_pos": 509, "sequence_org": "RLPLKR", "sequence_mut": "ELPLEE", "comment": "Abolished interaction with Inositol hexakisphosphate leading to impaired integrator complex function.", "evidence": [ { "database": "UniProtKB", "id": "Q95TS5", "url": "https://www.uniprot.org/uniprotkb/Q95TS5" }, { "database": "PubMed", "id": "36180473", "url": "https://pubmed.ncbi.nlm.nih.gov/36180473" } ], "uniprot_canonical_ac": "Q95TS5-1" }, { "start_pos": 462, "end_pos": 462, "sequence_org": "K", "sequence_mut": "E", "comment": "Abolished interaction with Inositol hexakisphosphate leading to impaired integrator complex function.", "evidence": [ { "database": "UniProtKB", "id": "Q9VAH9", "url": "https://www.uniprot.org/uniprotkb/Q9VAH9" }, { "database": "PubMed", "id": "36180473", "url": "https://pubmed.ncbi.nlm.nih.gov/36180473" } ], "uniprot_canonical_ac": "Q9VAH9-1" } ], "record_id": "pubmed.36180473", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A complex of Armadillo, Legless, and Pygopus coactivates dTCF to activate wingless target genes.", "journal": "Current biology : CB", "date": "2004", "authors": "Thompson BJ", "reference": { "type": "PubMed", "id": "15043810", "url": "https://pubmed.ncbi.nlm.nih.gov/15043810" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q961D9-1", "protein_name": "Protein BCL9 homolog", "gene_name": "lgs", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P16371-1", "protein_name": "Protein groucho", "gene_name": "gro", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P18824-1", "protein_name": "Armadillo segment polarity protein", "gene_name": "arm", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V9W8-1", "protein_name": "Protein pygopus", "gene_name": "pygo", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8IMA8-1", "protein_name": "Protein pangolin, isoform J", "gene_name": "pan", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q961D9", "url": "https://www.uniprot.org/uniprotkb/Q961D9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15043810", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Leading edge-secreted Dpp cooperates with ACK-dependent signaling from the amnioserosa to regulate myosin levels during dorsal closure.", "journal": "Dev. Dyn.", "date": "2008", "authors": "Zahedi Baharak, Shen Weiping, Xu Xing, Chen Xi, Mahey Meena, Harden Nicholas", "reference": { "type": "PubMed", "id": "18816840", "url": "https://pubmed.ncbi.nlm.nih.gov/18816840" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99323-3", "protein_name": "Myosin heavy chain, non-muscle", "gene_name": "zip", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9I7F7-1", "protein_name": "Activated Cdc42 kinase-like", "gene_name": "Ack-like", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VZI2-1", "protein_name": "Activated Cdc42 kinase Ack", "gene_name": "Ack", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q99323", "url": "https://www.uniprot.org/uniprotkb/Q99323" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.18816840", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complete sequence of the Drosophila nonmuscle myosin heavy-chain transcript: conserved sequences in the myosin tail and differential splicing in the 5' untranslated sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990-08", "authors": "Ketchum A S, Stewart C T, Stewart M, Kiehart D P", "reference": { "type": "PubMed", "id": "2117279", "url": "https://pubmed.ncbi.nlm.nih.gov/2117279" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99323-3", "protein_name": "Myosin heavy chain, non-muscle", "gene_name": "zip", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q99323", "url": "https://www.uniprot.org/uniprotkb/Q99323" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2117279", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The E3 ligase Ubr3 regulates Usher syndrome and MYH9 disorder proteins in the auditory organs of Drosophila and mammals.", "journal": "eLife", "date": "2016", "authors": "Li T, Giagtzoglou N, Eberl DF, Jaiswal SN, Cai T, Godt D, Groves AK, Bellen HJ", "reference": { "type": "PubMed", "id": "27331610", "url": "https://pubmed.ncbi.nlm.nih.gov/27331610" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99323-3", "protein_name": "Myosin heavy chain, non-muscle", "gene_name": "zip", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24311-1", "protein_name": "Cullin homolog 1", "gene_name": "Cul1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3Z6-1", "protein_name": "Myosin-VIIa", "gene_name": "ck", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VAF5-1", "protein_name": "Cadherin-99C", "gene_name": "Cad99C", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P35579-1", "protein_name": "Myosin-9", "gene_name": "MYH9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97479-1", "protein_name": "Unconventional myosin-VIIa", "gene_name": "Myo7a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q5U430-1", "protein_name": "E3 ubiquitin-protein ligase UBR3", "gene_name": "Ubr3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6ZT12-1", "protein_name": "E3 ubiquitin-protein ligase UBR3", "gene_name": "UBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13402-1", "protein_name": "Unconventional myosin-VIIa", "gene_name": "MYO7A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9W5E1-1", "protein_name": "RING-box protein 1A", "gene_name": "Roc1a", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W3M3-1", "protein_name": "E3 ubiquitin-protein ligase Ubr3", "gene_name": "Ubr3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8VDD5-1", "protein_name": "Myosin-9", "gene_name": "Myh9", "tax_name": "Mouse" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q99323", "url": "https://www.uniprot.org/uniprotkb/Q99323" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 1255, "end_pos": 1255, "sequence_org": "R", "sequence_mut": "C", "comment": "Large percentage of detached scolopidia in Johnston's organs but no effect on interaction with ck.", "evidence": [ { "database": "UniProtKB", "id": "Q99323", "url": "https://www.uniprot.org/uniprotkb/Q99323" }, { "database": "PubMed", "id": "27331610", "url": "https://pubmed.ncbi.nlm.nih.gov/27331610" } ], "uniprot_canonical_ac": "Q99323-3" }, { "start_pos": 1514, "end_pos": 1514, "sequence_org": "D", "sequence_mut": "N", "comment": "Small percentage of detached scolopidia in Johnston's organs but no effect on interaction with ck.", "evidence": [ { "database": "UniProtKB", "id": "Q99323", "url": "https://www.uniprot.org/uniprotkb/Q99323" }, { "database": "PubMed", "id": "27331610", "url": "https://pubmed.ncbi.nlm.nih.gov/27331610" } ], "uniprot_canonical_ac": "Q99323-3" }, { "start_pos": 1931, "end_pos": 1931, "sequence_org": "D", "sequence_mut": "K", "comment": "Increased interaction with ck and large percentage of detached scolopidia in Johnston's organs.", "evidence": [ { "database": "UniProtKB", "id": "Q99323", "url": "https://www.uniprot.org/uniprotkb/Q99323" }, { "database": "PubMed", "id": "27331610", "url": "https://pubmed.ncbi.nlm.nih.gov/27331610" } ], "uniprot_canonical_ac": "Q99323-3" }, { "start_pos": 2023, "end_pos": 2023, "sequence_org": "R", "sequence_mut": "X", "comment": "Small percentage of detached scolopidia in Johnston's organs but no effect on interaction with ck.", "evidence": [ { "database": "UniProtKB", "id": "Q99323", "url": "https://www.uniprot.org/uniprotkb/Q99323" }, { "database": "PubMed", "id": "27331610", "url": "https://pubmed.ncbi.nlm.nih.gov/27331610" } ], "uniprot_canonical_ac": "Q99323-3" }, { "start_pos": 949, "end_pos": 949, "sequence_org": "F", "sequence_mut": "L", "comment": "In eye imaginal disks, hh signaling is impaired resulting in delayed differentiation of photoreceptors in the morphogenetic furrow. In Johnston's organs, results in reduced auditory transduction. Often the filamentous structure of NompA at the apical junction of the neuronal cilium and antennal cuticle collapses into puncta resulting in the detachment of scolopidia from the hinge of the second and third antennal segment.", "evidence": [ { "database": "UniProtKB", "id": "Q9W3M3", "url": "https://www.uniprot.org/uniprotkb/Q9W3M3" }, { "database": "PubMed", "id": "27195754", "url": "https://pubmed.ncbi.nlm.nih.gov/27195754" }, { "database": "PubMed", "id": "27331610", "url": "https://pubmed.ncbi.nlm.nih.gov/27331610" } ], "uniprot_canonical_ac": "Q9W3M3-1" } ], "record_id": "pubmed.27331610", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interplay between integrins and PI4P5K Sktl is crucial for cell polarization and reepithelialisation during Drosophila wound healing.", "journal": "Scientific reports", "date": "2019-11-08", "authors": "Park Si-Hyoung, Lee Chan-Wool, Choe Kwang-Min", "reference": { "type": "PubMed", "id": "31704968", "url": "https://pubmed.ncbi.nlm.nih.gov/31704968" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99323-3", "protein_name": "Myosin heavy chain, non-muscle", "gene_name": "zip", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P92208-1", "protein_name": "Stress-activated protein kinase JNK", "gene_name": "bsk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W2R3-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 sktl", "gene_name": "sktl", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q99323", "url": "https://www.uniprot.org/uniprotkb/Q99323" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.31704968", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular organization and alternative splicing in zipper, the gene that encodes the Drosophila non-muscle myosin II heavy chain.", "journal": "Journal of molecular biology", "date": "1996-01-12", "authors": "Mansfield S G, al-Shirawi D Y, Ketchum A S, Newbern E C, Kiehart D P", "reference": { "type": "PubMed", "id": "8568878", "url": "https://pubmed.ncbi.nlm.nih.gov/8568878" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99323-3", "protein_name": "Myosin heavy chain, non-muscle", "gene_name": "zip", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q99323", "url": "https://www.uniprot.org/uniprotkb/Q99323" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8568878", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and genetic characterisation of the Drosophila homologue of (SCE)REV3, encoding the catalytic subunit of DNA polymerase zeta.", "journal": "Mutation research", "date": "2001", "authors": "Eeken JC, Romeijn RJ, de Jong AW, Pastink A, Lohman PH", "reference": { "type": "PubMed", "id": "11267835", "url": "https://pubmed.ncbi.nlm.nih.gov/11267835" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GSR1-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "PolZ1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9GSR1", "url": "https://www.uniprot.org/uniprotkb/Q9GSR1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 14, "end_pos": 2130, "sequence_org": "VRLVIADFYMEKPQFGMDPCYSELRGKEIKRVPVIRVFGGNSRGQKTCMHVHGVFPYLYIPYDKKDFESLERGILQMAMHLDKAINISLGQGSSNAQHVFKIQLVKGIPFYGYHRVEHQFLKIYMFNPRFVRRAANLLQSGAILSKNFSPHESHVPYILQFMIDYNLYGMSYVHVPLEVLKFRRNHDDDVIPYANVKQAQLLDITTAKKVACSALEVDVSSNFILNRFQLVAKSKSNHTNPGIEAIWNDEKLRRQKLVEKHTDAGDEEKAEAVPVLELPPTQERHQIEIAESDIFYRTALESKLMTLEQSTLSEQTLSDQTILPQATMQTTMPGTKAQKRRFNLQKLLANAVYPEECSQDQQQLLVNASFIQNHVTCGYSSSVSLSTSKDESDDLDETVVDEELILSLTQPHGAIPHDATLREEDLELLDALQLLEEQNESESHVDLDSSLAPLSQHKKFELTPELLDKETAATAALFDEDVDSDEDADQETRHDFSTVLDDVDELLLKLTQSQPAESKELKASSKLPQIDGADDRLQRTPIKSISSKSKSSPSKTPTTPIGQKSLPKSPRTPKTSAAKKYAPLALTIGSSSSKKSNDEFAGRPSNPRLSLQLDQGTGTGTLRPEISLRKKLAMSEMRRKSFEDSFVLLKNDCTPVRSTRRSTSNLDKTHIICSLTPRDRNPGLSDMFETEDGKQLPPKKVVRKTRWSTRNQDIESLPKAGCEIERPHRSEGSALDELKPRRSARHKVNSANPDECSSEIQTTGPRVTTTSLDRPQKKARLSQSPKENTKTSMNGTVALEKATKDSSSNSESPHQQENSVSEQIEYLESKPKKSDETARSCDEKLQRELIPQEPAGISPGDSANSTEEITFSPCHDEAIESDTESDYIVTKLRKTPNLKRLRWSIRSELLNKQFTPSSGIRPPETETTPQLSPKSNESNTPELMRSFYEHSLIVNSPSVFSDFLDSPEIHMDSPRSAPPSPDSNSFVIAPLELPPSYDEVVSGSRKMDIPEYEFQKPYYSNPSDVSKVTEVGFLVLHIPGNKLNDCDPFQSILGNDRGLASWRRRQLIAIGGLAMLQRHRGEQKVREYFSTQQRIAIEPAQLAPTWQEAKIWLKAKELLRQREEPKKSSDDIDSPIKIKRQKITMMLQAEEGDGGSGDEDAGEELDCSLSLTPLSQAKDKCKATPTSSKARETGKSRLKRGTRLSFIGSQDEEPPSSQSSEQSVSSSAAQAELDRSSFLRQLEGSSQDRQHDLSFGLSHATLDNTFGFKVNLENLQQAKADIDCNHLTIITLEVFVSTRGDLQPDPMHDEIRCLFYAIEHSLPDEKLPSKACGYIMVNTVQDLLSEGPFHGIDRDIEVQVVTSEAEAFEALLALCERWDADIYAGYEIEMSSWGYVIDRAKHLCFNIAPLLSRVPTQKVRDFVDEDREQFTDLDVEMKLCGRILLDVWRLMRSEIALTSYTFENVMYHILHKRCPWHTAKSLTEWFGSPCTRWIVMEYYLERVRGTLTLLDQLDLLGRTSEMAKLIGIQFYEVLSRGSQFRVESMMLRIAKPKNLVPLSPSVQARAHMRAPEYLALIMEPQSRFYADPLIVLDFQSLYPSMIIAYNYCFSTCLGRVEHLGGSSPFEFGASQLRVSRQMLQKLLEHDLVTVSPCGVVFVKREVREGILPRMLTEILDTRQMVKQSMKLHKDSSALQRILHSRQLGLKLMANVTYGYTAANFSGRMPSVEVGDSVVSKGRETLERAIKLVENNEEWKVRVVYGDTDSMFVLVPGRNRAEAFRIGEEIAKAVTEMNPQPVKLKLEKVYQPCMLQTKKRYVGYMYETADQEQPVYEAKGIETVRRDGCPAVAKMLEKVLRILFETQDVSKIKAYVCRQFTKLLSGRANLQDLIFAKEFRGLNGYKPTACVPALELTRKWMQKDPRHVPRRGERVPFIIVNGPPGMQLIRLVRSPHDILANEGHKINAIYYITKAIIPPLNRCLLLIGANVHDWFASLPRKLLMTPAVGTANELAGARGAKSTISQYFSTTSCVIDCGRQTKAGICPDCLKNATTCVVVLSDKTARLERGYQLTRQICQACCGRLGSLQCDSLDCPVLYVLEGKRRELQQIEHWNKLLEHHF", "sequence_mut": "", "comment": "In mus205; hypersensitive to alkylating agents and UV, but not sensitive to ionising radiation. In somatic cells, no effect on methyl methane sulfonate-induced mutations and homologous recombination. In germ cells, no effect on mutability by X-rays, NQO and alkylating agents.", "evidence": [ { "database": "UniProtKB", "id": "Q9GSR1", "url": "https://www.uniprot.org/uniprotkb/Q9GSR1" }, { "database": "PubMed", "id": "11267835", "url": "https://pubmed.ncbi.nlm.nih.gov/11267835" } ], "uniprot_canonical_ac": "Q9GSR1-1" } ], "record_id": "pubmed.11267835", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification of Drosophila DNA polymerase zeta by REV1 protein-affinity chromatography.", "journal": "The Biochemical journal", "date": "2004-09-01", "authors": "Takeuchi Ryo, Oshige Masahiko, Uchida Makiyo, Ishikawa Gen, Takata Kei-ichi, Shimanouchi Kaori, Kanai Yoshihiro, Ruike Tatsushi, Morioka Hiroshi, Sakaguchi Kengo", "reference": { "type": "PubMed", "id": "15175013", "url": "https://pubmed.ncbi.nlm.nih.gov/15175013" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GSR1-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "PolZ1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VNE1-1", "protein_name": "DNA polymerase zeta subunit 2", "gene_name": "PolZ2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9GSR1", "url": "https://www.uniprot.org/uniprotkb/Q9GSR1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15175013", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila DNA polymerase zeta interacts with recombination repair protein 1, the Drosophila homologue of human abasic endonuclease 1.", "journal": "The Journal of biological chemistry", "date": "2006-04-28", "authors": "Takeuchi Ryo, Ruike Tatsushi, Nakamura Ryo-ichi, Shimanouchi Kaori, Kanai Yoshihiro, Abe Yoko, Ihara Ayumi, Sakaguchi Kengo", "reference": { "type": "PubMed", "id": "16507570", "url": "https://pubmed.ncbi.nlm.nih.gov/16507570" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GSR1-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "PolZ1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P27864-1", "protein_name": "Recombination repair protein 1", "gene_name": "Rrp1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VNE1-1", "protein_name": "DNA polymerase zeta subunit 2", "gene_name": "PolZ2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9GSR1", "url": "https://www.uniprot.org/uniprotkb/Q9GSR1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16507570", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Competition between replicative and translesion polymerases during homologous recombination repair in Drosophila.", "journal": "PLoS genetics", "date": "2012", "authors": "Kane DP, Shusterman M, Rong Y, McVey M", "reference": { "type": "PubMed", "id": "22532806", "url": "https://pubmed.ncbi.nlm.nih.gov/22532806" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GSR1-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "PolZ1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9Y118-1", "protein_name": "DNA polymerase delta subunit 3", "gene_name": "PolD3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VNX1-1", "protein_name": "DNA polymerase eta", "gene_name": "PolH", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W0P2-1", "protein_name": "DNA repair protein Rev1", "gene_name": "Rev1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9GSR1", "url": "https://www.uniprot.org/uniprotkb/Q9GSR1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 15, "end_pos": 431, "sequence_org": "DRCVLVTDLLEEYKLSYKEVNDVLEAYIKEQEPATKFEKRFLVHGKRKTQGSDSGEDLYSVVLESRMQDWLAKVQDAESQLYSVKIAGGTKAPAAIFKPMQHLEVKLAKVEQRPGAGKIVPSANGTTPHNGVKSEPTKSEPSKSAVKLEPSKSSLKSEPAKSKAEKPVASKSSPEDKKTSPKEQASKAKPAAAKKGSINSFFTAAASKPKDVKATPSKSTSGTVDNFFKKQPAGAKKSPPESEDKSKKDASNSNKKEASKKKSPSPTKKPTTANTSMQLFDEESAESSDEEEKLDMLRRKVIESDNDSDQEKASSSKRRRISDSEDEEQPPKKSADEETIALDEKMDTEPANETYLDEDGFVITQRKPTKAQPANKKVSPKAAAPVNKKKSPPSAAKAGKDAPKTKQAGIMNFFSKK", "sequence_mut": "", "comment": "Homologous recombination repair is reduced by 70% resulting in mutants displaying extreme sensitivity to various DNA damaging agents, except for camptothecin.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y118", "url": "https://www.uniprot.org/uniprotkb/Q9Y118" }, { "database": "PubMed", "id": "22532806", "url": "https://pubmed.ncbi.nlm.nih.gov/22532806" } ], "uniprot_canonical_ac": "Q9Y118-1" } ], "record_id": "pubmed.22532806", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "members only encodes a Drosophila nucleoporin required for rel protein import and immune response activation.", "journal": "Genes & development", "date": "2000-08-01", "authors": "Uv A E, Roth P, Xylourgidis N, Wickberg A, Cantera R, Samakovlis C", "reference": { "type": "PubMed", "id": "10921908", "url": "https://pubmed.ncbi.nlm.nih.gov/10921908" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GYU8-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "mbo", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9GYU8", "url": "https://www.uniprot.org/uniprotkb/Q9GYU8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10921908", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Annulate lamellae play only a minor role in the storage of excess nucleoporins in Drosophila embryos.", "journal": "Traffic", "date": "2004", "authors": "Onischenko EA, Gubanova NV, Kieselbach T, Kiseleva EV, Hallberg E", "reference": { "type": "PubMed", "id": "15086791", "url": "https://pubmed.ncbi.nlm.nih.gov/15086791" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GYU8-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "mbo", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VDV3-1", "protein_name": "Nuclear pore complex protein Nup58", "gene_name": "Nup58", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9GYU8", "url": "https://www.uniprot.org/uniprotkb/Q9GYU8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15086791", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chromatin-bound nuclear pore components regulate gene expression in higher eukaryotes.", "journal": "Cell", "date": "2010", "authors": "Capelson Maya, Liang Yun, Schulte Roberta, Mair William, Wagner Ulrich, Hetzer Martin W", "reference": { "type": "PubMed", "id": "20144761", "url": "https://pubmed.ncbi.nlm.nih.gov/20144761" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GYU8-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "mbo", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCH5-1", "protein_name": "Nuclear pore complex protein Nup98-Nup96", "gene_name": "Nup98-96", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3J4-1", "protein_name": "Protein SEC13 homolog", "gene_name": "Sec13", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9GYU8", "url": "https://www.uniprot.org/uniprotkb/Q9GYU8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.20144761", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A high resolution protein interaction map of the yeast Mediator complex.", "journal": "Nucleic Acids Res.", "date": "2004", "authors": "Guglielmi Benjamin, van Berkum Nynke L, Klapholz Benjamin, Bijma Theo, Boube Muriel, Boschiero Claire, Bourbon Henri-Marc, Holstege Frank C P, Werner Michel", "reference": { "type": "PubMed", "id": "15477388", "url": "https://pubmed.ncbi.nlm.nih.gov/15477388" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GYV9-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47822-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 21", "gene_name": "SRB7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12343-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32259-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "SIN4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32569-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "SRB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32570-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 22", "gene_name": "SRB6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32585-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 18", "gene_name": "SRB5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33308-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 9", "gene_name": "CSE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34162-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "SRB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38633-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "SOH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38782-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9W5P1-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 21", "gene_name": "MED21", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q12124-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 2", "gene_name": "MED2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39073-1", "protein_name": "Meiotic mRNA stability protein kinase SSN3", "gene_name": "SSN3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53114-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 5", "gene_name": "NUT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 11", "gene_name": "MED11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19263-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "RGR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25046-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 19", "gene_name": "ROX3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "SRB8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38304-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 8", "gene_name": "MED8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40356-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 3", "gene_name": "PGD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06213-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "NUT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12321-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19659-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 15", "gene_name": "GAL11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38931-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "SSN2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9GYU7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VS38-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9GYV9", "url": "https://www.uniprot.org/uniprotkb/Q9GYV9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15477388", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 29 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coactivator cross-talk specifies transcriptional output.", "journal": "Genes & development", "date": "2006-06-01", "authors": "Marr Michael T, Isogai Yoh, Wright Kevin J, Tjian Robert", "reference": { "type": "PubMed", "id": "16751183", "url": "https://pubmed.ncbi.nlm.nih.gov/16751183" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GYV9-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VDR1-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 25", "gene_name": "MED25", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VNG0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 27", "gene_name": "MED27", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1ZBT5-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 8", "gene_name": "MED8", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VP05-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V4F9-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 26", "gene_name": "MED26", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W0P8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "MED14", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9Y149-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 15", "gene_name": "MED15", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8IH24-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "MED31", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7KTX8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "skd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8MSX2-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P91641-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "MED20", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9GYU7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VEC1-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "MED17", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VS38-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VSF2-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 24", "gene_name": "MED24", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "MED16", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9GYV9", "url": "https://www.uniprot.org/uniprotkb/Q9GYV9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16751183", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The lipid-droplet proteome reveals that droplets are a protein-storage depot.", "journal": "Curr. Biol.", "date": "2006", "authors": "Cermelli Silvia, Guo Yi, Gross Steven P, Welte Michael A", "reference": { "type": "PubMed", "id": "16979555", "url": "https://pubmed.ncbi.nlm.nih.gov/16979555" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9I7D3-1", "protein_name": "Caprin homolog", "gene_name": "Capr", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O18404-1", "protein_name": "3-hydroxyacyl-CoA dehydrogenase type-2", "gene_name": "scu", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9I7D3", "url": "https://www.uniprot.org/uniprotkb/Q9I7D3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16979555", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Involvement of Drosophila Sir2-like genes in the regulation of life span.", "journal": "Genes & genetic systems", "date": "2006-10", "authors": "Kusama Sakiku, Ueda Ryu, Suda Takeshi, Nishihara Shoko, Matsuura Etsuko T", "reference": { "type": "PubMed", "id": "17159295", "url": "https://pubmed.ncbi.nlm.nih.gov/17159295" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9I7I7-1", "protein_name": "NAD-dependent protein deacetylase Sirt2", "gene_name": "Sirt2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VH08-1", "protein_name": "NAD-dependent protein deacetylase Sirt6", "gene_name": "Sirt6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VK34-1", "protein_name": "NAD-dependent histone deacetylase sirtuin-1", "gene_name": "Sirt1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9I7I7", "url": "https://www.uniprot.org/uniprotkb/Q9I7I7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.17159295", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An evolutionary mechanism to assimilate new nutrient sensors into the mTORC1 pathway.", "journal": "Nature communications", "date": "2024-03-21", "authors": "Liu Grace Y, Jouandin Patrick, Bahng Raymond E, Perrimon Norbert, Sabatini David M", "reference": { "type": "PubMed", "id": "38514639", "url": "https://pubmed.ncbi.nlm.nih.gov/38514639" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9I7X6-2", "protein_name": "Carnosine N-methyltransferase unmet", "gene_name": "unmet", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VKK2-1", "protein_name": "GATOR2 complex protein Wdr59", "gene_name": "Wdr59", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VQ89-1", "protein_name": "GATOR2 complex protein Mio", "gene_name": "mio", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9XZ25-1", "protein_name": "GATOR2 complex protein Wdr24", "gene_name": "Wdr24", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7K2X8-1", "protein_name": "Nucleoporin seh1", "gene_name": "Nup44A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3J4-1", "protein_name": "Protein SEC13 homolog", "gene_name": "Sec13", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W1K5-1", "protein_name": "Sestrin homolog", "gene_name": "Sesn", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W138-1", "protein_name": "Probable S-adenosyl-L-methionine-dependent methyltransferase", "gene_name": "CG3570", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9I7X6", "url": "https://www.uniprot.org/uniprotkb/Q9I7X6" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 195, "end_pos": 195, "sequence_org": "G", "sequence_mut": "D", "comment": "Abolishes S-adenosyl-L-methionine binding but not association with the GATOR2 complex. Unable to regulate mTORC1 signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q9I7X6", "url": "https://www.uniprot.org/uniprotkb/Q9I7X6" }, { "database": "PubMed", "id": "38514639", "url": "https://pubmed.ncbi.nlm.nih.gov/38514639" } ], "uniprot_canonical_ac": "Q9I7X6-2" }, { "start_pos": 30, "end_pos": 30, "sequence_org": "E", "sequence_mut": "A", "comment": "Disrupts association with the GATOR2 complex but not S-adenosyl-L-methionine binding. Constitutively inhibits mTORC1signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q9I7X6", "url": "https://www.uniprot.org/uniprotkb/Q9I7X6" }, { "database": "PubMed", "id": "38514639", "url": "https://pubmed.ncbi.nlm.nih.gov/38514639" } ], "uniprot_canonical_ac": "Q9I7X6-2" } ], "record_id": "pubmed.38514639", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Orbit, a novel microtubule-associated protein essential for mitosis in Drosophila melanogaster.", "journal": "The Journal of cell biology", "date": "2000-04-03", "authors": "Inoue Y H, do Carmo Avides M, Shiraki M, Deak P, Yamaguchi M, Nishimoto Y, Matsukage A, Glover D M", "reference": { "type": "PubMed", "id": "10747094", "url": "https://pubmed.ncbi.nlm.nih.gov/10747094" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NBD7-1", "protein_name": "CLIP-associating protein", "gene_name": "chb", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NBD7", "url": "https://www.uniprot.org/uniprotkb/Q9NBD7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10747094", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mast, a conserved microtubule-associated protein required for bipolar mitotic spindle organization.", "journal": "The EMBO journal", "date": "2000-07-17", "authors": "Lemos C L, Sampaio P, Maiato H, Costa M, Omel'yanchuk L V, Liberal V, Sunkel C E", "reference": { "type": "PubMed", "id": "10899121", "url": "https://pubmed.ncbi.nlm.nih.gov/10899121" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NBD7-1", "protein_name": "CLIP-associating protein", "gene_name": "chb", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NBD7", "url": "https://www.uniprot.org/uniprotkb/Q9NBD7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10899121", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A misexpression screen identifies genes that can modulate RAS1 pathway signaling in Drosophila melanogaster.", "journal": "Genetics", "date": "2000", "authors": "Huang A M, Rubin G M", "reference": { "type": "PubMed", "id": "11063696", "url": "https://pubmed.ncbi.nlm.nih.gov/11063696" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NBD7-1", "protein_name": "CLIP-associating protein", "gene_name": "chb", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NBD7", "url": "https://www.uniprot.org/uniprotkb/Q9NBD7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11063696", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MAST/Orbit has a role in microtubule-kinetochore attachment and is essential for chromosome alignment and maintenance of spindle bipolarity.", "journal": "The Journal of cell biology", "date": "2002-05-27", "authors": "Maiato Helder, Sampaio Paula, Lemos Catarina L, Findlay John, Carmena Mar, Earnshaw William C, Sunkel Claudio E", "reference": { "type": "PubMed", "id": "12034769", "url": "https://pubmed.ncbi.nlm.nih.gov/12034769" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NBD7-1", "protein_name": "CLIP-associating protein", "gene_name": "chb", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NBD7", "url": "https://www.uniprot.org/uniprotkb/Q9NBD7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12034769", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Orbit/Mast, the CLASP orthologue of Drosophila, is required for asymmetric stem cell and cystocyte divisions and development of the polarised microtubule network that interconnects oocyte and nurse cells during oogenesis.", "journal": "Development (Cambridge, England)", "date": "2003-03", "authors": "M\u00e1th\u00e9 Endre, Inoue Yoshihiro H, Palframan William, Brown Gemma, Glover David M", "reference": { "type": "PubMed", "id": "12538517", "url": "https://pubmed.ncbi.nlm.nih.gov/12538517" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NBD7-1", "protein_name": "CLIP-associating protein", "gene_name": "chb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V4P1-1", "protein_name": "Anillin", "gene_name": "scra", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NBD7", "url": "https://www.uniprot.org/uniprotkb/Q9NBD7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12538517", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The microtubule plus end tracking protein Orbit/MAST/CLASP acts downstream of the tyrosine kinase Abl in mediating axon guidance.", "journal": "Neuron", "date": "2004", "authors": "Lee H, Engel U, Rusch J, Scherrer S, Sheard K, Van Vactor D", "reference": { "type": "PubMed", "id": "15207236", "url": "https://pubmed.ncbi.nlm.nih.gov/15207236" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NBD7-1", "protein_name": "CLIP-associating protein", "gene_name": "chb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O75122-1", "protein_name": "CLIP-associating protein 2", "gene_name": "CLASP2", "tax_name": "Human" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NBD7", "url": "https://www.uniprot.org/uniprotkb/Q9NBD7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15207236", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in orbit/mast reveal that the central spindle is comprised of two microtubule populations, those that initiate cleavage and those that propagate furrow ingression.", "journal": "The Journal of cell biology", "date": "2004-07-05", "authors": "Inoue Yoshihiro H, Savoian Matthew S, Suzuki Takao, M\u00e1th\u00e9 Endre, Yamamoto Masa-Toshi, Glover David M", "reference": { "type": "PubMed", "id": "15240569", "url": "https://pubmed.ncbi.nlm.nih.gov/15240569" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NBD7-1", "protein_name": "CLIP-associating protein", "gene_name": "chb", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NBD7", "url": "https://www.uniprot.org/uniprotkb/Q9NBD7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15240569", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila CLASP is required for the incorporation of microtubule subunits into fluxing kinetochore fibres.", "journal": "Nature cell biology", "date": "2005-01", "authors": "Maiato Helder, Khodjakov Alexey, Rieder Conly L", "reference": { "type": "PubMed", "id": "15592460", "url": "https://pubmed.ncbi.nlm.nih.gov/15592460" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NBD7-1", "protein_name": "CLIP-associating protein", "gene_name": "chb", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NBD7", "url": "https://www.uniprot.org/uniprotkb/Q9NBD7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15592460", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Antagonistic activities of Klp10A and Orbit regulate spindle length, bipolarity and function in vivo.", "journal": "Journal of cell science", "date": "2006-06-01", "authors": "Laycock Joseph E, Savoian Matthew S, Glover David M", "reference": { "type": "PubMed", "id": "16723741", "url": "https://pubmed.ncbi.nlm.nih.gov/16723741" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NBD7-1", "protein_name": "CLIP-associating protein", "gene_name": "chb", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NBD7", "url": "https://www.uniprot.org/uniprotkb/Q9NBD7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16723741", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An ESTs description of the new vanin gene family conserved from fly to human.", "journal": "Immunogenetics", "date": "1999", "authors": "Granjeaud S, Naquet P, Galland F", "reference": { "type": "PubMed", "id": "10501839", "url": "https://pubmed.ncbi.nlm.nih.gov/10501839" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NFP1-1", "protein_name": "Vanin-like protein 1", "gene_name": "vanin-like", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9QZ25-1", "protein_name": "Vascular non-inflammatory molecule 3", "gene_name": "Vnn3", "tax_name": "Mouse" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NFP1", "url": "https://www.uniprot.org/uniprotkb/Q9NFP1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10501839", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Contrasting molecular population genetics of four hexokinases in Drosophila melanogaster, D. simulans and D. yakuba.", "journal": "Genetics", "date": "2000", "authors": "Duvernell DD, Eanes WF", "reference": { "type": "PubMed", "id": "11063694", "url": "https://pubmed.ncbi.nlm.nih.gov/11063694" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NFT9-1", "protein_name": "Hexokinase-like protein", "gene_name": "Hexl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NFT7-1", "protein_name": "Hexokinase-2", "gene_name": "Hex-T", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NFT9", "url": "https://www.uniprot.org/uniprotkb/Q9NFT9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11063694", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila disembodied gene controls late embryonic morphogenesis and codes for a cytochrome P450 enzyme that regulates embryonic ecdysone levels.", "journal": "Development (Cambridge, England)", "date": "2000-10", "authors": "Ch\u00e1vez V M, Marqu\u00e9s G, Delbecque J P, Kobayashi K, Hollingsworth M, Burr J, Natzle J E, O'Connor M B", "reference": { "type": "PubMed", "id": "10976044", "url": "https://pubmed.ncbi.nlm.nih.gov/10976044" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NGX9-1", "protein_name": "Cytochrome P450 302a1, mitochondrial", "gene_name": "dib", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NGX9", "url": "https://www.uniprot.org/uniprotkb/Q9NGX9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10976044", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular and biochemical characterization of two P450 enzymes in the ecdysteroidogenic pathway of Drosophila melanogaster.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002-08-20", "authors": "Warren James T, Petryk Anna, Marques Guillermo, Jarcho Michael, Parvy Jean-Philippe, Dauphin-Villemant Chantal, O'Connor Michael B, Gilbert Lawrence I", "reference": { "type": "PubMed", "id": "12177427", "url": "https://pubmed.ncbi.nlm.nih.gov/12177427" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NGX9-1", "protein_name": "Cytochrome P450 302a1, mitochondrial", "gene_name": "dib", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VGH1-1", "protein_name": "Cytochrome P450 315a1, mitochondrial", "gene_name": "sad", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NGX9", "url": "https://www.uniprot.org/uniprotkb/Q9NGX9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12177427", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of glial cell number and differentiation by ecdysone and Fos signaling.", "journal": "Mechanisms of development", "date": "2003-04", "authors": "Giesen Kay, Lammel Uwe, Langehans Dirk, Krukkert Karin, Bunse Ingrid, Kl\u00e4mbt Christian", "reference": { "type": "PubMed", "id": "12676319", "url": "https://pubmed.ncbi.nlm.nih.gov/12676319" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NGX9-1", "protein_name": "Cytochrome P450 302a1, mitochondrial", "gene_name": "dib", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VUF8-1", "protein_name": "Ecdysone 20-monooxygenase", "gene_name": "shd", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NGX9", "url": "https://www.uniprot.org/uniprotkb/Q9NGX9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12676319", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Shade is the Drosophila P450 enzyme that mediates the hydroxylation of ecdysone to the steroid insect molting hormone 20-hydroxyecdysone.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2003", "authors": "Petryk A, Warren JT, Marques G, Jarcho MP, Gilbert LI, Kahler J, Parvy JP, Li Y, Dauphin-Villemant C, O'Connor MB", "reference": { "type": "PubMed", "id": "14610274", "url": "https://pubmed.ncbi.nlm.nih.gov/14610274" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NGX9-1", "protein_name": "Cytochrome P450 302a1, mitochondrial", "gene_name": "dib", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VGH1-1", "protein_name": "Cytochrome P450 315a1, mitochondrial", "gene_name": "sad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VUF8-1", "protein_name": "Ecdysone 20-monooxygenase", "gene_name": "shd", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NGX9", "url": "https://www.uniprot.org/uniprotkb/Q9NGX9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 225, "end_pos": 225, "sequence_org": "E", "sequence_mut": "K", "comment": "In allele shd-Z383; failure of head involution. Defects in dorsal closure and aberrant gut looping.", "evidence": [ { "database": "UniProtKB", "id": "Q9VUF8", "url": "https://www.uniprot.org/uniprotkb/Q9VUF8" }, { "database": "PubMed", "id": "14610274", "url": "https://pubmed.ncbi.nlm.nih.gov/14610274" } ], "uniprot_canonical_ac": "Q9VUF8-1" } ], "record_id": "pubmed.14610274", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila Roc1a encodes a RING-H2 protein with a unique function in processing the Hh signal transducer Ci by the SCF E3 ubiquitin ligase.", "journal": "Developmental cell", "date": "2002", "authors": "Noureddine MA, Donaldson TD, Thacker SA, Duronio RJ", "reference": { "type": "PubMed", "id": "12062088", "url": "https://pubmed.ncbi.nlm.nih.gov/12062088" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NHX0-1", "protein_name": "RING-box protein 1B", "gene_name": "Roc1b", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W5E1-1", "protein_name": "RING-box protein 1A", "gene_name": "Roc1a", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NHX0", "url": "https://www.uniprot.org/uniprotkb/Q9NHX0" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 59, "end_pos": 59, "sequence_org": "N", "sequence_mut": "C", "comment": "Loss of function; when associated with R-68.", "evidence": [ { "database": "UniProtKB", "id": "Q9W5E1", "url": "https://www.uniprot.org/uniprotkb/Q9W5E1" }, { "database": "PubMed", "id": "12062088", "url": "https://pubmed.ncbi.nlm.nih.gov/12062088" } ], "uniprot_canonical_ac": "Q9W5E1-1" }, { "start_pos": 68, "end_pos": 68, "sequence_org": "C", "sequence_mut": "R", "comment": "Loss of function; when associated with C-59.", "evidence": [ { "database": "UniProtKB", "id": "Q9W5E1", "url": "https://www.uniprot.org/uniprotkb/Q9W5E1" }, { "database": "PubMed", "id": "12062088", "url": "https://pubmed.ncbi.nlm.nih.gov/12062088" } ], "uniprot_canonical_ac": "Q9W5E1-1" } ], "record_id": "pubmed.12062088", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Paralogous stellate and Su(Ste) repeats: evolution and ability to silence a reporter gene.", "journal": "Genetica", "date": "2000", "authors": "Gvozdev V A, Kogan G L, Tulin A A, Aravin A A, Naumova N M, Shevelyov Y Y", "reference": { "type": "PubMed", "id": "11293788", "url": "https://pubmed.ncbi.nlm.nih.gov/11293788" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NIV2-1", "protein_name": "Stellate orphon protein at 12D", "gene_name": "Ste12DOR", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NIV2", "url": "https://www.uniprot.org/uniprotkb/Q9NIV2" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11293788", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SAGA and a novel Drosophila export complex anchor efficient transcription and mRNA export to NPC.", "journal": "The EMBO journal", "date": "2007-12-12", "authors": "Kurshakova Maria M, Krasnov Alexey N, Kopytova Daria V, Shidlovskii Yulii V, Nikolenko Julia V, Nabirochkina Elena N, Spehner Dani\u00e8le, Schultz Patrick, Tora L\u00e0szl\u00f2, Georgieva Sofia G", "reference": { "type": "PubMed", "id": "18034162", "url": "https://pubmed.ncbi.nlm.nih.gov/18034162" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9U3V9-2", "protein_name": "Protein xmas", "gene_name": "xmas", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VYX1-1", "protein_name": "Enhancer of yellow 2 transcription factor", "gene_name": "e(y)2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9U3V9", "url": "https://www.uniprot.org/uniprotkb/Q9U3V9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.18034162", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ORC interacts with THSC/TREX-2 and its subunits promote Nxf1 association with mRNP and mRNA export in Drosophila.", "journal": "Nucleic acids research", "date": "2016-06-02", "authors": "Kopytova Daria, Popova Varvara, Kurshakova Maria, Shidlovskii Yulii, Nabirochkina Elena, Brechalov Alexander, Georgiev Georgii, Georgieva Sofia", "reference": { "type": "PubMed", "id": "27016737", "url": "https://pubmed.ncbi.nlm.nih.gov/27016737" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9U3V9-2", "protein_name": "Protein xmas", "gene_name": "xmas", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VYX1-1", "protein_name": "Enhancer of yellow 2 transcription factor", "gene_name": "e(y)2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9U1H9-1", "protein_name": "Nuclear RNA export factor 1", "gene_name": "sbr", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24168-1", "protein_name": "Origin recognition complex subunit 2", "gene_name": "Orc2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VTL1-1", "protein_name": "PCI domain-containing protein 2 homolog", "gene_name": "PCID2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9U3V9", "url": "https://www.uniprot.org/uniprotkb/Q9U3V9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.27016737", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Piwi interacts with chromatin at nuclear pores and promiscuously binds nuclear transcripts in Drosophila ovarian somatic cells.", "journal": "Nucleic Acids Res.", "date": "2017", "authors": "Ilyin Artem A, Ryazansky Sergei S, Doronin Semen A, Olenkina Oxana M, Mikhaleva Elena A, Yakushev Evgeny Y, Abramov Yuri A, Belyakin Stepan N, Ivankin Anton V, Pindyurin Alexey V, Gvozdev Vladimir A, Klenov Mikhail S, Shevelyov Yuri Y", "reference": { "type": "PubMed", "id": "28472469", "url": "https://pubmed.ncbi.nlm.nih.gov/28472469" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9U3V9-2", "protein_name": "Protein xmas", "gene_name": "xmas", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W1F4-1", "protein_name": "THO complex subunit 5", "gene_name": "thoc5", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VWE6-1", "protein_name": "Protein ELYS homolog", "gene_name": "Elys", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VKM1-1", "protein_name": "Protein piwi", "gene_name": "piwi", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9U3V9", "url": "https://www.uniprot.org/uniprotkb/Q9U3V9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.28472469", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alternative Splicing of the Xmas mRNA Encoding the mRNA Export Protein in Drosophila melanogaster.", "journal": "Dokl. Biochem. Biophys.", "date": "2018", "authors": "Kopytova D V, Il'in Yu V, Nabirochkina E N", "reference": { "type": "PubMed", "id": "29779104", "url": "https://pubmed.ncbi.nlm.nih.gov/29779104" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9U3V9-2", "protein_name": "Protein xmas", "gene_name": "xmas", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9U3V9", "url": "https://www.uniprot.org/uniprotkb/Q9U3V9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.29779104", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PCID2, a subunit of the Drosophila TREX-2 nuclear export complex, is essential for both mRNA nuclear export and its subsequent cytoplasmic trafficking.", "journal": "RNA biology", "date": "2021", "authors": "Glukhova AA, Kurshakova MM, Nabirochkina EN, Georgieva SG, Kopytova DV", "reference": { "type": "PubMed", "id": "33602059", "url": "https://pubmed.ncbi.nlm.nih.gov/33602059" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9U3V9-2", "protein_name": "Protein xmas", "gene_name": "xmas", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VVA6-1", "protein_name": "Nuclear migration protein nudC", "gene_name": "nudC", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VTL1-1", "protein_name": "PCI domain-containing protein 2 homolog", "gene_name": "PCID2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9U3V9", "url": "https://www.uniprot.org/uniprotkb/Q9U3V9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.33602059", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Study of the Interaction between Xmas-2, the Main Protein of TREX-2 mRNA Export Complex, and the Orc3 Protein, a Subunit of ORC Complex of D. melanogaster.", "journal": "Doklady. Biochemistry and biophysics", "date": "2021", "authors": "Kurshakova MM, Kopytova DV, Georgieva SG", "reference": { "type": "PubMed", "id": "33689068", "url": "https://pubmed.ncbi.nlm.nih.gov/33689068" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9U3V9-2", "protein_name": "Protein xmas", "gene_name": "xmas", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9U3V9", "url": "https://www.uniprot.org/uniprotkb/Q9U3V9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 1, "end_pos": 252, "sequence_org": "MAEPRPGGYNYKTLLCRNIPELFLDKYVARSHFGRFGTLVNFVLRPRRMTCTVSYASEDEAARALLDGASFQGHLFDISYADNETAPAQKTEEWVDPDIQAELSALQSGWRNEYGSGKPIKKPQNGSSGSGGSSMLPAIPVGPATAPVSRDRTPAQLRDLENMMRRPAHTSEEKFSVLDARDKLLRLNRTQHKLSGATQGHCADMCPEKERVLREFQRQVAYYELQPGSDELICHERALKQYSRSSADQETP", "sequence_mut": "", "comment": "In xmas-2-dRRM; no effect on interaction with Orc3.", "evidence": [ { "database": "UniProtKB", "id": "Q9U3V9", "url": "https://www.uniprot.org/uniprotkb/Q9U3V9" }, { "database": "PubMed", "id": "33689068", "url": "https://pubmed.ncbi.nlm.nih.gov/33689068" } ], "uniprot_canonical_ac": "Q9U3V9-2" }, { "start_pos": 1, "end_pos": 339, "sequence_org": "MAEPRPGGYNYKTLLCRNIPELFLDKYVARSHFGRFGTLVNFVLRPRRMTCTVSYASEDEAARALLDGASFQGHLFDISYADNETAPAQKTEEWVDPDIQAELSALQSGWRNEYGSGKPIKKPQNGSSGSGGSSMLPAIPVGPATAPVSRDRTPAQLRDLENMMRRPAHTSEEKFSVLDARDKLLRLNRTQHKLSGATQGHCADMCPEKERVLREFQRQVAYYELQPGSDELICHERALKQYSRSSADQETPLPHELRNETALHMTMSYLMHEIMDISERQDPQSHMGDWFHFVWDRTRSIRKEITQQELCSLGAVKLVEQCARFHIHCAARLVDADPS", "sequence_mut": "", "comment": "In xmas-2-dM; no effect on interaction with Orc3.", "evidence": [ { "database": "UniProtKB", "id": "Q9U3V9", "url": "https://www.uniprot.org/uniprotkb/Q9U3V9" }, { "database": "PubMed", "id": "33689068", "url": "https://pubmed.ncbi.nlm.nih.gov/33689068" } ], "uniprot_canonical_ac": "Q9U3V9-2" }, { "start_pos": 1, "end_pos": 672, "sequence_org": "MAEPRPGGYNYKTLLCRNIPELFLDKYVARSHFGRFGTLVNFVLRPRRMTCTVSYASEDEAARALLDGASFQGHLFDISYADNETAPAQKTEEWVDPDIQAELSALQSGWRNEYGSGKPIKKPQNGSSGSGGSSMLPAIPVGPATAPVSRDRTPAQLRDLENMMRRPAHTSEEKFSVLDARDKLLRLNRTQHKLSGATQGHCADMCPEKERVLREFQRQVAYYELQPGSDELICHERALKQYSRSSADQETPLPHELRNETALHMTMSYLMHEIMDISERQDPQSHMGDWFHFVWDRTRSIRKEITQQELCSLGAVKLVEQCARFHIHCAARLVDADPSVFDSKINAENLTKCLQTLKYMYHDLRIKGVPCPKEAEFRGYIVLLNLADANFLWDIGQLPAELQSCPEVRQAIQFYLALQDTNFVRFFQLLADKDTSYLSACILVNYFTRLRVLGLHRLIQAYRSPRKDEVSSLPLSYIAELLSFASEQEAADFVQHYGLQINEAGRVVLSRMHTVETEYKLPRQYELVEVKRVKSVGEVVSGEPLPPRDLYLNHRPHNSFDDYGMLKSIAWTAKDQLAGMQQEEMQPQMPSQPPAVSKHSDTLFKVPMQPDGTAAGFGVFAAAAVPPASSIDGFSFVLPKSRAQEFQEQAPATQQRRAQEEAKHQALQVAIA", "sequence_mut": "", "comment": "In xmas-2-C; no effect on interaction with Orc3.", "evidence": [ { "database": "UniProtKB", "id": "Q9U3V9", "url": "https://www.uniprot.org/uniprotkb/Q9U3V9" }, { "database": "PubMed", "id": "33689068", "url": "https://pubmed.ncbi.nlm.nih.gov/33689068" } ], "uniprot_canonical_ac": "Q9U3V9-2" }, { "start_pos": 1, "end_pos": 834, "sequence_org": "MAEPRPGGYNYKTLLCRNIPELFLDKYVARSHFGRFGTLVNFVLRPRRMTCTVSYASEDEAARALLDGASFQGHLFDISYADNETAPAQKTEEWVDPDIQAELSALQSGWRNEYGSGKPIKKPQNGSSGSGGSSMLPAIPVGPATAPVSRDRTPAQLRDLENMMRRPAHTSEEKFSVLDARDKLLRLNRTQHKLSGATQGHCADMCPEKERVLREFQRQVAYYELQPGSDELICHERALKQYSRSSADQETPLPHELRNETALHMTMSYLMHEIMDISERQDPQSHMGDWFHFVWDRTRSIRKEITQQELCSLGAVKLVEQCARFHIHCAARLVDADPSVFDSKINAENLTKCLQTLKYMYHDLRIKGVPCPKEAEFRGYIVLLNLADANFLWDIGQLPAELQSCPEVRQAIQFYLALQDTNFVRFFQLLADKDTSYLSACILVNYFTRLRVLGLHRLIQAYRSPRKDEVSSLPLSYIAELLSFASEQEAADFVQHYGLQINEAGRVVLSRMHTVETEYKLPRQYELVEVKRVKSVGEVVSGEPLPPRDLYLNHRPHNSFDDYGMLKSIAWTAKDQLAGMQQEEMQPQMPSQPPAVSKHSDTLFKVPMQPDGTAAGFGVFAAAAVPPASSIDGFSFVLPKSRAQEFQEQAPATQQRRAQEEAKHQALQVAIAAAKKREAELMAIHEAKVAEAERVRQQKLRERQEQQRRQQQELEEQRQREQEKLQLEKERQLKLEQLFFVQQQEREAHKQTRTLELYQEIFQDTLAEICQSEFMSHSRACRSYESMLDSITRDLVERQMEQSIYELGVMRVCIRRWRKYRRTQQEKDTLFNQL", "sequence_mut": "", "comment": "In xmas-2-dCID; no effect on interaction with Orc3.", "evidence": [ { "database": "UniProtKB", "id": "Q9U3V9", "url": "https://www.uniprot.org/uniprotkb/Q9U3V9" }, { "database": "PubMed", "id": "33689068", "url": "https://pubmed.ncbi.nlm.nih.gov/33689068" } ], "uniprot_canonical_ac": "Q9U3V9-2" }, { "start_pos": 671, "end_pos": 1359, "sequence_org": "IAAAKKREAELMAIHEAKVAEAERVRQQKLRERQEQQRRQQQELEEQRQREQEKLQLEKERQLKLEQLFFVQQQEREAHKQTRTLELYQEIFQDTLAEICQSEFMSHSRACRSYESMLDSITRDLVERQMEQSIYELGVMRVCIRRWRKYRRTQQEKDTLFNQLPLSFGAENPEGVVNKRSMEDSLRLSRRYRLGEPCDYGKLLAGLEEHSWLKLDLWHVLDKCLPVAQPGARRFYKLLISLSGGQEGLQLNCDLDRGLLQQPQSPDARFVDGGYIRGFSQGIGLSVMKIRDDDHDWKATDLAEANGIICLIGLDDIRLLPDRLKPLLQASRCHDVAVIVQHPANTAFVQPDIPLQELCLRSFNIFRLRKSGNNRQRLMIALESAVKFLAKATERKRVGHLHQVETREYLLVNLGSELFRRLKYAAEHDTAIRSDTQLNPQRCVDLFNEAVHRLQLVAGEDLSDWPQFPEELRVFVQPLPIESSLNTNRLEHFEPGWHLPERRQRIVQLLERCKLPKMPVLPRSSSLAEAQCQWVLDYAQISQQEDCVEQIALQAIKILQYDTDDYLNFVEYLAGERMQYILRQERNPPQGIVYNTKTLKRRFLSAWYYEFREPQIYEPVPAEENAQMLEKQPSSQAEVQQLDFDEITSKAEAVLKRFHQRQDERHTLRELNRSHKSRKRRDASDHKHA", "sequence_mut": "", "comment": "In xmas-2-N; abolishes interaction with Orc3.", "evidence": [ { "database": "UniProtKB", "id": "Q9U3V9", "url": "https://www.uniprot.org/uniprotkb/Q9U3V9" }, { "database": "PubMed", "id": "33689068", "url": "https://pubmed.ncbi.nlm.nih.gov/33689068" } ], "uniprot_canonical_ac": "Q9U3V9-2" } ], "record_id": "pubmed.33689068", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Post-transcriptional silencing and functional characterization of the Drosophila melanogaster homolog of human Surf1.", "journal": "Genetics", "date": "2006-01", "authors": "Zordan Mauro A, Cisotto Paola, Benna Clara, Agostino Alessandro, Rizzo Giorgia, Piccin Alberto, Pegoraro Mirko, Sandrelli Federica, Perini Giuliana, Tognon Giuseppe, De Caro Raffaele, Peron Samantha, Kronni\u00e8 Truus Te, Megighian Aram, Reggiani Carlo, Zeviani Massimo, Costa Rodolfo", "reference": { "type": "PubMed", "id": "16172499", "url": "https://pubmed.ncbi.nlm.nih.gov/16172499" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9U4F3-1", "protein_name": "SURF1-like protein", "gene_name": "Surf1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9U4F3", "url": "https://www.uniprot.org/uniprotkb/Q9U4F3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16172499", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Leigh syndrome in Drosophila melanogaster: morphological and biochemical characterization of Surf1 post-transcriptional silencing.", "journal": "The Journal of biological chemistry", "date": "2014-10-17", "authors": "Da-R\u00e8 Caterina, von Stockum Sophia, Biscontin Alberto, Millino Caterina, Cisotto Paola, Zordan Mauro A, Zeviani Massimo, Bernardi Paolo, De Pitt\u00e0 Cristiano, Costa Rodolfo", "reference": { "type": "PubMed", "id": "25164807", "url": "https://pubmed.ncbi.nlm.nih.gov/25164807" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9U4F3-1", "protein_name": "SURF1-like protein", "gene_name": "Surf1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9U4F3", "url": "https://www.uniprot.org/uniprotkb/Q9U4F3" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.25164807", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Visual circuit assembly requires fine tuning of the novel Ig transmembrane protein Borderless.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2013-10-30", "authors": "Cameron Scott, Chang Wen-Tzu, Chen Yixu, Zhou Yating, Taran Shaurya, Rao Yong", "reference": { "type": "PubMed", "id": "24174674", "url": "https://pubmed.ncbi.nlm.nih.gov/24174674" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9U4G1-1", "protein_name": "Protein borderless", "gene_name": "bdl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P16621-1", "protein_name": "Tyrosine-protein phosphatase Lar", "gene_name": "Lar", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q967D7-2", "protein_name": "Protein turtle", "gene_name": "tutl", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9U4G1", "url": "https://www.uniprot.org/uniprotkb/Q9U4G1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.24174674", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two novel Drosophila TAF(II)s have homology with human TAF(II)30 and are differentially regulated during development.", "journal": "Molecular and cellular biology", "date": "2000-03", "authors": "Georgieva S, Kirschner D B, Jagla T, Nabirochkina E, Hanke S, Schenkel H, de Lorenzo C, Sinha P, Jagla K, Mechler B, Tora L", "reference": { "type": "PubMed", "id": "10669741", "url": "https://pubmed.ncbi.nlm.nih.gov/10669741" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9U5W9-1", "protein_name": "Transcription initiation factor TFIID subunit 10", "gene_name": "Taf10", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9XZT7-1", "protein_name": "Transcription initiation factor TFIID subunit 10b", "gene_name": "Taf10b", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9U5W9", "url": "https://www.uniprot.org/uniprotkb/Q9U5W9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10669741", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prodos is a conserved transcriptional regulator that interacts with dTAF(II)16 in Drosophila melanogaster.", "journal": "Mol. Cell. Biol.", "date": "2001", "authors": "Hern\u00e1ndez-Hern\u00e1ndez A, Ferr\u00fas A", "reference": { "type": "PubMed", "id": "11134347", "url": "https://pubmed.ncbi.nlm.nih.gov/11134347" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9U5W9-1", "protein_name": "Transcription initiation factor TFIID subunit 10", "gene_name": "Taf10", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VWY6-1", "protein_name": "Transcription initiation factor TFIID subunit 8", "gene_name": "Taf8", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9XZT7-1", "protein_name": "Transcription initiation factor TFIID subunit 10b", "gene_name": "Taf10b", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9U5W9", "url": "https://www.uniprot.org/uniprotkb/Q9U5W9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11134347", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Repair of oxidative DNA damage in Drosophila melanogaster: identification and characterization of dOgg1, a second DNA glycosylase activity for 8-hydroxyguanine and formamidopyrimidines.", "journal": "Nucleic acids research", "date": "2000-12-01", "authors": "Dherin C, Dizdaroglu M, Doerflinger H, Boiteux S, Radicella J P", "reference": { "type": "PubMed", "id": "11095666", "url": "https://pubmed.ncbi.nlm.nih.gov/11095666" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3I8-1", "protein_name": "N-glycosylase/DNA lyase", "gene_name": "Ogg1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3I8", "url": "https://www.uniprot.org/uniprotkb/Q9V3I8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11095666", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An immune-responsive Serpin regulates the melanization cascade in Drosophila.", "journal": "Developmental cell", "date": "2002", "authors": "De Gregorio E, Han SJ, Lee WJ, Baek MJ, Osaki T, Kawabata S, Lee BL, Iwanaga S, Lemaitre B, Brey PT", "reference": { "type": "PubMed", "id": "12408809", "url": "https://pubmed.ncbi.nlm.nih.gov/12408809" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3N1", "url": "https://www.uniprot.org/uniprotkb/Q9V3N1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 406, "end_pos": 406, "sequence_org": "K", "sequence_mut": "A", "comment": "Fails to inhibit proteolytic activation of phenoloxidase (PO).", "evidence": [ { "database": "UniProtKB", "id": "Q9V3N1", "url": "https://www.uniprot.org/uniprotkb/Q9V3N1" }, { "database": "PubMed", "id": "12408809", "url": "https://pubmed.ncbi.nlm.nih.gov/12408809" } ], "uniprot_canonical_ac": "Q9V3N1-1" }, { "start_pos": 406, "end_pos": 406, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreased inhibition of proteolytic activation of phenoloxidase (PO).", "evidence": [ { "database": "UniProtKB", "id": "Q9V3N1", "url": "https://www.uniprot.org/uniprotkb/Q9V3N1" }, { "database": "PubMed", "id": "12408809", "url": "https://pubmed.ncbi.nlm.nih.gov/12408809" } ], "uniprot_canonical_ac": "Q9V3N1-1" } ], "record_id": "pubmed.12408809", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A serpin mutant links Toll activation to melanization in the host defence of Drosophila.", "journal": "The EMBO journal", "date": "2002", "authors": "Ligoxygakis P, Pelte N, Ji C, Leclerc V, Duvic B, Belvin M, Jiang H, Hoffmann JA, Reichhart JM", "reference": { "type": "PubMed", "id": "12456640", "url": "https://pubmed.ncbi.nlm.nih.gov/12456640" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P98149-1", "protein_name": "Dorsal-related immunity factor Dif", "gene_name": "Dif", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3N1", "url": "https://www.uniprot.org/uniprotkb/Q9V3N1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 181, "end_pos": 181, "sequence_org": "G", "sequence_mut": "D", "comment": "In Dif1; immune response defective. Reduced survival following infection with fungi, and reduced levels of Drs following immune challenge with fungi or bacteria. No down-regulation of the serpin Spn27A in response to bacterial infection. Ectopic bristles form on the dorsocentral, scutellar and lateral regions of the notum.", "evidence": [ { "database": "UniProtKB", "id": "P98149", "url": "https://www.uniprot.org/uniprotkb/P98149" }, { "database": "PubMed", "id": "21576362", "url": "https://pubmed.ncbi.nlm.nih.gov/21576362" }, { "database": "PubMed", "id": "18000549", "url": "https://pubmed.ncbi.nlm.nih.gov/18000549" }, { "database": "PubMed", "id": "12456640", "url": "https://pubmed.ncbi.nlm.nih.gov/12456640" } ], "uniprot_canonical_ac": "P98149-1" } ], "record_id": "pubmed.12456640", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A serpin regulates dorsal-ventral axis formation in the Drosophila embryo.", "journal": "Current biology : CB", "date": "2003-12-02", "authors": "Ligoxygakis Petros, Roth Siegfried, Reichhart Jean-Marc", "reference": { "type": "PubMed", "id": "14654000", "url": "https://pubmed.ncbi.nlm.nih.gov/14654000" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3N1", "url": "https://www.uniprot.org/uniprotkb/Q9V3N1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.14654000", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila serpin 27A is a likely target for immune suppression of the blood cell-mediated melanotic encapsulation response.", "journal": "Journal of insect physiology", "date": "2005-02", "authors": "Nappi A J, Frey F, Carton Y", "reference": { "type": "PubMed", "id": "15749104", "url": "https://pubmed.ncbi.nlm.nih.gov/15749104" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3N1", "url": "https://www.uniprot.org/uniprotkb/Q9V3N1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15749104", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prophenoloxidase activation is not required for survival to microbial infections in Drosophila.", "journal": "EMBO reports", "date": "2006-02", "authors": "Leclerc Vincent, Pelte Nad\u00e8ge, El Chamy Laure, Martinelli Cosimo, Ligoxygakis Petros, Hoffmann Jules A, Reichhart Jean-Marc", "reference": { "type": "PubMed", "id": "16322759", "url": "https://pubmed.ncbi.nlm.nih.gov/16322759" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3Z2-1", "protein_name": "Serine protease 7", "gene_name": "Sp7", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3N1", "url": "https://www.uniprot.org/uniprotkb/Q9V3N1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16322759", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two proteases defining a melanization cascade in the immune system of Drosophila.", "journal": "The Journal of biological chemistry", "date": "2006-09-22", "authors": "Tang Huaping, Kambris Zakaria, Lemaitre Bruno, Hashimoto Carl", "reference": { "type": "PubMed", "id": "16861233", "url": "https://pubmed.ncbi.nlm.nih.gov/16861233" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A0A126GUP6-1", "protein_name": "Melanization protease 1", "gene_name": "MP1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3Z2-1", "protein_name": "Serine protease 7", "gene_name": "Sp7", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3N1", "url": "https://www.uniprot.org/uniprotkb/Q9V3N1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16861233", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila Serpin-28D regulates hemolymph phenoloxidase activity and adult pigmentation.", "journal": "Developmental biology", "date": "2008", "authors": "Scherfer C, Tang H, Kambris Z, Lhocine N, Hashimoto C, Lemaitre B", "reference": { "type": "PubMed", "id": "18801354", "url": "https://pubmed.ncbi.nlm.nih.gov/18801354" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VLU4-1", "protein_name": "Serine protease inhibitor 28Dc", "gene_name": "Spn28Dc", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3N1", "url": "https://www.uniprot.org/uniprotkb/Q9V3N1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.18801354", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Serine protease MP2 activates prophenoloxidase in the melanization immune response of Drosophila melanogaster.", "journal": "PloS one", "date": "2013", "authors": "An Chunju, Zhang Mingming, Chu Yuan, Zhao Zhangwu", "reference": { "type": "PubMed", "id": "24260243", "url": "https://pubmed.ncbi.nlm.nih.gov/24260243" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3Z2-1", "protein_name": "Serine protease 7", "gene_name": "Sp7", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3N1", "url": "https://www.uniprot.org/uniprotkb/Q9V3N1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.24260243", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prophenoloxidase activation is required for survival to microbial infections in Drosophila.", "journal": "PLoS pathogens", "date": "2014-05", "authors": "Binggeli Olivier, Neyen Claudine, Poidevin Mickael, Lemaitre Bruno", "reference": { "type": "PubMed", "id": "24788090", "url": "https://pubmed.ncbi.nlm.nih.gov/24788090" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3N1", "url": "https://www.uniprot.org/uniprotkb/Q9V3N1" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.24788090", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neurodegeneration in a Drosophila model of adrenoleukodystrophy: the roles of the Bubblegum and Double bubble acyl-CoA synthetases.", "journal": "Disease models & mechanisms", "date": "2016-04", "authors": "Sivachenko Anna, Gordon Hannah B, Kimball Suzanne S, Gavin Erin J, Bonkowsky Joshua L, Letsou Anthea", "reference": { "type": "PubMed", "id": "26893370", "url": "https://pubmed.ncbi.nlm.nih.gov/26893370" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3U0-1", "protein_name": "Long-chain-fatty-acid--CoA ligase heimdall", "gene_name": "hll", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3S9-1", "protein_name": "Very long-chain-fatty-acid--CoA ligase bubblegum", "gene_name": "bgm", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3U0", "url": "https://www.uniprot.org/uniprotkb/Q9V3U0" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.26893370", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Etiology and treatment of adrenoleukodystrophy: new insights from Drosophila.", "journal": "Disease models & mechanisms", "date": "2018-06-15", "authors": "Gordon Hannah B, Valdez Lourdes, Letsou Anthea", "reference": { "type": "PubMed", "id": "29739804", "url": "https://pubmed.ncbi.nlm.nih.gov/29739804" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3U0-1", "protein_name": "Long-chain-fatty-acid--CoA ligase heimdall", "gene_name": "hll", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3S9-1", "protein_name": "Very long-chain-fatty-acid--CoA ligase bubblegum", "gene_name": "bgm", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3U0", "url": "https://www.uniprot.org/uniprotkb/Q9V3U0" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.29739804", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tissue-autonomous function of Drosophila seipin in preventing ectopic lipid droplet formation.", "journal": "PLoS genetics", "date": "2011", "authors": "Tian Y, Bi J, Shui G, Liu Z, Xiang Y, Liu Y, Wenk MR, Yang H, Huang X", "reference": { "type": "PubMed", "id": "21533227", "url": "https://pubmed.ncbi.nlm.nih.gov/21533227" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3X4-1", "protein_name": "Seipin", "gene_name": "Seipin", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q96G97-2", "protein_name": "Seipin", "gene_name": "BSCL2", "tax_name": "Human" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3X4", "url": "https://www.uniprot.org/uniprotkb/Q9V3X4" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.21533227", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Seipin is required for converting nascent to mature lipid droplets.", "journal": "eLife", "date": "2016-08-26", "authors": "Wang Huajin, Becuwe Michel, Housden Benjamin E, Chitraju Chandramohan, Porras Ashley J, Graham Morven M, Liu Xinran N, Thiam Abdou Rachid, Savage David B, Agarwal Anil K, Garg Abhimanyu, Olarte Maria-Jesus, Lin Qingqing, Fr\u00f6hlich Florian, Hannibal-Bach Hans Kristian, Upadhyayula Srigokul, Perrimon Norbert, Kirchhausen Tomas, Ejsing Christer S, Walther Tobias C, Farese Robert V", "reference": { "type": "PubMed", "id": "27564575", "url": "https://pubmed.ncbi.nlm.nih.gov/27564575" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V3X4-1", "protein_name": "Seipin", "gene_name": "Seipin", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q96G97-2", "protein_name": "Seipin", "gene_name": "BSCL2", "tax_name": "Human" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V3X4", "url": "https://www.uniprot.org/uniprotkb/Q9V3X4" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.27564575", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Thioredoxin-2 but not thioredoxin-1 is a substrate of thioredoxin peroxidase-1 from Drosophila melanogaster: isolation and characterization of a second thioredoxin in D. Melanogaster and evidence for distinct biological functions of Trx-1 and Trx-2.", "journal": "The Journal of biological chemistry", "date": "2002-05-17", "authors": "Bauer Holger, Kanzok Stefan M, Schirmer R Heiner", "reference": { "type": "PubMed", "id": "11877442", "url": "https://pubmed.ncbi.nlm.nih.gov/11877442" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V429-1", "protein_name": "Thioredoxin-2", "gene_name": "Trx2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P47938-1", "protein_name": "Thioredoxin-1", "gene_name": "dhd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P91938-1", "protein_name": "Thioredoxin reductase 1, mitochondrial", "gene_name": "Trxr1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3P0-1", "protein_name": "Peroxiredoxin 2", "gene_name": "Prx2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V429", "url": "https://www.uniprot.org/uniprotkb/Q9V429" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11877442", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparative structural analysis of oxidized and reduced thioredoxin from Drosophila melanogaster.", "journal": "Journal of molecular biology", "date": "2005", "authors": "Wahl MC, Irmler A, Hecker B, Schirmer RH, Becker K", "reference": { "type": "PubMed", "id": "15644209", "url": "https://pubmed.ncbi.nlm.nih.gov/15644209" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V429-1", "protein_name": "Thioredoxin-2", "gene_name": "Trx2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V429", "url": "https://www.uniprot.org/uniprotkb/Q9V429" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15644209", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two histone fold proteins, CHRAC-14 and CHRAC-16, are developmentally regulated subunits of chromatin accessibility complex (CHRAC).", "journal": "The EMBO journal", "date": "2000-06-15", "authors": "Corona D F, Eberharter A, Budde A, Deuring R, Ferrari S, Varga-Weisz P, Wilm M, Tamkun J, Becker P B", "reference": { "type": "PubMed", "id": "10856248", "url": "https://pubmed.ncbi.nlm.nih.gov/10856248" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V444-1", "protein_name": "DNA polymerase epsilon subunit 3", "gene_name": "Chrac-14", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V452-1", "protein_name": "Chromatin accessibility complex 16kD protein", "gene_name": "Chrac-16", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24368-1", "protein_name": "Chromatin-remodeling complex ATPase chain Iswi", "gene_name": "Iswi", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V444", "url": "https://www.uniprot.org/uniprotkb/Q9V444" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10856248", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Acf1, the largest subunit of CHRAC, regulates ISWI-induced nucleosome remodelling.", "journal": "The EMBO journal", "date": "2001-07-16", "authors": "Eberharter A, Ferrari S, L\u00e4ngst G, Straub T, Imhof A, Varga-Weisz P, Wilm M, Becker P B", "reference": { "type": "PubMed", "id": "11447119", "url": "https://pubmed.ncbi.nlm.nih.gov/11447119" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V444-1", "protein_name": "DNA polymerase epsilon subunit 3", "gene_name": "Chrac-14", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V452-1", "protein_name": "Chromatin accessibility complex 16kD protein", "gene_name": "Chrac-16", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24368-1", "protein_name": "Chromatin-remodeling complex ATPase chain Iswi", "gene_name": "Iswi", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V444", "url": "https://www.uniprot.org/uniprotkb/Q9V444" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11447119", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The histone fold subunits of Drosophila CHRAC facilitate nucleosome sliding through dynamic DNA interactions.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Hartlepp KF, Fernandez-Tornero C, Eberharter A, Grune T, Muller CW, Becker PB", "reference": { "type": "PubMed", "id": "16260604", "url": "https://pubmed.ncbi.nlm.nih.gov/16260604" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V444-1", "protein_name": "DNA polymerase epsilon subunit 3", "gene_name": "Chrac-14", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V452-1", "protein_name": "Chromatin accessibility complex 16kD protein", "gene_name": "Chrac-16", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V444", "url": "https://www.uniprot.org/uniprotkb/Q9V444" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 109, "end_pos": 128, "sequence_org": "SNTAENANASATATAEEAPE", "sequence_mut": "", "comment": "When in a heterodimer with Chrac-16, reduces DNA binding and is less able to stimulate Acf nucleosome sliding activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9V444", "url": "https://www.uniprot.org/uniprotkb/Q9V444" }, { "database": "PubMed", "id": "16260604", "url": "https://pubmed.ncbi.nlm.nih.gov/16260604" } ], "uniprot_canonical_ac": "Q9V444-1" }, { "start_pos": 2, "end_pos": 18, "sequence_org": "VERIEDLNLPNAVIGRL", "sequence_mut": "", "comment": "When in a heterodimer with Chrac-16, reduces Acf binding but does not affect DNA binding or Acf nucleosome sliding activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9V444", "url": "https://www.uniprot.org/uniprotkb/Q9V444" }, { "database": "PubMed", "id": "16260604", "url": "https://pubmed.ncbi.nlm.nih.gov/16260604" } ], "uniprot_canonical_ac": "Q9V444-1" }, { "start_pos": 118, "end_pos": 140, "sequence_org": "DDDDDDDDDDDEEESESESESDE", "sequence_mut": "", "comment": "When in a heterodimer with Chrac-14, enhances DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "Q9V452", "url": "https://www.uniprot.org/uniprotkb/Q9V452" }, { "database": "PubMed", "id": "16260604", "url": "https://pubmed.ncbi.nlm.nih.gov/16260604" } ], "uniprot_canonical_ac": "Q9V452-1" }, { "start_pos": 2, "end_pos": 18, "sequence_org": "GEPRSQPPVERPPTAET", "sequence_mut": "", "comment": "When in a heterodimer with Chrac-14, does not affect DNA binding or Acf nucleosome sliding activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9V452", "url": "https://www.uniprot.org/uniprotkb/Q9V452" }, { "database": "PubMed", "id": "16260604", "url": "https://pubmed.ncbi.nlm.nih.gov/16260604" } ], "uniprot_canonical_ac": "Q9V452-1" } ], "record_id": "pubmed.16260604", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The histone-fold protein CHRAC14 influences chromatin composition in response to DNA damage.", "journal": "Cell reports", "date": "2014-04-24", "authors": "Mathew Veena, Pauleau Anne-Laure, Steffen Natascha, Bergner Andrea, Becker Peter B, Erhardt Sylvia", "reference": { "type": "PubMed", "id": "24703848", "url": "https://pubmed.ncbi.nlm.nih.gov/24703848" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V444-1", "protein_name": "DNA polymerase epsilon subunit 3", "gene_name": "Chrac-14", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V6Q2-1", "protein_name": "Histone H3-like centromeric protein cid", "gene_name": "cid", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V444", "url": "https://www.uniprot.org/uniprotkb/Q9V444" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.24703848", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A role for tuned levels of nucleosome remodeler subunit ACF1 during Drosophila oogenesis.", "journal": "Developmental biology", "date": "2016-03-15", "authors": "B\u00f6rner Kenneth, Jain Dhawal, Vazquez-Pianzola Paula, Vengadasalam Sandra, Steffen Natascha, Fyodorov Dmitry V, Tomancak Pavel, Konev Alexander, Suter Beat, Becker Peter B", "reference": { "type": "PubMed", "id": "26851213", "url": "https://pubmed.ncbi.nlm.nih.gov/26851213" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V452-1", "protein_name": "Chromatin accessibility complex 16kD protein", "gene_name": "Chrac-16", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V452", "url": "https://www.uniprot.org/uniprotkb/Q9V452" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.26851213", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and complete cDNA sequence of the missing Drosophila MCMs: DmMCM3, DmMCM6 and DmMCM7.", "journal": "Gene", "date": "1999", "authors": "Feger G", "reference": { "type": "PubMed", "id": "10023044", "url": "https://pubmed.ncbi.nlm.nih.gov/10023044" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V461-1", "protein_name": "DNA replication licensing factor Mcm6", "gene_name": "Mcm6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9XYU0-1", "protein_name": "DNA replication licensing factor Mcm7", "gene_name": "Mcm7", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9XYU1-1", "protein_name": "DNA replication licensing factor Mcm3", "gene_name": "Mcm3", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V461", "url": "https://www.uniprot.org/uniprotkb/Q9V461" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10023044", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA cloning and expression during development of Drosophila melanogaster MCM3, MCM6 and MCM7.", "journal": "Gene", "date": "1998", "authors": "Ohno K, Hirose F, Inoue Y H, Takisawa H, Mimura S, Hashimoto Y, Kiyono T, Nishida Y, Matsukage A", "reference": { "type": "PubMed", "id": "9795205", "url": "https://pubmed.ncbi.nlm.nih.gov/9795205" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V461-1", "protein_name": "DNA replication licensing factor Mcm6", "gene_name": "Mcm6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9XYU0-1", "protein_name": "DNA replication licensing factor Mcm7", "gene_name": "Mcm7", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9XYU1-1", "protein_name": "DNA replication licensing factor Mcm3", "gene_name": "Mcm3", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V461", "url": "https://www.uniprot.org/uniprotkb/Q9V461" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9795205", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Induction of neuron-specific glycosylation by Tollo/Toll-8, a Drosophila Toll-like receptor expressed in non-neural cells.", "journal": "Development", "date": "2003", "authors": "Seppo Antti, Matani Parul, Sharrow Mary, Tiemeyer Michael", "reference": { "type": "PubMed", "id": "12588858", "url": "https://pubmed.ncbi.nlm.nih.gov/12588858" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V477-1", "protein_name": "Toll-like receptor Tollo", "gene_name": "Tollo", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V477", "url": "https://www.uniprot.org/uniprotkb/Q9V477" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12588858", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ectopic expression of Tollo/Toll-8 antagonizes Dpp signaling and induces cell sorting in the Drosophila wing.", "journal": "Genesis (New York, N.Y. : 2000)", "date": "2006-11", "authors": "Kim Sangjoon, Chung SeYeon, Yoon Jeongsook, Choi Kwang-Wook, Yim Jeongbin", "reference": { "type": "PubMed", "id": "17078066", "url": "https://pubmed.ncbi.nlm.nih.gov/17078066" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V477-1", "protein_name": "Toll-like receptor Tollo", "gene_name": "Tollo", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V477", "url": "https://www.uniprot.org/uniprotkb/Q9V477" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.17078066", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamic developmental elaboration of N-linked glycan complexity in the Drosophila melanogaster embryo.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Aoki K, Perlman M, Lim JM, Cantu R, Wells L, Tiemeyer M", "reference": { "type": "PubMed", "id": "17264077", "url": "https://pubmed.ncbi.nlm.nih.gov/17264077" }, "referenced_glycans": [ { "glytoucan_ac": "G00406II" }, { "glytoucan_ac": "G58858DY" }, { "glytoucan_ac": "G59325ZF" }, { "glytoucan_ac": "G88489PQ" }, { "glytoucan_ac": "G88918AF" }, { "glytoucan_ac": "G89319AW" }, { "glytoucan_ac": "G89763TI" }, { "glytoucan_ac": "G78607HP" }, { "glytoucan_ac": "G78850SX" }, { "glytoucan_ac": "G82119TF" }, { "glytoucan_ac": "G82348BZ" }, { "glytoucan_ac": "G26322FA" }, { "glytoucan_ac": "G26352KE" }, { "glytoucan_ac": "G27502BJ" }, { "glytoucan_ac": "G72291OX" }, { "glytoucan_ac": "G66538GV" }, { "glytoucan_ac": "G43463XA" }, { "glytoucan_ac": "G44298KL" }, { "glytoucan_ac": "G44576SJ" }, { "glytoucan_ac": "G25637MV" }, { "glytoucan_ac": "G11460AB" }, { "glytoucan_ac": "G11771HD" }, { "glytoucan_ac": "G73636FD" }, { "glytoucan_ac": "G74259OD" }, { "glytoucan_ac": "G74724QE" }, { "glytoucan_ac": "G97800PC" }, { "glytoucan_ac": "G19386HE" }, { "glytoucan_ac": "G37692XE" }, { "glytoucan_ac": "G38193VX" }, { "glytoucan_ac": "G60145BJ" }, { "glytoucan_ac": "G81295CK" }, { "glytoucan_ac": "G05479GT" }, { "glytoucan_ac": "G05724UK" }, { "glytoucan_ac": "G06110VR" }, { "glytoucan_ac": "G53322AG" }, { "glytoucan_ac": "G84820NF" }, { "glytoucan_ac": "G99858XP" }, { "glytoucan_ac": "G39943KJ" }, { "glytoucan_ac": "G41463QD" }, { "glytoucan_ac": "G21455AX" }, { "glytoucan_ac": "G22768VO" }, { "glytoucan_ac": "G77141OA" }, { "glytoucan_ac": "G14669DU" }, { "glytoucan_ac": "G33609NS" }, { "glytoucan_ac": "G34427JE" }, { "glytoucan_ac": "G70101JE" }, { "glytoucan_ac": "G63628AV" }, { "glytoucan_ac": "G64006UO" }, { "glytoucan_ac": "G64159KW" }, { "glytoucan_ac": "G64162JC" }, { "glytoucan_ac": "G64527OM" }, { "glytoucan_ac": "G64780OA" }, { "glytoucan_ac": "G01595WZ" }, { "glytoucan_ac": "G02654ED" }, { "glytoucan_ac": "G94703YT" }, { "glytoucan_ac": "G94854LT" }, { "glytoucan_ac": "G50045TK" }, { "glytoucan_ac": "G51287LK" }, { "glytoucan_ac": "G51393QH" }, { "glytoucan_ac": "G28906TV" }, { "glytoucan_ac": "G87655FE" }, { "glytoucan_ac": "G46687AB" }, { "glytoucan_ac": "G47202BY" }, { "glytoucan_ac": "G47552OZ" }, { "glytoucan_ac": "G03833LE" }, { "glytoucan_ac": "G03842KQ" }, { "glytoucan_ac": "G04604BY" }, { "glytoucan_ac": "G55220VL" }, { "glytoucan_ac": "G55383ZG" }, { "glytoucan_ac": "G91885UU" }, { "glytoucan_ac": "G49874UX" }, { "glytoucan_ac": "G10256JP" }, { "glytoucan_ac": "G10471FG" }, { "glytoucan_ac": "G85437LF" }, { "glytoucan_ac": "G86427WL" }, { "glytoucan_ac": "G29880MM" }, { "glytoucan_ac": "G31277DF" }, { "glytoucan_ac": "G39188ZX" }, { "glytoucan_ac": "G39389UU" }, { "glytoucan_ac": "G23453IV" }, { "glytoucan_ac": "G23863VK" }, { "glytoucan_ac": "G76317SK" }, { "glytoucan_ac": "G31685JQ" }, { "glytoucan_ac": "G31916IQ" }, { "glytoucan_ac": "G31936TA" }, { "glytoucan_ac": "G69689WT" }, { "glytoucan_ac": "G62036UG" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V477-1", "protein_name": "Toll-like receptor Tollo", "gene_name": "Tollo", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V477", "url": "https://www.uniprot.org/uniprotkb/Q9V477" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "glycan_expression": [ { "glytoucan_ac": "G00406II", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G58858DY", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G58858DY", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G58858DY", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G59325ZF", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G59325ZF", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G59325ZF", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G88489PQ", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G88489PQ", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G88489PQ", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G88918AF", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G88918AF", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G88918AF", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G89319AW", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G89763TI", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G89763TI", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G89763TI", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G78607HP", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G78607HP", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G78607HP", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G78850SX", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G78850SX", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G78850SX", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G82119TF", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G82348BZ", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G26322FA", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G26322FA", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G26322FA", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G26352KE", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G26352KE", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G26352KE", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G27502BJ", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G27502BJ", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G27502BJ", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G72291OX", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G66538GV", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G43463XA", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G43463XA", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G43463XA", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G44298KL", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G44298KL", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G44298KL", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G44576SJ", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G44576SJ", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G44576SJ", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G25637MV", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G11460AB", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G11771HD", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G11771HD", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G11771HD", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G73636FD", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G73636FD", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G73636FD", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G74259OD", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G74259OD", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G74259OD", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G74724QE", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G97800PC", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G97800PC", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G97800PC", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G19386HE", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G19386HE", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G19386HE", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G37692XE", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G37692XE", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G37692XE", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G38193VX", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G38193VX", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G38193VX", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G60145BJ", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G05479GT", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G05479GT", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G05479GT", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G05724UK", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G06110VR", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G53322AG", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G53322AG", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G53322AG", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G84820NF", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G99858XP", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G39943KJ", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G41463QD", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G41463QD", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G41463QD", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G21455AX", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G21455AX", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G21455AX", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G22768VO", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G77141OA", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G77141OA", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G77141OA", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G14669DU", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G33609NS", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G34427JE", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G34427JE", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G34427JE", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G70101JE", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G63628AV", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G64006UO", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G64006UO", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G64006UO", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G64159KW", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G64159KW", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G64159KW", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G64162JC", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G64527OM", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G64780OA", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G64780OA", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G64780OA", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G01595WZ", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G01595WZ", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G01595WZ", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G02654ED", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G02654ED", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G02654ED", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G94703YT", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G94703YT", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G94703YT", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G94854LT", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G51287LK", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G51393QH", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G51393QH", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G51393QH", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G28906TV", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G28906TV", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G28906TV", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G87655FE", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G87655FE", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G87655FE", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G46687AB", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G47202BY", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G47202BY", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G47202BY", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G47552OZ", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G47552OZ", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G47552OZ", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G03833LE", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G03833LE", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G03833LE", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G03842KQ", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G04604BY", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G04604BY", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G04604BY", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G55220VL", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G55383ZG", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G91885UU", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G91885UU", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G91885UU", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G49874UX", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G10256JP", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G10471FG", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G85437LF", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G85437LF", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G85437LF", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G86427WL", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G86427WL", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G86427WL", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G29880MM", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G31277DF", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G31277DF", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G31277DF", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G39188ZX", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G39389UU", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G39389UU", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G39389UU", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G23453IV", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G76317SK", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G76317SK", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G76317SK", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G31685JQ", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G31916IQ", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G31936TA", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G69689WT", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G69689WT", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G69689WT", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G62036UG", "abundance": "", "tissue": { "name": "early embryo", "namespace": "UBERON", "id": "0019248", "url": "http://purl.obolibrary.org/obo/UBERON_0019248" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G62036UG", "abundance": "", "tissue": { "name": "embryo", "namespace": "UBERON", "id": "0000922", "url": "http://purl.obolibrary.org/obo/UBERON_0000922" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} }, { "glytoucan_ac": "G62036UG", "abundance": "", "tissue": { "name": "late embryo", "namespace": "UBERON", "id": "0000323", "url": "http://purl.obolibrary.org/obo/UBERON_0000323" }, "species": { "name": "Drosophila melanogaster", "taxid": 7227, "reference_species": "Drosophila melanogaster [7227]", "common_name": "Fruit fly", "glygen_name": "Fruit fly" }, "cell_line": {} } ], "record_id": "pubmed.17264077", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 87 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NF-kappaB/Rel-mediated regulation of the neural fate in Drosophila.", "journal": "PloS one", "date": "2007", "authors": "Ayyar S, Pistillo D, Calleja M, Brookfield A, Gittins K, Goldstone C, Simpson P", "reference": { "type": "PubMed", "id": "18000549", "url": "https://pubmed.ncbi.nlm.nih.gov/18000549" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V477-1", "protein_name": "Toll-like receptor Tollo", "gene_name": "Tollo", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P15330-1", "protein_name": "Embryonic polarity protein dorsal", "gene_name": "dl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P98149-1", "protein_name": "Dorsal-related immunity factor Dif", "gene_name": "Dif", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94527-1", "protein_name": "Nuclear factor NF-kappa-B p110 subunit", "gene_name": "Rel", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V477", "url": "https://www.uniprot.org/uniprotkb/Q9V477" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 181, "end_pos": 181, "sequence_org": "G", "sequence_mut": "D", "comment": "In Dif1; immune response defective. Reduced survival following infection with fungi, and reduced levels of Drs following immune challenge with fungi or bacteria. No down-regulation of the serpin Spn27A in response to bacterial infection. Ectopic bristles form on the dorsocentral, scutellar and lateral regions of the notum.", "evidence": [ { "database": "UniProtKB", "id": "P98149", "url": "https://www.uniprot.org/uniprotkb/P98149" }, { "database": "PubMed", "id": "21576362", "url": "https://pubmed.ncbi.nlm.nih.gov/21576362" }, { "database": "PubMed", "id": "18000549", "url": "https://pubmed.ncbi.nlm.nih.gov/18000549" }, { "database": "PubMed", "id": "12456640", "url": "https://pubmed.ncbi.nlm.nih.gov/12456640" } ], "uniprot_canonical_ac": "P98149-1" } ], "record_id": "pubmed.18000549", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of Toll-related genes in Drosophila.", "journal": "Development, growth & differentiation", "date": "2010-12", "authors": "Yagi Yoshimasa, Nishida Yasuyoshi, Ip Y Tony", "reference": { "type": "PubMed", "id": "21158756", "url": "https://pubmed.ncbi.nlm.nih.gov/21158756" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V477-1", "protein_name": "Toll-like receptor Tollo", "gene_name": "Tollo", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VUN0-1", "protein_name": "Toll-like receptor 6", "gene_name": "Toll-6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7KIN0-1", "protein_name": "Toll-like receptor 7", "gene_name": "Toll-7", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V477", "url": "https://www.uniprot.org/uniprotkb/Q9V477" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.21158756", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retrograde neurotrophin signaling through Tollo regulates synaptic growth in Drosophila.", "journal": "The Journal of cell biology", "date": "2014-03-31", "authors": "Ballard Shannon L, Miller Daniel L, Ganetzky Barry", "reference": { "type": "PubMed", "id": "24662564", "url": "https://pubmed.ncbi.nlm.nih.gov/24662564" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V477-1", "protein_name": "Toll-like receptor Tollo", "gene_name": "Tollo", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VLV7-1", "protein_name": "Protein spaetzle 3", "gene_name": "spz3", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V477", "url": "https://www.uniprot.org/uniprotkb/Q9V477" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.24662564", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A positional Toll receptor code directs convergent extension in Drosophila.", "journal": "Nature", "date": "2014-11-27", "authors": "Par\u00e9 Adam C, Vichas Athea, Fincher Christopher T, Mirman Zachary, Farrell Dene L, Mainieri Avantika, Zallen Jennifer A", "reference": { "type": "PubMed", "id": "25363762", "url": "https://pubmed.ncbi.nlm.nih.gov/25363762" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V477-1", "protein_name": "Toll-like receptor Tollo", "gene_name": "Tollo", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VUN0-1", "protein_name": "Toll-like receptor 6", "gene_name": "Toll-6", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V477", "url": "https://www.uniprot.org/uniprotkb/Q9V477" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.25363762", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An ancient defense system eliminates unfit cells from developing tissues during cell competition.", "journal": "Science (New York, N.Y.)", "date": "2014-12-05", "authors": "Meyer S N, Amoyel M, Berganti\u00f1os C, de la Cova C, Schertel C, Basler K, Johnston L A", "reference": { "type": "PubMed", "id": "25477468", "url": "https://pubmed.ncbi.nlm.nih.gov/25477468" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V477-1", "protein_name": "Toll-like receptor Tollo", "gene_name": "Tollo", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P15330-1", "protein_name": "Embryonic polarity protein dorsal", "gene_name": "dl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P98149-1", "protein_name": "Dorsal-related immunity factor Dif", "gene_name": "Dif", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94527-1", "protein_name": "Nuclear factor NF-kappa-B p110 subunit", "gene_name": "Rel", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V477", "url": "https://www.uniprot.org/uniprotkb/Q9V477" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.25477468", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The NHL-domain protein Wech is crucial for the integrin-cytoskeleton link.", "journal": "Nature cell biology", "date": "2008-04", "authors": "L\u00f6er Birgit, Bauer Reinhard, Bornheim Roland, Grell Jessica, Kremmer Elisabeth, Kolanus Waldemar, Hoch Michael", "reference": { "type": "PubMed", "id": "18327251", "url": "https://pubmed.ncbi.nlm.nih.gov/18327251" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V4M2-1", "protein_name": "Protein wech", "gene_name": "wech", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V4M2", "url": "https://www.uniprot.org/uniprotkb/Q9V4M2" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.18327251", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mei-P26 regulates microRNAs and cell growth in the Drosophila ovarian stem cell lineage.", "journal": "Nature", "date": "2008", "authors": "Neum\u00fcller Ralph A, Betschinger Joerg, Fischer Anja, Bushati Natascha, Poernbacher Ingrid, Mechtler Karl, Cohen Stephen M, Knoblich Juergen A", "reference": { "type": "PubMed", "id": "18528333", "url": "https://pubmed.ncbi.nlm.nih.gov/18528333" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V4M2-1", "protein_name": "Protein wech", "gene_name": "wech", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "M9PH32-1", "protein_name": "Protein meiotic P26", "gene_name": "mei-P26", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8MQJ9-1", "protein_name": "Protein brain tumor", "gene_name": "brat", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V4M2", "url": "https://www.uniprot.org/uniprotkb/Q9V4M2" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.18528333", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mei-P26 regulates the maintenance of ovarian germline stem cells by promoting BMP signaling.", "journal": "Development", "date": "2012", "authors": "Li Yun, Maines Jean Z, Tastan Om\u00fcr Y, McKearin Dennis M, Buszczak Michael", "reference": { "type": "PubMed", "id": "22438571", "url": "https://pubmed.ncbi.nlm.nih.gov/22438571" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V4M2-1", "protein_name": "Protein wech", "gene_name": "wech", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "M9PH32-1", "protein_name": "Protein meiotic P26", "gene_name": "mei-P26", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P25724-1", "protein_name": "Protein nanos", "gene_name": "nanos", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V4M2", "url": "https://www.uniprot.org/uniprotkb/Q9V4M2" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.22438571", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of immune system and response genes, and novel mutations causing melanotic tumor formation in Drosophila melanogaster.", "journal": "Genetics", "date": "1996-06", "authors": "Rodriguez A, Zhou Z, Tang M L, Meller S, Chen J, Bellen H, Kimbrell D A", "reference": { "type": "PubMed", "id": "8725239", "url": "https://pubmed.ncbi.nlm.nih.gov/8725239" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V4M2-1", "protein_name": "Protein wech", "gene_name": "wech", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V4M2", "url": "https://www.uniprot.org/uniprotkb/Q9V4M2" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8725239", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A conserved F box regulatory complex controls proteasome activity in Drosophila.", "journal": "Cell", "date": "2011", "authors": "Bader M, Benjamin S, Wapinski OL, Smith DM, Goldberg AL, Steller H", "reference": { "type": "PubMed", "id": "21529711", "url": "https://pubmed.ncbi.nlm.nih.gov/21529711" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V5C6-1", "protein_name": "Proteasome subunit alpha type-3", "gene_name": "Prosalpha7", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V637-1", "protein_name": "Proteasome inhibitor PI31 subunit", "gene_name": "PI31", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8SX86-1", "protein_name": "Protein nutcracker", "gene_name": "ntc", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V5C6", "url": "https://www.uniprot.org/uniprotkb/Q9V5C6" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 103, "end_pos": 103, "sequence_org": "I", "sequence_mut": "E", "comment": "Fails to rescue null mutant phenotype; when associated with E-96.", "evidence": [ { "database": "UniProtKB", "id": "Q9V637", "url": "https://www.uniprot.org/uniprotkb/Q9V637" }, { "database": "PubMed", "id": "21529711", "url": "https://pubmed.ncbi.nlm.nih.gov/21529711" } ], "uniprot_canonical_ac": "Q9V637-1" }, { "start_pos": 268, "end_pos": 270, "sequence_org": "YYM", "sequence_mut": "", "comment": "Abolishes interaction with Tnks, PSMD5 and PSMD9. Reduces 26S proteasome activation.", "evidence": [ { "database": "UniProtKB", "id": "Q9V637", "url": "https://www.uniprot.org/uniprotkb/Q9V637" }, { "database": "PubMed", "id": "21529711", "url": "https://pubmed.ncbi.nlm.nih.gov/21529711" }, { "database": "PubMed", "id": "23622245", "url": "https://pubmed.ncbi.nlm.nih.gov/23622245" } ], "uniprot_canonical_ac": "Q9V637-1" }, { "start_pos": 96, "end_pos": 96, "sequence_org": "I", "sequence_mut": "E", "comment": "Fails to rescue null mutant phenotype; when associated with E-103.", "evidence": [ { "database": "UniProtKB", "id": "Q9V637", "url": "https://www.uniprot.org/uniprotkb/Q9V637" }, { "database": "PubMed", "id": "21529711", "url": "https://pubmed.ncbi.nlm.nih.gov/21529711" } ], "uniprot_canonical_ac": "Q9V637-1" }, { "start_pos": 188, "end_pos": 188, "sequence_org": "V", "sequence_mut": "E", "comment": "Reduces interaction with PI31.", "evidence": [ { "database": "UniProtKB", "id": "Q8SX86", "url": "https://www.uniprot.org/uniprotkb/Q8SX86" }, { "database": "PubMed", "id": "21529711", "url": "https://pubmed.ncbi.nlm.nih.gov/21529711" } ], "uniprot_canonical_ac": "Q8SX86-1" } ], "record_id": "pubmed.21529711", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cutoff and aubergine mutations result in retrotransposon upregulation and checkpoint activation in Drosophila.", "journal": "Current biology : CB", "date": "2007-04-03", "authors": "Chen Yu, Pane Attilio, Sch\u00fcpbach Trudi", "reference": { "type": "PubMed", "id": "17363252", "url": "https://pubmed.ncbi.nlm.nih.gov/17363252" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V629-1", "protein_name": "Protein cutoff", "gene_name": "cuff", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VM71-1", "protein_name": "5'-3' exoribonuclease 2 homolog", "gene_name": "Rat1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V629", "url": "https://www.uniprot.org/uniprotkb/Q9V629" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.17363252", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Cutoff protein regulates piRNA cluster expression and piRNA production in the Drosophila germline.", "journal": "The EMBO journal", "date": "2011-11-16", "authors": "Pane Attilio, Jiang Peng, Zhao Dorothy Yanling, Singh Mona, Sch\u00fcpbach Trudi", "reference": { "type": "PubMed", "id": "21952049", "url": "https://pubmed.ncbi.nlm.nih.gov/21952049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V629-1", "protein_name": "Protein cutoff", "gene_name": "cuff", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V629", "url": "https://www.uniprot.org/uniprotkb/Q9V629" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.21952049", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transgenerationally inherited piRNAs trigger piRNA biogenesis by changing the chromatin of piRNA clusters and inducing precursor processing.", "journal": "Genes & development", "date": "2014-08-01", "authors": "Le Thomas Adrien, Stuwe Evelyn, Li Sisi, Du Jiamu, Marinov Georgi, Rozhkov Nikolay, Chen Yung-Chia Ariel, Luo Yicheng, Sachidanandam Ravi, Toth Katalin Fejes, Patel Dinshaw, Aravin Alexei A", "reference": { "type": "PubMed", "id": "25085419", "url": "https://pubmed.ncbi.nlm.nih.gov/25085419" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V629-1", "protein_name": "Protein cutoff", "gene_name": "cuff", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7JXA8-1", "protein_name": "Chromo domain-containing protein rhino", "gene_name": "rhi", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P02299-1", "protein_name": "Histone H3", "gene_name": "His3:CG31613; His3:CG33803; His3:CG33806; His3:CG33809; His3:CG33812; His3:CG33815; His3:CG33818; His3:CG33821; His3:CG33824; His3:CG33827; His3:CG33830; His3:CG33833; His3:CG33836; His3:CG33839; His3:CG33842; His3:CG33845; His3:CG33848; His3:CG33851; His3:CG33854; His3:CG33857; His3:CG33860; His3:CG33863; His3:CG33866; His3", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V629", "url": "https://www.uniprot.org/uniprotkb/Q9V629" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.25085419", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DFsn collaborates with Highwire to down-regulate the Wallenda/DLK kinase and restrain synaptic terminal growth.", "journal": "Neural development", "date": "2007-08-15", "authors": "Wu Chunlai, Daniels Richard W, DiAntonio Aaron", "reference": { "type": "PubMed", "id": "17697379", "url": "https://pubmed.ncbi.nlm.nih.gov/17697379" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V6L9-1", "protein_name": "F-box/SPRY domain-containing protein 1", "gene_name": "Fsn", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NB71-1", "protein_name": "E3 ubiquitin-protein ligase highwire", "gene_name": "hiw", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V6L9", "url": "https://www.uniprot.org/uniprotkb/Q9V6L9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.17697379", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila Rae1 controls the abundance of the ubiquitin ligase Highwire in post-mitotic neurons.", "journal": "Nat. Neurosci.", "date": "2011", "authors": "Tian X, Li J, Valakh V, DiAntonio A, Wu C", "reference": { "type": "PubMed", "id": "21874015", "url": "https://pubmed.ncbi.nlm.nih.gov/21874015" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9V6L9-1", "protein_name": "F-box/SPRY domain-containing protein 1", "gene_name": "Fsn", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NB71-1", "protein_name": "E3 ubiquitin-protein ligase highwire", "gene_name": "hiw", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCH5-1", "protein_name": "Nuclear pore complex protein Nup98-Nup96", "gene_name": "Nup98-96", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W2E7-1", "protein_name": "Protein Rae1", "gene_name": "Rae1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9V6L9", "url": "https://www.uniprot.org/uniprotkb/Q9V6L9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 1012, "end_pos": 1014, "sequence_org": "VQV", "sequence_mut": "ELE", "comment": "Unable to rescue synaptic terminal overgrowth in mutants but has no effect on binding to Rae1; when associated with 671-T--R-1011 DEL.", "evidence": [ { "database": "UniProtKB", "id": "Q9NB71", "url": "https://www.uniprot.org/uniprotkb/Q9NB71" }, { "database": "PubMed", "id": "21874015", "url": "https://pubmed.ncbi.nlm.nih.gov/21874015" } ], "uniprot_canonical_ac": "Q9NB71-1" }, { "start_pos": 1266, "end_pos": 2146, "sequence_org": "RSMHEARNQIFEEQLPEVGSSAAAAAVAAPGTPVSAGSVPRSRRGGKQGTSSPEPIPSPPQLAFTMDPTYNVLWVFDGAARKLRCHNVVASDINDSDANAATYRSLLSPELSLPDRVDSRVARSQASLNLLACLDILTSAQDNIPGCFEQPLLKQTQQTAETQAGEFQVVNRFDNFGGGWGYSGHSVEAIRFSADTDIVICGFGMFGGRGEYSCKLKLFDLGGDGGGYEKEGILISETKEVPYECGARSKHHILLPKPVSAVAGRWYLVWARIAGPSSDCGSCGQASVTTEDQVVFSFKSSKKANNGTDVNSGQIPAILYRLVTQDCKQTPAQMDADPVQRISRAFANSVSRECFESLVVLLSWSWDCFKLQLREERDRSRPLQLQQSLQYLGYVIKSCLRLLRKYTIEIYPQRNSSTSVATGGGSNAAHGSGVVTTAKSVQSKPNKDKNTPRVVGNAGVMAKYFGDPSTSVAPAMISSASSGGAPSTSASAAVAPGSGTPVTRKTNMENIQLAECIGNVRALLIGIFCDDIFKDIATDEGYELSLEILDECHLSFVACFDAFYPTSSLKWNCLCDLLAQMDRGALHSRLLSAILAGLCSPSVKLRATFSLLSAAGNERQSIISPSDNSGLPMLSSTDAHPYPVLVEQMIYRTQQEKSDFLSNSWTFKDVLVRLLDIIASPIRSRIEAIYSRSLGSLGYPGGKDCVNQGLIDNCCHLLARVLAEIVYQTAMGEYDKLFMPPRTLHSTGARFARCDVSRTWNTGNFGPDAIAFAVDRPGVAIAGAMVYSGSGSYDYQLELLYDNTADLQPQHKWETLESVSGSYDQDAVHNDLAEIKFDHPVHIKENARYALRLCSQGARTCSGDAGMPAVRGPCGAQFHFY", "sequence_mut": "", "comment": "Unable to rescue synaptic terminal overgrowth in mutants but has no effect on binding to Rae1.", "evidence": [ { "database": "UniProtKB", "id": "Q9NB71", "url": "https://www.uniprot.org/uniprotkb/Q9NB71" }, { "database": "PubMed", "id": "21874015", "url": "https://pubmed.ncbi.nlm.nih.gov/21874015" } ], "uniprot_canonical_ac": "Q9NB71-1" }, { "start_pos": 1, "end_pos": 2419, "sequence_org": "MVGLLNPLKYGDHFYELYTNSTRRKMQHDRKVLTKRKSRKDKSAAAMAAAAAAAVLEGNAGAGGLVNPLDPPLVKEQLMILPSFPVAHIELDPNASKFAVFSAIRSTVLEAETRYSLFQEGGAPSGQSGSNQKKWSNNVNSACCMMCAHSCMISNLLDCSCHAHMAMHGAVGPGNAGPGGPVGVLVDGRIPAPVPVVVGGPGLPAEKRPRRDSANSDADSDTEEPTEREPVYATVPLIVGAGLRSLFELIADARHVHPLLCTKALKALLDVIQGQQPESFKLEPEELINPLYDLLLDLATMPAALNSATGAEANWSAMACAALLGLCIARGDTGKMLKAIAAMLMTPRQLSAQIVQLPVVLATLQHTVISAALNKPTRPDFHSHGVPHNSLIDEFPVKLPPLSTGAPITSPAMACDGVFVYLLYGGTLLKIGTGFGGSYKGHIYAQNEDFSHERSAWLGYSGGQLYFRRTCRRSAGDQLQMVGLDTLAIKAMSPLSMLHMREGLNYVLFTDDDSLHAICSNRDDTLVVKKLNLYHNSYNIDPPPFELPLQLARKKFRTLGYAAFEDELLNQYQIQRIQSAHNSFEPKLPAPCRDADVDVMGMACGKEFGLVRASNGRVYYYGKSAALGLKCVGRTPTLKLTELVISKAANIVHVAVGHDGIHALLVNDDGTVFFAGTARRGEDGDSSKNRRQPKAVKPKKMTKIDGHVVVHAACNNGTSAFVTKTGKLIMYGKDTAHCDAMGFVSELLEQHVTKVALGKAHCVALNAKGQLFSFGLNNKGQCGRIFNKLQPVKDVPPFASSSTAAACFASLLPLDKRLKLDFSTLCDYDDHNLVQGQCRVCVICRECTGYNVSCVSALNVPLDQRLAGSICPCGHGDAGCAKCGLCAACIALQDSDEAKTELKPPPSDVQQRQQRSKTLIMRRKERKGELETGAAGGGAATPTDLDKDPPRVAPLAPQLLQLTSSSPVVQVACGLHHTVVLTLAGEVYTFGSNQYGQLGSGDLQPVSGPVRVQVPGAISQVAAGSNHTVLLTSKGMVYTFGNYQKGQLGRLPSDYGLKPPPQDDDSPVGAGSDGGAGGSPTVAPVGMPGPERSQSPANVQPSGSKEMPPLLPVLTQRQKFLWNCSPGAVFGLGPCYGKKVTWIGANGDQTFIKIDESLITAQMLPKMHVVANKKTILLIPSIPLSFHTLSINRRDGSCTAHYRGQTNFVKLMQAQPEQQQPEINSNLDVAVTPVADSPAHASTSSLLAALTGTATAGVPINEQMSRSMHEARNQIFEEQLPEVGSSAAAAAVAAPGTPVSAGSVPRSRRGGKQGTSSPEPIPSPPQLAFTMDPTYNVLWVFDGAARKLRCHNVVASDINDSDANAATYRSLLSPELSLPDRVDSRVARSQASLNLLACLDILTSAQDNIPGCFEQPLLKQTQQTAETQAGEFQVVNRFDNFGGGWGYSGHSVEAIRFSADTDIVICGFGMFGGRGEYSCKLKLFDLGGDGGGYEKEGILISETKEVPYECGARSKHHILLPKPVSAVAGRWYLVWARIAGPSSDCGSCGQASVTTEDQVVFSFKSSKKANNGTDVNSGQIPAILYRLVTQDCKQTPAQMDADPVQRISRAFANSVSRECFESLVVLLSWSWDCFKLQLREERDRSRPLQLQQSLQYLGYVIKSCLRLLRKYTIEIYPQRNSSTSVATGGGSNAAHGSGVVTTAKSVQSKPNKDKNTPRVVGNAGVMAKYFGDPSTSVAPAMISSASSGGAPSTSASAAVAPGSGTPVTRKTNMENIQLAECIGNVRALLIGIFCDDIFKDIATDEGYELSLEILDECHLSFVACFDAFYPTSSLKWNCLCDLLAQMDRGALHSRLLSAILAGLCSPSVKLRATFSLLSAAGNERQSIISPSDNSGLPMLSSTDAHPYPVLVEQMIYRTQQEKSDFLSNSWTFKDVLVRLLDIIASPIRSRIEAIYSRSLGSLGYPGGKDCVNQGLIDNCCHLLARVLAEIVYQTAMGEYDKLFMPPRTLHSTGARFARCDVSRTWNTGNFGPDAIAFAVDRPGVAIAGAMVYSGSGSYDYQLELLYDNTADLQPQHKWETLESVSGSYDQDAVHNDLAEIKFDHPVHIKENARYALRLCSQGARTCSGDAGMPAVRGPCGAQFHFYACDLSFNGTTPARGQLPCILYYSTPMKQDGHSASGRTGDGSNVATHLEDRIMLLGPHEVSTRDTALQIAADITKKCTELLILARNAMAASCSPSDNSSNHTQTIDSEHNITPIEEHMDINWANNSRTAALPTAIDPQLSTARDLGKRIESFSKGLMETLKFDKRSTNPFEMEIEIGATEVEESADLRNGQSQSVSQSQSQSQSVPINGNERTADFEFAEQSAQQSMPQHLHSDSEEAPLEVAGMAAGGGVSVADGSGGVAGVGSQAAAVQLLE", "sequence_mut": "", "comment": "Unable to rescue synaptic terminal overgrowth in mutants but has no effect on binding to Rae1.", "evidence": [ { "database": "UniProtKB", "id": "Q9NB71", "url": "https://www.uniprot.org/uniprotkb/Q9NB71" }, { "database": "PubMed", "id": "21874015", "url": "https://pubmed.ncbi.nlm.nih.gov/21874015" } ], "uniprot_canonical_ac": "Q9NB71-1" }, { "start_pos": 1, "end_pos": 4083, "sequence_org": "MVGLLNPLKYGDHFYELYTNSTRRKMQHDRKVLTKRKSRKDKSAAAMAAAAAAAVLEGNAGAGGLVNPLDPPLVKEQLMILPSFPVAHIELDPNASKFAVFSAIRSTVLEAETRYSLFQEGGAPSGQSGSNQKKWSNNVNSACCMMCAHSCMISNLLDCSCHAHMAMHGAVGPGNAGPGGPVGVLVDGRIPAPVPVVVGGPGLPAEKRPRRDSANSDADSDTEEPTEREPVYATVPLIVGAGLRSLFELIADARHVHPLLCTKALKALLDVIQGQQPESFKLEPEELINPLYDLLLDLATMPAALNSATGAEANWSAMACAALLGLCIARGDTGKMLKAIAAMLMTPRQLSAQIVQLPVVLATLQHTVISAALNKPTRPDFHSHGVPHNSLIDEFPVKLPPLSTGAPITSPAMACDGVFVYLLYGGTLLKIGTGFGGSYKGHIYAQNEDFSHERSAWLGYSGGQLYFRRTCRRSAGDQLQMVGLDTLAIKAMSPLSMLHMREGLNYVLFTDDDSLHAICSNRDDTLVVKKLNLYHNSYNIDPPPFELPLQLARKKFRTLGYAAFEDELLNQYQIQRIQSAHNSFEPKLPAPCRDADVDVMGMACGKEFGLVRASNGRVYYYGKSAALGLKCVGRTPTLKLTELVISKAANIVHVAVGHDGIHALLVNDDGTVFFAGTARRGEDGDSSKNRRQPKAVKPKKMTKIDGHVVVHAACNNGTSAFVTKTGKLIMYGKDTAHCDAMGFVSELLEQHVTKVALGKAHCVALNAKGQLFSFGLNNKGQCGRIFNKLQPVKDVPPFASSSTAAACFASLLPLDKRLKLDFSTLCDYDDHNLVQGQCRVCVICRECTGYNVSCVSALNVPLDQRLAGSICPCGHGDAGCAKCGLCAACIALQDSDEAKTELKPPPSDVQQRQQRSKTLIMRRKERKGELETGAAGGGAATPTDLDKDPPRVAPLAPQLLQLTSSSPVVQVACGLHHTVVLTLAGEVYTFGSNQYGQLGSGDLQPVSGPVRVQVPGAISQVAAGSNHTVLLTSKGMVYTFGNYQKGQLGRLPSDYGLKPPPQDDDSPVGAGSDGGAGGSPTVAPVGMPGPERSQSPANVQPSGSKEMPPLLPVLTQRQKFLWNCSPGAVFGLGPCYGKKVTWIGANGDQTFIKIDESLITAQMLPKMHVVANKKTILLIPSIPLSFHTLSINRRDGSCTAHYRGQTNFVKLMQAQPEQQQPEINSNLDVAVTPVADSPAHASTSSLLAALTGTATAGVPINEQMSRSMHEARNQIFEEQLPEVGSSAAAAAVAAPGTPVSAGSVPRSRRGGKQGTSSPEPIPSPPQLAFTMDPTYNVLWVFDGAARKLRCHNVVASDINDSDANAATYRSLLSPELSLPDRVDSRVARSQASLNLLACLDILTSAQDNIPGCFEQPLLKQTQQTAETQAGEFQVVNRFDNFGGGWGYSGHSVEAIRFSADTDIVICGFGMFGGRGEYSCKLKLFDLGGDGGGYEKEGILISETKEVPYECGARSKHHILLPKPVSAVAGRWYLVWARIAGPSSDCGSCGQASVTTEDQVVFSFKSSKKANNGTDVNSGQIPAILYRLVTQDCKQTPAQMDADPVQRISRAFANSVSRECFESLVVLLSWSWDCFKLQLREERDRSRPLQLQQSLQYLGYVIKSCLRLLRKYTIEIYPQRNSSTSVATGGGSNAAHGSGVVTTAKSVQSKPNKDKNTPRVVGNAGVMAKYFGDPSTSVAPAMISSASSGGAPSTSASAAVAPGSGTPVTRKTNMENIQLAECIGNVRALLIGIFCDDIFKDIATDEGYELSLEILDECHLSFVACFDAFYPTSSLKWNCLCDLLAQMDRGALHSRLLSAILAGLCSPSVKLRATFSLLSAAGNERQSIISPSDNSGLPMLSSTDAHPYPVLVEQMIYRTQQEKSDFLSNSWTFKDVLVRLLDIIASPIRSRIEAIYSRSLGSLGYPGGKDCVNQGLIDNCCHLLARVLAEIVYQTAMGEYDKLFMPPRTLHSTGARFARCDVSRTWNTGNFGPDAIAFAVDRPGVAIAGAMVYSGSGSYDYQLELLYDNTADLQPQHKWETLESVSGSYDQDAVHNDLAEIKFDHPVHIKENARYALRLCSQGARTCSGDAGMPAVRGPCGAQFHFYACDLSFNGTTPARGQLPCILYYSTPMKQDGHSASGRTGDGSNVATHLEDRIMLLGPHEVSTRDTALQIAADITKKCTELLILARNAMAASCSPSDNSSNHTQTIDSEHNITPIEEHMDINWANNSRTAALPTAIDPQLSTARDLGKRIESFSKGLMETLKFDKRSTNPFEMEIEIGATEVEESADLRNGQSQSVSQSQSQSQSVPINGNERTADFEFAEQSAQQSMPQHLHSDSEEAPLEVAGMAAGGGVSVADGSGGVAGVGSQAAAVQLLEVFNLAASNMFHTLLPLVYAHIANLACSDPKSSVQILGLIKEILPHIAALNQLHVSKDQRQPEPAIFATQTSGSGNSNSSSTTSNHYCVVESDHPYKSASISSYRVEFPPCVQWLTIEFDPQCGTAQLEDYLLLSIPMRPASQAPPVPHVDDYLEQADNNVNGAGDRRRNTGGGIAGSGAAPNTHQRSASVQLTMASCCRSPGCGNAPGSAAAPSSMPLRSQDPNDREWIVVKKFNTASTWLHNVLILPGNCVEFSLETASLYAQDPHNNRYGFKCLVVGYDNPTSINASNSCLIRLEQELAYLGGMCSANLMKKELNLPDDKDVEDMSGIEETINTHHTLLSKGFALSEPQLTVHQALESYLPIGSQSNERQFLKDFISGAPGSSGARLAAWLQPESRLDPNKCELNTITEPLRYGWPSQVTVTIRDQYGDAVLVPELKVEIKAIPTGSGPNGSATGTGTSCTSVAEVSAPGPNLWMRRASRDTWGWGGMAPPPRINYEPTVKDKMVFKAITFMKPYANYSFEELRYASPVQTRVTELLNAKDMEDGTFSVQWTPSSVGAYCLAVTIDGIPLEEVYRVDVKEGILPPPTQRNSAQRRPQAPSKLRRFQARHSSGLRIRSHPTLQSEQVGVVRVGGVISFIDEIENDDGVWLRLSTESIRQHCTMGWYPTEAWCLQFNQHLARMLLQPVTDKEVNPVRKGVGAEEDVEEQPPVTPSASGEASPEPEPDPSPVLSPAKTKPGRFLSGHQSTNPFLYPAKHADLAEREAQVQEEREKEEEQVDDEDADDREPEQEALPAVELLPAHIGSAIAGVVGGGAIKLQALQKWFKGDAVDGPQPLTPSHSPPLAGVSVRELVRAMGGQDSPRGNGNRSQQEQDPEFSLASMRRPNYSASQTAALLSTPKHTPKRSAVVASETSGLEDELSLLQITTTTTGQGEQQSELQLATTSTASSASKRNPMGPIKRAMPPSFAESIRAVFAALLWHEGVVHDAMACASFLKFHPGLPKEGATVVTRRGESGDPRLQLSREQKAQQRHSVEVANAGNYLNIRPSTLETLTKSGNCSLHNRSKYRKNLLSGGGGAINSGDDTAQKLQALPEMVSVLPPALRCLVYLWEQICSGCVQIVQSNALEQREPRLLSPGSRDLNGDADTEGKEGKNSDQASAGEKDLGRKCKRKKKDDGSWCEICELFLPMPVTYHMRIAHPGCGKSAKGKGYNSVGIFCEGWAGNCGEGGKGASSWFLMCDPCRDRYLASCRSANNINSAARQLESSAAEGNELNLFGVKSTTLIANAEVYTTMRENATFLLELCSSSSSASGAAGSLAATSSSSKRSPQQMSVVAMPVVIEHQLGNSDLKPSTSRCSRMARLSGSKFCPGVGSGAFRKSFVGGPPTAPENVWLAPESFACLECLGTAGHEDLPYEMFGLGPNSNDNGYDRPLSEISYESCEPNNYDMLSGSLAPGTTAAASVGGGNLSKFHRSYSMGQGWASLAQHNHPPPHHPQQQHHQQQQMNLQLQQHQAPPVDGQPKVVYRRRNNSTSEGDGSLLICYPSEHLRRLVPQKLLASVSVMQTASGEGTGKDHATGTLGLDQSAGQNGGGNLLLTRPAMAFITQKHELDRLRAAMRRSLRIAACRIYALQALNWLLRSVTQGVCLHDLMWWFVSSLNPTGGH", "sequence_mut": "", "comment": "Loss of binding to Rae1 and unable to rescue synaptic terminal overgrowth in mutants.", "evidence": [ { "database": "UniProtKB", "id": "Q9NB71", "url": "https://www.uniprot.org/uniprotkb/Q9NB71" }, { "database": "PubMed", "id": "21874015", "url": "https://pubmed.ncbi.nlm.nih.gov/21874015" } ], "uniprot_canonical_ac": "Q9NB71-1" }, { "start_pos": 2885, "end_pos": 5233, "sequence_org": "AEVSAPGPNLWMRRASRDTWGWGGMAPPPRINYEPTVKDKMVFKAITFMKPYANYSFEELRYASPVQTRVTELLNAKDMEDGTFSVQWTPSSVGAYCLAVTIDGIPLEEVYRVDVKEGILPPPTQRNSAQRRPQAPSKLRRFQARHSSGLRIRSHPTLQSEQVGVVRVGGVISFIDEIENDDGVWLRLSTESIRQHCTMGWYPTEAWCLQFNQHLARMLLQPVTDKEVNPVRKGVGAEEDVEEQPPVTPSASGEASPEPEPDPSPVLSPAKTKPGRFLSGHQSTNPFLYPAKHADLAEREAQVQEEREKEEEQVDDEDADDREPEQEALPAVELLPAHIGSAIAGVVGGGAIKLQALQKWFKGDAVDGPQPLTPSHSPPLAGVSVRELVRAMGGQDSPRGNGNRSQQEQDPEFSLASMRRPNYSASQTAALLSTPKHTPKRSAVVASETSGLEDELSLLQITTTTTGQGEQQSELQLATTSTASSASKRNPMGPIKRAMPPSFAESIRAVFAALLWHEGVVHDAMACASFLKFHPGLPKEGATVVTRRGESGDPRLQLSREQKAQQRHSVEVANAGNYLNIRPSTLETLTKSGNCSLHNRSKYRKNLLSGGGGAINSGDDTAQKLQALPEMVSVLPPALRCLVYLWEQICSGCVQIVQSNALEQREPRLLSPGSRDLNGDADTEGKEGKNSDQASAGEKDLGRKCKRKKKDDGSWCEICELFLPMPVTYHMRIAHPGCGKSAKGKGYNSVGIFCEGWAGNCGEGGKGASSWFLMCDPCRDRYLASCRSANNINSAARQLESSAAEGNELNLFGVKSTTLIANAEVYTTMRENATFLLELCSSSSSASGAAGSLAATSSSSKRSPQQMSVVAMPVVIEHQLGNSDLKPSTSRCSRMARLSGSKFCPGVGSGAFRKSFVGGPPTAPENVWLAPESFACLECLGTAGHEDLPYEMFGLGPNSNDNGYDRPLSEISYESCEPNNYDMLSGSLAPGTTAAASVGGGNLSKFHRSYSMGQGWASLAQHNHPPPHHPQQQHHQQQQMNLQLQQHQAPPVDGQPKVVYRRRNNSTSEGDGSLLICYPSEHLRRLVPQKLLASVSVMQTASGEGTGKDHATGTLGLDQSAGQNGGGNLLLTRPAMAFITQKHELDRLRAAMRRSLRIAACRIYALQALNWLLRSVTQGVCLHDLMWWFVSSLNPTGGHQPVERGEEASEPALEHPVAYTQISGRFAHLITQSLHVFLQSVADLTLHLPLGSPLQRVAIQCFGIRFRQADHQFLHSSHVFGNISKILSKSDEQNDAMAVSTILKPDCDVEHNQVHSVATGGSSGAGARLLCYTDLAGMFEVTVSSRPAMAESLTDNSTETFWESDEEDRNKCKIIELSLTKLNYACRYLLVHIDNSRDIQNKVLNVVFYAGQSLGDTNIIKSADVDPKACSWISAKICDDSCTHFRLELHGPENTLRVRQIKLLGLPIGGAVGSDDSSDHKHQPHLRLSHASRIQQQICEAETLRVFRLITGQVFGKLISNVSSDLVPPDSAGIGPPSGGAASTSLLADSLDLREHMVGILFSRSKLSHLQKQVIVHIVHAIRKEAQRAKEDWELANLAHVLKQSPQQQTAPALAASASCESTPERSRAPDTYCFEMLSMVLALSGSVVGRSYLSQQHGLLRDLLGLLHTGSDRVQRQVTALLRRILPEITPESFAELLGVQRLPPADYSIAHQSASDFDMSRLGLLDIFLAVIAKSLQLQVKVKTTVASTGPSGSGGVSGSSSGNGGAVLKAGQQEKTPAFVRLWSSLDLSVQQLRSRPPTGEPGTTDPFQFDALPPRKESKRNLNQRWFLNGVISTKQAESIISLIRDLASGKLSEKWSQITKAAIAESVLNLTRLEEIYRSPEHCTKTSTLWLALASLCVLERDHVEKLSSGQWSKLCDTRPLCSNHDDGETAAIIQCETCGSLCGDCDRFLHLNRKTRSHKRTVCKEEEEAIRVELHESCGRTKLFWLLALADSKTLKAMVEFRDGSHTIISGPQEAVGRCRFCGLTGNSGLLEIGNVCADAQCQEYAANSCLKTKPCGHACGGVTGERKCLPCLQHVCHTRENELAEELRDPKLTQDADDMCMICFVEALSCAPSIHLECGHVFHYHCCKAVLEKRWSGPRITFGFSLCPICKADIQHPLLSDILEPINGLKQDVKRKALMRIKYEGVVKDTDSKNVNMTQLAMDRYAYYVCFKCQKAYYGGEARCDAEIGEKFDPEELVCGGCSDVARAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCDTCHDDFQRLTNIPKVKLPQCPAGPKAKQLLGDECPLHVMHPPTGEEFALGCGVCRNAQTF", "sequence_mut": "", "comment": "Loss of binding to Rae1 and unable to rescue synaptic terminal overgrowth in mutants.", "evidence": [ { "database": "UniProtKB", "id": "Q9NB71", "url": "https://www.uniprot.org/uniprotkb/Q9NB71" }, { "database": "PubMed", "id": "21874015", "url": "https://pubmed.ncbi.nlm.nih.gov/21874015" } ], "uniprot_canonical_ac": "Q9NB71-1" }, { "start_pos": 3800, "end_pos": 4039, "sequence_org": "FVGGPPTAPENVWLAPESFACLECLGTAGHEDLPYEMFGLGPNSNDNGYDRPLSEISYESCEPNNYDMLSGSLAPGTTAAASVGGGNLSKFHRSYSMGQGWASLAQHNHPPPHHPQQQHHQQQQMNLQLQQHQAPPVDGQPKVVYRRRNNSTSEGDGSLLICYPSEHLRRLVPQKLLASVSVMQTASGEGTGKDHATGTLGLDQSAGQNGGGNLLLTRPAMAFITQKHELDRLRAAMRRS", "sequence_mut": "", "comment": "Unable to rescue synaptic terminal overgrowth in mutants but has no effect on binding to Rae1.", "evidence": [ { "database": "UniProtKB", "id": "Q9NB71", "url": "https://www.uniprot.org/uniprotkb/Q9NB71" }, { "database": "PubMed", "id": "21874015", "url": "https://pubmed.ncbi.nlm.nih.gov/21874015" } ], "uniprot_canonical_ac": "Q9NB71-1" }, { "start_pos": 5038, "end_pos": 5038, "sequence_org": "C", "sequence_mut": "S", "comment": "Unable to rescue synaptic terminal overgrowth in mutants but has no effect on binding to Rae1; when associated with S-5041.", "evidence": [ { "database": "UniProtKB", "id": "Q9NB71", "url": "https://www.uniprot.org/uniprotkb/Q9NB71" }, { "database": "PubMed", "id": "21874015", "url": "https://pubmed.ncbi.nlm.nih.gov/21874015" } ], "uniprot_canonical_ac": "Q9NB71-1" }, { "start_pos": 5041, "end_pos": 5041, "sequence_org": "C", "sequence_mut": "S", "comment": "Unable to rescue synaptic terminal overgrowth in mutants but has no effect on binding to Rae1; when associated with S-5038.", "evidence": [ { "database": "UniProtKB", "id": "Q9NB71", "url": "https://www.uniprot.org/uniprotkb/Q9NB71" }, { "database": "PubMed", "id": "21874015", "url": "https://pubmed.ncbi.nlm.nih.gov/21874015" } ], "uniprot_canonical_ac": "Q9NB71-1" }, { "start_pos": 671, "end_pos": 1011, "sequence_org": "TVFFAGTARRGEDGDSSKNRRQPKAVKPKKMTKIDGHVVVHAACNNGTSAFVTKTGKLIMYGKDTAHCDAMGFVSELLEQHVTKVALGKAHCVALNAKGQLFSFGLNNKGQCGRIFNKLQPVKDVPPFASSSTAAACFASLLPLDKRLKLDFSTLCDYDDHNLVQGQCRVCVICRECTGYNVSCVSALNVPLDQRLAGSICPCGHGDAGCAKCGLCAACIALQDSDEAKTELKPPPSDVQQRQQRSKTLIMRRKERKGELETGAAGGGAATPTDLDKDPPRVAPLAPQLLQLTSSSPVVQVACGLHHTVVLTLAGEVYTFGSNQYGQLGSGDLQPVSGPVR", "sequence_mut": "", "comment": "Unable to rescue synaptic terminal overgrowth in mutants but has no effect on binding to Rae1; when associated with 1012-E--E-1014.", "evidence": [ { "database": "UniProtKB", "id": "Q9NB71", "url": "https://www.uniprot.org/uniprotkb/Q9NB71" }, { "database": "PubMed", "id": "21874015", "url": "https://pubmed.ncbi.nlm.nih.gov/21874015" } ], "uniprot_canonical_ac": "Q9NB71-1" } ], "record_id": "pubmed.21874015", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]