[ { "title": "Identification of a novel domain in two mammalian inositol-polyphosphate 5-phosphatases that mediates membrane ruffle localization. The inositol 5-phosphatase skip localizes to the endoplasmic reticulum and translocates to membrane ruffles following epidermal growth factor stimulation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Gurung R, Tan A, Ooms LM, McGrath MJ, Huysmans RD, Munday AD, Prescott M, Whisstock JC, Mitchell CA", "reference": { "type": "PubMed", "id": "12536145", "url": "https://pubmed.ncbi.nlm.nih.gov/12536145" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59644-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "Inpp5j", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 349, "end_pos": 349, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on EGF-induced ruffle localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9BT40", "url": "https://www.uniprot.org/uniprotkb/Q9BT40" }, { "database": "PubMed", "id": "12536145", "url": "https://pubmed.ncbi.nlm.nih.gov/12536145" } ], "uniprot_canonical_ac": "Q9BT40-1" }, { "start_pos": 349, "end_pos": 349, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect on EGF-induced ruffle localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9BT40", "url": "https://www.uniprot.org/uniprotkb/Q9BT40" }, { "database": "PubMed", "id": "12536145", "url": "https://pubmed.ncbi.nlm.nih.gov/12536145" } ], "uniprot_canonical_ac": "Q9BT40-1" }, { "start_pos": 361, "end_pos": 361, "sequence_org": "D", "sequence_mut": "A", "comment": "Significant decrease in EGF-induced ruffle localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9BT40", "url": "https://www.uniprot.org/uniprotkb/Q9BT40" }, { "database": "PubMed", "id": "12536145", "url": "https://pubmed.ncbi.nlm.nih.gov/12536145" } ], "uniprot_canonical_ac": "Q9BT40-1" }, { "start_pos": 362, "end_pos": 362, "sequence_org": "W", "sequence_mut": "A", "comment": "Significant decrease in EGF-induced ruffle localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9BT40", "url": "https://www.uniprot.org/uniprotkb/Q9BT40" }, { "database": "PubMed", "id": "12536145", "url": "https://pubmed.ncbi.nlm.nih.gov/12536145" } ], "uniprot_canonical_ac": "Q9BT40-1" }, { "start_pos": 376, "end_pos": 376, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on EGF-induced ruffle localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9BT40", "url": "https://www.uniprot.org/uniprotkb/Q9BT40" }, { "database": "PubMed", "id": "12536145", "url": "https://pubmed.ncbi.nlm.nih.gov/12536145" } ], "uniprot_canonical_ac": "Q9BT40-1" }, { "start_pos": 376, "end_pos": 376, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect on EGF-induced ruffle localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9BT40", "url": "https://www.uniprot.org/uniprotkb/Q9BT40" }, { "database": "PubMed", "id": "12536145", "url": "https://pubmed.ncbi.nlm.nih.gov/12536145" } ], "uniprot_canonical_ac": "Q9BT40-1" } ], "record_id": "pubmed.12536145", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphatidylinositol-5-phosphate activation and conserved substrate specificity of the myotubularin phosphatidylinositol 3-phosphatases.", "journal": "Current biology : CB", "date": "2003", "authors": "Schaletzky J, Dove SK, Short B, Lorenzo O, Clague MJ, Barr FA", "reference": { "type": "PubMed", "id": "12646134", "url": "https://pubmed.ncbi.nlm.nih.gov/12646134" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 114, "end_pos": 114, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduced response to PI5P.", "evidence": [ { "database": "UniProtKB", "id": "Q13496", "url": "https://www.uniprot.org/uniprotkb/Q13496" }, { "database": "PubMed", "id": "12646134", "url": "https://pubmed.ncbi.nlm.nih.gov/12646134" } ], "uniprot_canonical_ac": "Q13496-1" }, { "start_pos": 220, "end_pos": 220, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13496", "url": "https://www.uniprot.org/uniprotkb/Q13496" }, { "database": "PubMed", "id": "12646134", "url": "https://pubmed.ncbi.nlm.nih.gov/12646134" } ], "uniprot_canonical_ac": "Q13496-1" }, { "start_pos": 375, "end_pos": 375, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on subcellular location.", "evidence": [ { "database": "UniProtKB", "id": "Q13496", "url": "https://www.uniprot.org/uniprotkb/Q13496" }, { "database": "PubMed", "id": "11001925", "url": "https://pubmed.ncbi.nlm.nih.gov/11001925" }, { "database": "PubMed", "id": "10900271", "url": "https://pubmed.ncbi.nlm.nih.gov/10900271" }, { "database": "PubMed", "id": "12646134", "url": "https://pubmed.ncbi.nlm.nih.gov/12646134" }, { "database": "PubMed", "id": "21135508", "url": "https://pubmed.ncbi.nlm.nih.gov/21135508" }, { "database": "PubMed", "id": "12118066", "url": "https://pubmed.ncbi.nlm.nih.gov/12118066" } ], "uniprot_canonical_ac": "Q13496-1" }, { "start_pos": 375, "end_pos": 375, "sequence_org": "C", "sequence_mut": "S", "comment": "Lacks activity toward PI3P. Does not affect interaction with DES or MTMR12.", "evidence": [ { "database": "UniProtKB", "id": "Q13496", "url": "https://www.uniprot.org/uniprotkb/Q13496" }, { "database": "PubMed", "id": "11001925", "url": "https://pubmed.ncbi.nlm.nih.gov/11001925" }, { "database": "PubMed", "id": "10900271", "url": "https://pubmed.ncbi.nlm.nih.gov/10900271" }, { "database": "PubMed", "id": "12646134", "url": "https://pubmed.ncbi.nlm.nih.gov/12646134" }, { "database": "PubMed", "id": "23818870", "url": "https://pubmed.ncbi.nlm.nih.gov/23818870" }, { "database": "PubMed", "id": "21135508", "url": "https://pubmed.ncbi.nlm.nih.gov/21135508" }, { "database": "PubMed", "id": "12118066", "url": "https://pubmed.ncbi.nlm.nih.gov/12118066" } ], "uniprot_canonical_ac": "Q13496-1" } ], "record_id": "pubmed.12646134", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Membrane-binding and activation mechanism of PTEN.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Das S, Dixon JE, Cho W", "reference": { "type": "PubMed", "id": "12808147", "url": "https://pubmed.ncbi.nlm.nih.gov/12808147" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12808147", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of myotubularin-related protein 7 and its binding partner, myotubularin-related protein 9.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2003", "authors": "Mochizuki Y, Majerus PW", "reference": { "type": "PubMed", "id": "12890864", "url": "https://pubmed.ncbi.nlm.nih.gov/12890864" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VE11-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "Mtmr6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z2C9-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "Mtmr7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z2D0-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "Mtmr9", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12890864", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 27 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA cloning of human and rat brain myo-inositol monophosphatase. Expression and characterization of the human recombinant enzyme.", "journal": "The Biochemical journal", "date": "1992", "authors": "McAllister G, Whiting P, Hammond EA, Knowles MR, Atack JR, Bailey FJ, Maigetter R, Ragan CI", "reference": { "type": "PubMed", "id": "1377913", "url": "https://pubmed.ncbi.nlm.nih.gov/1377913" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97697-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "Impa1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1377913", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of the protein tyrosine phosphatase PTPL1 with the PtdIns(3,4)P2-binding adaptor protein TAPP1.", "journal": "The Biochemical journal", "date": "2003", "authors": "Kimber WA, Deak M, Prescott AR, Alessi DR", "reference": { "type": "PubMed", "id": "14516276", "url": "https://pubmed.ncbi.nlm.nih.gov/14516276" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ERS5-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "Plekha2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14516276", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rabip4' is an effector of rab5 and rab4 and regulates transport through early endosomes.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Fouraux MA, Deneka M, Ivan V, van der Heijden A, Raymackers J, van Suylekom D, van Venrooij WJ, van der Sluijs P, Pruijn GJ", "reference": { "type": "PubMed", "id": "14617813", "url": "https://pubmed.ncbi.nlm.nih.gov/14617813" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05455-1", "protein_name": "Lupus La protein", "gene_name": "SSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14617813", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Production of phosphatidylinositol 5-phosphate by the phosphoinositide 3-phosphatase myotubularin in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Tronchere H, Laporte J, Pendaries C, Chaussade C, Liaubet L, Pirola L, Mandel JL, Payrastre B", "reference": { "type": "PubMed", "id": "14660569", "url": "https://pubmed.ncbi.nlm.nih.gov/14660569" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14660569", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 60 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Myotubularin regulates the function of the late endosome through the gram domain-phosphatidylinositol 3,5-bisphosphate interaction.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Tsujita K, Itoh T, Ijuin T, Yamamoto A, Shisheva A, Laporte J, Takenawa T", "reference": { "type": "PubMed", "id": "14722070", "url": "https://pubmed.ncbi.nlm.nih.gov/14722070" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14722070", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human 1-D-myo-inositol-3-phosphate synthase is functional in yeast.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Ju S, Shaltiel G, Shamir A, Agam G, Greenberg ML", "reference": { "type": "PubMed", "id": "15024000", "url": "https://pubmed.ncbi.nlm.nih.gov/15024000" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15024000", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "InsP3-mediated intracellular calcium signalling is altered by expression of synaptojanin-1.", "journal": "The Biochemical journal", "date": "2004", "authors": "Johenning FW, Wenk MR, Uhlen P, Degray B, Lee E, De Camilli P, Ehrlich BE", "reference": { "type": "PubMed", "id": "15080793", "url": "https://pubmed.ncbi.nlm.nih.gov/15080793" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15080793", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FAPPs control Golgi-to-cell-surface membrane traffic by binding to ARF and PtdIns(4)P.", "journal": "Nature cell biology", "date": "2004", "authors": "Godi A, Di Campli A, Konstantakopoulos A, Di Tullio G, Alessi DR, Kular GS, Daniele T, Marra P, Lucocq JM, De Matteis MA", "reference": { "type": "PubMed", "id": "15107860", "url": "https://pubmed.ncbi.nlm.nih.gov/15107860" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0FGR8-1", "protein_name": "Extended synaptotagmin-2", "gene_name": "ESYT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0FGR9-1", "protein_name": "Extended synaptotagmin-3", "gene_name": "ESYT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSJ8-1", "protein_name": "Extended synaptotagmin-1", "gene_name": "ESYT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13286-1", "protein_name": "Battenin", "gene_name": "CLN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TA50-1", "protein_name": "Ceramide-1-phosphate transfer protein", "gene_name": "CPTP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZD2-1", "protein_name": "Glycolipid transfer protein", "gene_name": "GLTP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15107860", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 59 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, expression, purification, and characterization of the human Class Ia phosphoinositide 3-kinase isoforms.", "journal": "Protein expression and purification", "date": "2004", "authors": "Meier TI, Cook JA, Thomas JE, Radding JA, Horn C, Lingaraj T, Smith MC", "reference": { "type": "PubMed", "id": "15135396", "url": "https://pubmed.ncbi.nlm.nih.gov/15135396" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15135396", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation and cellular roles of phosphoinositide 5-kinases.", "journal": "European journal of pharmacology", "date": "2004", "authors": "Oude Weernink PA, Schmidt M, Jakobs KH", "reference": { "type": "PubMed", "id": "15464023", "url": "https://pubmed.ncbi.nlm.nih.gov/15464023" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15464023", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Type II phosphoinositide 5-phosphatases have unique sensitivities towards fatty acid composition and head group phosphorylation.", "journal": "FEBS letters", "date": "2004", "authors": "Schmid AC, Wise HM, Mitchell CA, Nussbaum R, Woscholski R", "reference": { "type": "PubMed", "id": "15474001", "url": "https://pubmed.ncbi.nlm.nih.gov/15474001" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51178-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1", "gene_name": "PLCD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23677-1", "protein_name": "Inositol-trisphosphate 3-kinase A", "gene_name": "ITPKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00722-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2", "gene_name": "PLCB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRC7-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4", "gene_name": "PLCD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YW0-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1", "gene_name": "PLCZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P212-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1", "gene_name": "PLCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ66-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1", "gene_name": "PLCB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75038-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2", "gene_name": "PLCH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KWH8-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1", "gene_name": "PLCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27987-1", "protein_name": "Inositol-trisphosphate 3-kinase B", "gene_name": "ITPKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15147-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4", "gene_name": "PLCB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3E9-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3", "gene_name": "PLCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01970-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3", "gene_name": "PLCB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BZ4-1", "protein_name": "5'-3' exonuclease PLD4", "gene_name": "PLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DU7-1", "protein_name": "Inositol-trisphosphate 3-kinase C", "gene_name": "ITPKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13572-1", "protein_name": "Inositol-tetrakisphosphate 1-kinase", "gene_name": "ITPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15474001", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning, expression, and characterization of myo-inositol oxygenase from mouse, rat, and human kidney.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Arner RJ, Prabhu KS, Reddy CC", "reference": { "type": "PubMed", "id": "15504367", "url": "https://pubmed.ncbi.nlm.nih.gov/15504367" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QXN4-1", "protein_name": "Inositol oxygenase", "gene_name": "Miox", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QXN5-1", "protein_name": "Inositol oxygenase", "gene_name": "Miox", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15504367", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The type Ialpha inositol polyphosphate 4-phosphatase generates and terminates phosphoinositide 3-kinase signals on endosomes and the plasma membrane.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Ivetac I, Munday AD, Kisseleva MV, Zhang XM, Luff S, Tiganis T, Whisstock JC, Rowe T, Majerus PW, Mitchell CA", "reference": { "type": "PubMed", "id": "15716355", "url": "https://pubmed.ncbi.nlm.nih.gov/15716355" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0I1-1", "protein_name": "Myotubularin-related protein 12", "gene_name": "MTMR12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXD2-1", "protein_name": "Myotubularin-related protein 10", "gene_name": "MTMR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 731, "end_pos": 731, "sequence_org": "D", "sequence_mut": "N", "comment": "Complete loss of lipid phosphatase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96PE3", "url": "https://www.uniprot.org/uniprotkb/Q96PE3" }, { "database": "PubMed", "id": "15716355", "url": "https://pubmed.ncbi.nlm.nih.gov/15716355" } ], "uniprot_canonical_ac": "Q96PE3-1" }, { "start_pos": 895, "end_pos": 895, "sequence_org": "C", "sequence_mut": "S", "comment": "Does not rescue the wortmannin-induced dilation of endosomes due to accumulation of (PtdIns(3,4)P2).", "evidence": [ { "database": "UniProtKB", "id": "Q96PE3", "url": "https://www.uniprot.org/uniprotkb/Q96PE3" }, { "database": "PubMed", "id": "15716355", "url": "https://pubmed.ncbi.nlm.nih.gov/15716355" } ], "uniprot_canonical_ac": "Q96PE3-1" } ], "record_id": "pubmed.15716355", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 62 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "p84, a new Gbetagamma-activated regulatory subunit of the type IB phosphoinositide 3-kinase p110gamma.", "journal": "Current biology : CB", "date": "2005", "authors": "Suire S, Coadwell J, Ferguson GJ, Davidson K, Hawkins P, Stephens L", "reference": { "type": "PubMed", "id": "15797027", "url": "https://pubmed.ncbi.nlm.nih.gov/15797027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3U6Q4-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "Pik3r6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15797027", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of phosphoinositide binding domain properties within the myotubularin-related protein MTMR3.", "journal": "Journal of cell science", "date": "2005", "authors": "Lorenzo O, Urbe S, Clague MJ", "reference": { "type": "PubMed", "id": "15840652", "url": "https://pubmed.ncbi.nlm.nih.gov/15840652" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15840652", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the role of the Rab GTPase-activating protein AS160 in insulin-regulated GLUT4 trafficking.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Larance M, Ramm G, Stockli J, van Dam EM, Winata S, Wasinger V, Simpson F, Graham M, Junutula JR, Guilhaus M, James DE", "reference": { "type": "PubMed", "id": "16154996", "url": "https://pubmed.ncbi.nlm.nih.gov/16154996" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16154996", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multi-level regulation of myotubularin-related protein-2 phosphatase activity by myotubularin-related protein-13/set-binding factor-2.", "journal": "Human molecular genetics", "date": "2006", "authors": "Berger P, Berger I, Schaffitzel C, Tersar K, Volkmer B, Suter U", "reference": { "type": "PubMed", "id": "16399794", "url": "https://pubmed.ncbi.nlm.nih.gov/16399794" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "E9PXF8-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "Sbf2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Z2D1-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "Mtmr2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 417, "end_pos": 417, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of activity. Does not affect the interaction with SBF2/MTMR13.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2D1", "url": "https://www.uniprot.org/uniprotkb/Q9Z2D1" }, { "database": "PubMed", "id": "16399794", "url": "https://pubmed.ncbi.nlm.nih.gov/16399794" }, { "database": "PubMed", "id": "14530412", "url": "https://pubmed.ncbi.nlm.nih.gov/14530412" } ], "uniprot_canonical_ac": "Q9Z2D1-1" }, { "start_pos": 589, "end_pos": 643, "sequence_org": "PQEPIHSRYKELLAKRAELQRKVEELQREISNRSTSSSERASSPAQCVTPVQTVV", "sequence_mut": "", "comment": "Loss of interaction with SBF2/MTMR13 which results in a decrease in SBF2/MTMR13 localization to membranes.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2D1", "url": "https://www.uniprot.org/uniprotkb/Q9Z2D1" }, { "database": "PubMed", "id": "23297362", "url": "https://pubmed.ncbi.nlm.nih.gov/23297362" }, { "database": "PubMed", "id": "16399794", "url": "https://pubmed.ncbi.nlm.nih.gov/16399794" } ], "uniprot_canonical_ac": "Q9Z2D1-1" } ], "record_id": "pubmed.16399794", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 55 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of p87PIKAP, a novel regulatory subunit of phosphoinositide 3-kinase gamma that is highly expressed in heart and interacts with PDE3B.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Voigt P, Dorner MB, Schaefer M", "reference": { "type": "PubMed", "id": "16476736", "url": "https://pubmed.ncbi.nlm.nih.gov/16476736" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3U6Q4-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "Pik3r6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16476736", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Rab4 effector Rabip4 plays a role in the endocytotic trafficking of Glut 4 in 3T3-L1 adipocytes.", "journal": "Journal of cell science", "date": "2006", "authors": "Mari M, Monzo P, Kaddai V, Keslair F, Gonzalez T, Le Marchand-Brustel Y, Cormont M", "reference": { "type": "PubMed", "id": "16522682", "url": "https://pubmed.ncbi.nlm.nih.gov/16522682" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BIJ7-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "Rufy1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16522682", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Systematic analysis of myotubularins: heteromeric interactions, subcellular localisation and endosome related functions.", "journal": "J. Cell Sci.", "date": "2006", "authors": "Lorenzo O, Urbe S, Clague MJ", "reference": { "type": "PubMed", "id": "16787938", "url": "https://pubmed.ncbi.nlm.nih.gov/16787938" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0I1-1", "protein_name": "Myotubularin-related protein 12", "gene_name": "MTMR12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXD2-1", "protein_name": "Myotubularin-related protein 10", "gene_name": "MTMR10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1169, "end_pos": 1169, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of localization to early endosome membranes. No effect on function in mitotic abscission.", "evidence": [ { "database": "UniProtKB", "id": "Q9NYA4", "url": "https://www.uniprot.org/uniprotkb/Q9NYA4" }, { "database": "PubMed", "id": "25659891", "url": "https://pubmed.ncbi.nlm.nih.gov/25659891" }, { "database": "PubMed", "id": "16787938", "url": "https://pubmed.ncbi.nlm.nih.gov/16787938" } ], "uniprot_canonical_ac": "Q9NYA4-1" } ], "record_id": "pubmed.16787938", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Specificity of the myotubularin family of phosphatidylinositol-3-phosphatase is determined by the PH/GRAM domain.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Choudhury P, Srivastava S, Li Z, Ko K, Albaqumi M, Narayan K, Coetzee WA, Lemmon MA, Skolnik EY", "reference": { "type": "PubMed", "id": "16914545", "url": "https://pubmed.ncbi.nlm.nih.gov/16914545" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16914545", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A role for PtdIns(4,5)P2 and PIP5Kalpha in regulating stress-induced apoptosis.", "journal": "Current biology : CB", "date": "2006", "authors": "Halstead JR, van Rheenen J, Snel MH, Meeuws S, Mohammed S, D'Santos CS, Heck AJ, Jalink K, Divecha N", "reference": { "type": "PubMed", "id": "16979564", "url": "https://pubmed.ncbi.nlm.nih.gov/16979564" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16979564", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel PtdIns3P and PtdIns(3,5)P2 phosphatase with an inactivating variant in centronuclear myopathy.", "journal": "Human molecular genetics", "date": "2006", "authors": "Tosch V, Rohde HM, Tronchere H, Zanoteli E, Monroy N, Kretz C, Dondaine N, Payrastre B, Mandel JL, Laporte J", "reference": { "type": "PubMed", "id": "17008356", "url": "https://pubmed.ncbi.nlm.nih.gov/17008356" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VEL2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "Mtmr14", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 330, "end_pos": 330, "sequence_org": "C", "sequence_mut": "S", "comment": "Decreased phosphatidylinositol-3-phosphate phosphatase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8NCE2", "url": "https://www.uniprot.org/uniprotkb/Q8NCE2" }, { "database": "PubMed", "id": "17008356", "url": "https://pubmed.ncbi.nlm.nih.gov/17008356" } ], "uniprot_canonical_ac": "Q8NCE2-1" } ], "record_id": "pubmed.17008356", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spatial expression patterns and biochemical properties distinguish a second myo-inositol monophosphatase IMPA2 from IMPA1.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Ohnishi T, Ohba H, Seo KC, Im J, Sato Y, Iwayama Y, Furuichi T, Chung SK, Yoshikawa T", "reference": { "type": "PubMed", "id": "17068342", "url": "https://pubmed.ncbi.nlm.nih.gov/17068342" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O55023-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "Impa1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q91UZ5-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "Impa2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 104, "end_pos": 104, "sequence_org": "D", "sequence_mut": "N", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "O14732", "url": "https://www.uniprot.org/uniprotkb/O14732" }, { "database": "PubMed", "id": "17068342", "url": "https://pubmed.ncbi.nlm.nih.gov/17068342" } ], "uniprot_canonical_ac": "O14732-1" }, { "start_pos": 93, "end_pos": 93, "sequence_org": "D", "sequence_mut": "N", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P29218", "url": "https://www.uniprot.org/uniprotkb/P29218" }, { "database": "PubMed", "id": "17068342", "url": "https://pubmed.ncbi.nlm.nih.gov/17068342" } ], "uniprot_canonical_ac": "P29218-1" } ], "record_id": "pubmed.17068342", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and expression of human 75-kDa inositol polyphosphate-5-phosphatase.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Ross TS, Jefferson AB, Mitchell CA, Majerus PW", "reference": { "type": "PubMed", "id": "1718960", "url": "https://pubmed.ncbi.nlm.nih.gov/1718960" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51178-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1", "gene_name": "PLCD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23677-1", "protein_name": "Inositol-trisphosphate 3-kinase A", "gene_name": "ITPKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00722-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2", "gene_name": "PLCB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRC7-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4", "gene_name": "PLCD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YW0-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1", "gene_name": "PLCZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P212-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1", "gene_name": "PLCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ66-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1", "gene_name": "PLCB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75038-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2", "gene_name": "PLCH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KWH8-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1", "gene_name": "PLCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27987-1", "protein_name": "Inositol-trisphosphate 3-kinase B", "gene_name": "ITPKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15147-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4", "gene_name": "PLCB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3E9-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3", "gene_name": "PLCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01970-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3", "gene_name": "PLCB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BZ4-1", "protein_name": "5'-3' exonuclease PLD4", "gene_name": "PLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DU7-1", "protein_name": "Inositol-trisphosphate 3-kinase C", "gene_name": "ITPKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13572-1", "protein_name": "Inositol-tetrakisphosphate 1-kinase", "gene_name": "ITPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1718960", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phospholipase D signaling: orchestration by PIP2 and small GTPases.", "journal": "Naunyn-Schmiedeberg's archives of pharmacology", "date": "2007", "authors": "Oude Weernink PA, Lopez de Jesus M, Schmidt M", "reference": { "type": "PubMed", "id": "17245604", "url": "https://pubmed.ncbi.nlm.nih.gov/17245604" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61586-1", "protein_name": "Transforming protein RhoA", "gene_name": "RHOA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01138-1", "protein_name": "Beta-nerve growth factor", "gene_name": "NGF", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4H2-1", "protein_name": "Insulin receptor substrate 2", "gene_name": "IRS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35568-1", "protein_name": "Insulin receptor substrate 1", "gene_name": "IRS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04629-1", "protein_name": "High affinity nerve growth factor receptor", "gene_name": "NTRK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17245604", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 58 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Core protein machinery for mammalian phosphatidylinositol 3,5-bisphosphate synthesis and turnover that regulates the progression of endosomal transport. Novel Sac phosphatase joins the ArPIKfyve-PIKfyve complex.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sbrissa D, Ikonomov OC, Fu Z, Ijuin T, Gruenberg J, Takenawa T, Shisheva A", "reference": { "type": "PubMed", "id": "17556371", "url": "https://pubmed.ncbi.nlm.nih.gov/17556371" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0I1-1", "protein_name": "Myotubularin-related protein 12", "gene_name": "MTMR12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42356-1", "protein_name": "Phosphatidylinositol 4-kinase alpha", "gene_name": "PI4KA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTJ5-1", "protein_name": "Phosphatidylinositol-3-phosphatase SAC1", "gene_name": "SACM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF8-1", "protein_name": "Phosphatidylinositol 4-kinase beta", "gene_name": "PI4KB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56180-1", "protein_name": "Putative tyrosine-protein phosphatase TPTE", "gene_name": "TPTE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRR6-1", "protein_name": "Phosphatidylinositol polyphosphate 5-phosphatase type IV", "gene_name": "INPP5E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXD2-1", "protein_name": "Myotubularin-related protein 10", "gene_name": "MTMR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6XPS3-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2", "gene_name": "TPTE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 488, "end_pos": 488, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q92562", "url": "https://www.uniprot.org/uniprotkb/Q92562" }, { "database": "PubMed", "id": "17556371", "url": "https://pubmed.ncbi.nlm.nih.gov/17556371" } ], "uniprot_canonical_ac": "Q92562-1" } ], "record_id": "pubmed.17556371", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Myotubularin lipid phosphatase binds the hVPS15/hVPS34 lipid kinase complex on endosomes.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Cao C, Laporte J, Backer JM, Wandinger-Ness A, Stein MP", "reference": { "type": "PubMed", "id": "17651088", "url": "https://pubmed.ncbi.nlm.nih.gov/17651088" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0I1-1", "protein_name": "Myotubularin-related protein 12", "gene_name": "MTMR12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXD2-1", "protein_name": "Myotubularin-related protein 10", "gene_name": "MTMR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17651088", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 63 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and biophysical characterization of human myo-inositol oxygenase.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Thorsell AG, Persson C, Voevodskaya N, Busam RD, Hammarstrom M, Graslund S, Graslund A, Hallberg BM", "reference": { "type": "PubMed", "id": "18364358", "url": "https://pubmed.ncbi.nlm.nih.gov/18364358" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QXN5-1", "protein_name": "Inositol oxygenase", "gene_name": "Miox", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 127, "end_pos": 127, "sequence_org": "K", "sequence_mut": "S", "comment": "Strongly reduced enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9UGB7", "url": "https://www.uniprot.org/uniprotkb/Q9UGB7" }, { "database": "PubMed", "id": "18364358", "url": "https://pubmed.ncbi.nlm.nih.gov/18364358" } ], "uniprot_canonical_ac": "Q9UGB7-1" } ], "record_id": "pubmed.18364358", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequential actions of myotubularin lipid phosphatases regulate endosomal PI(3)P and growth factor receptor trafficking.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Cao C, Backer JM, Laporte J, Bedrick EJ, Wandinger-Ness A", "reference": { "type": "PubMed", "id": "18524850", "url": "https://pubmed.ncbi.nlm.nih.gov/18524850" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0I1-1", "protein_name": "Myotubularin-related protein 12", "gene_name": "MTMR12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXD2-1", "protein_name": "Myotubularin-related protein 10", "gene_name": "MTMR10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18524850", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Localization of phosphatidylinositol phosphate kinase IIgamma in kidney to a membrane trafficking compartment within specialized cells of the nephron.", "journal": "American journal of physiology. Renal physiology", "date": "2008", "authors": "Clarke JH, Emson PC, Irvine RF", "reference": { "type": "PubMed", "id": "18753295", "url": "https://pubmed.ncbi.nlm.nih.gov/18753295" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q91XU3-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "Pip4k2c", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18753295", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ArPIKfyve homomeric and heteromeric interactions scaffold PIKfyve and Sac3 in a complex to promote PIKfyve activity and functionality.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Sbrissa D, Ikonomov OC, Fenner H, Shisheva A", "reference": { "type": "PubMed", "id": "18950639", "url": "https://pubmed.ncbi.nlm.nih.gov/18950639" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0I1-1", "protein_name": "Myotubularin-related protein 12", "gene_name": "MTMR12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42356-1", "protein_name": "Phosphatidylinositol 4-kinase alpha", "gene_name": "PI4KA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTJ5-1", "protein_name": "Phosphatidylinositol-3-phosphatase SAC1", "gene_name": "SACM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF8-1", "protein_name": "Phosphatidylinositol 4-kinase beta", "gene_name": "PI4KB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56180-1", "protein_name": "Putative tyrosine-protein phosphatase TPTE", "gene_name": "TPTE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRR6-1", "protein_name": "Phosphatidylinositol polyphosphate 5-phosphatase type IV", "gene_name": "INPP5E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXD2-1", "protein_name": "Myotubularin-related protein 10", "gene_name": "MTMR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6XPS3-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2", "gene_name": "TPTE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18950639", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MTMR9 increases MTMR6 enzyme activity, stability, and role in apoptosis.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Zou J, Chang SC, Marjanovic J, Majerus PW", "reference": { "type": "PubMed", "id": "19038970", "url": "https://pubmed.ncbi.nlm.nih.gov/19038970" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19038970", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Localization, regulation and function of type II phosphatidylinositol 5-phosphate 4-kinases.", "journal": "Advances in enzyme regulation", "date": "2010", "authors": "Clarke JH, Wang M, Irvine RF", "reference": { "type": "PubMed", "id": "19896968", "url": "https://pubmed.ncbi.nlm.nih.gov/19896968" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19896968", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional cross-talk between Rab14 and Rab4 through a dual effector, RUFY1/Rabip4.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Yamamoto H, Koga H, Katoh Y, Takahashi S, Nakayama K, Shin HW", "reference": { "type": "PubMed", "id": "20534812", "url": "https://pubmed.ncbi.nlm.nih.gov/20534812" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61018-1", "protein_name": "Ras-related protein Rab-4B", "gene_name": "RAB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 25, "end_pos": 25, "sequence_org": "S", "sequence_mut": "N", "comment": "Dominant-negative mutant (GDP-bound form). Loss of interaction with RUFY1.", "evidence": [ { "database": "UniProtKB", "id": "P61106", "url": "https://www.uniprot.org/uniprotkb/P61106" }, { "database": "PubMed", "id": "20534812", "url": "https://pubmed.ncbi.nlm.nih.gov/20534812" } ], "uniprot_canonical_ac": "P61106-1" }, { "start_pos": 70, "end_pos": 70, "sequence_org": "Q", "sequence_mut": "L", "comment": "Constitutively active mutant (GTP-bound form). Interacts with RUFY1.", "evidence": [ { "database": "UniProtKB", "id": "P61106", "url": "https://www.uniprot.org/uniprotkb/P61106" }, { "database": "PubMed", "id": "20534812", "url": "https://pubmed.ncbi.nlm.nih.gov/20534812" } ], "uniprot_canonical_ac": "P61106-1" }, { "start_pos": 67, "end_pos": 67, "sequence_org": "Q", "sequence_mut": "L", "comment": "GTP-locked. Interacts with RUFY1.", "evidence": [ { "database": "UniProtKB", "id": "P61018", "url": "https://www.uniprot.org/uniprotkb/P61018" }, { "database": "PubMed", "id": "20534812", "url": "https://pubmed.ncbi.nlm.nih.gov/20534812" } ], "uniprot_canonical_ac": "P61018-1" } ], "record_id": "pubmed.20534812", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of TAPP1 and TAPP2 adaptor binding to PtdIns(3,4)P2 in regulating insulin sensitivity defined by knock-in analysis.", "journal": "The Biochemical journal", "date": "2011", "authors": "Wullschleger S, Wasserman DH, Gray A, Sakamoto K, Alessi DR", "reference": { "type": "PubMed", "id": "21204784", "url": "https://pubmed.ncbi.nlm.nih.gov/21204784" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21204784", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of splicing variants of PLEKHA5 (Plekha5) during brain development.", "journal": "Gene", "date": "2012", "authors": "Yamada K, Nomura N, Yamano A, Yamada Y, Wakamatsu N", "reference": { "type": "PubMed", "id": "22037487", "url": "https://pubmed.ncbi.nlm.nih.gov/22037487" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22037487", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Myotubularin-related protein (MTMR) 9 determines the enzymatic activity, substrate specificity, and role in autophagy of MTMR8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Zou J, Zhang C, Marjanovic J, Kisseleva MV, Majerus PW, Wilson MP", "reference": { "type": "PubMed", "id": "22647598", "url": "https://pubmed.ncbi.nlm.nih.gov/22647598" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22647598", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphatidylinositol 3-phosphatase myotubularin-related protein 6 (MTMR6) is regulated by small GTPase Rab1B in the early secretory and autophagic pathways.", "journal": "J. Biol. Chem.", "date": "2013", "authors": "Mochizuki Y, Ohashi R, Kawamura T, Iwanari H, Kodama T, Naito M, Hamakubo T", "reference": { "type": "PubMed", "id": "23188820", "url": "https://pubmed.ncbi.nlm.nih.gov/23188820" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VE11-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "Mtmr6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9D1G1-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "Rab1b", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Z2C9-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "Mtmr7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10536-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "Rab1b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0G2JXT6-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "Mtmr6", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 22, "end_pos": 22, "sequence_org": "S", "sequence_mut": "N", "comment": "Increases the interaction with MTMR6.", "evidence": [ { "database": "UniProtKB", "id": "Q9D1G1", "url": "https://www.uniprot.org/uniprotkb/Q9D1G1" }, { "database": "PubMed", "id": "23188820", "url": "https://pubmed.ncbi.nlm.nih.gov/23188820" } ], "uniprot_canonical_ac": "Q9D1G1-1" }, { "start_pos": 67, "end_pos": 67, "sequence_org": "Q", "sequence_mut": "L", "comment": "No effect on the interaction with MTMR6.", "evidence": [ { "database": "UniProtKB", "id": "Q9D1G1", "url": "https://www.uniprot.org/uniprotkb/Q9D1G1" }, { "database": "PubMed", "id": "23188820", "url": "https://pubmed.ncbi.nlm.nih.gov/23188820" } ], "uniprot_canonical_ac": "Q9D1G1-1" } ], "record_id": "pubmed.23188820", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RUFY, Rab and Rap Family Proteins Involved in a Regulation of Cell Polarity and Membrane Trafficking.", "journal": "International journal of molecular sciences", "date": "2013", "authors": "Kitagishi Y, Matsuda S", "reference": { "type": "PubMed", "id": "23519112", "url": "https://pubmed.ncbi.nlm.nih.gov/23519112" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23519112", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evolutionarily conserved structural changes in phosphatidylinositol 5-phosphate 4-kinase (PI5P4K) isoforms are responsible for differences in enzyme activity and localization.", "journal": "The Biochemical journal", "date": "2013", "authors": "Clarke JH, Irvine RF", "reference": { "type": "PubMed", "id": "23758345", "url": "https://pubmed.ncbi.nlm.nih.gov/23758345" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23758345", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequential breakdown of 3-phosphorylated phosphoinositides is essential for the completion of macropinocytosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Maekawa M, Terasaka S, Mochizuki Y, Kawai K, Ikeda Y, Araki N, Skolnik EY, Taguchi T, Arai H", "reference": { "type": "PubMed", "id": "24591580", "url": "https://pubmed.ncbi.nlm.nih.gov/24591580" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VE11-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "Mtmr6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z2D0-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "Mtmr9", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O15554-1", "protein_name": "Intermediate conductance calcium-activated potassium channel protein 4", "gene_name": "KCNN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 336, "end_pos": 342, "sequence_org": "CSDGWDR", "sequence_mut": "ASDGWDA", "comment": "Probable loss of catalytic activity. Loss of macropinocytosis.", "evidence": [ { "database": "UniProtKB", "id": "Q8VE11", "url": "https://www.uniprot.org/uniprotkb/Q8VE11" }, { "database": "PubMed", "id": "24591580", "url": "https://pubmed.ncbi.nlm.nih.gov/24591580" } ], "uniprot_canonical_ac": "Q8VE11-1" }, { "start_pos": 2, "end_pos": 108, "sequence_org": "EFAELIKTPRVDNVVLHRPFYTAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDKRFVGSLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSVTLM", "sequence_mut": "", "comment": "Loss of cell membrane recruitment following EGF stimulation.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z2D0", "url": "https://www.uniprot.org/uniprotkb/Q9Z2D0" }, { "database": "PubMed", "id": "24591580", "url": "https://pubmed.ncbi.nlm.nih.gov/24591580" } ], "uniprot_canonical_ac": "Q9Z2D0-1" } ], "record_id": "pubmed.24591580", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The function of phosphatidylinositol 5-phosphate 4-kinase gamma (PI5P4Kgamma) explored using a specific inhibitor that targets the PI5P-binding site.", "journal": "The Biochemical journal", "date": "2015", "authors": "Clarke JH, Giudici ML, Burke JE, Williams RL, Maloney DJ, Marugan J, Irvine RF", "reference": { "type": "PubMed", "id": "25495341", "url": "https://pubmed.ncbi.nlm.nih.gov/25495341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25495341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human myotubularin-related protein 9 regulates ER-to-Golgi trafficking and modulates WNT3A secretion.", "journal": "Experimental cell research", "date": "2020", "authors": "Doubravska L, Dostal V, Knop F, Libusova L, Macurkova M", "reference": { "type": "PubMed", "id": "31704058", "url": "https://pubmed.ncbi.nlm.nih.gov/31704058" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31704058", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic Variants of the MTMR9 Gene Are Associated with Nonspecific Intellectual Disability: A Family-Based Association Study.", "journal": "Genetic testing and molecular biomarkers", "date": "2020", "authors": "Shi Z, Jia X, Tian Y, Liu X, Bai J, Liu Y, Zhang F, Li J, Gao X, Zhang K", "reference": { "type": "PubMed", "id": "32991201", "url": "https://pubmed.ncbi.nlm.nih.gov/32991201" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32991201", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The isolation and characterization of cDNA encoding human and rat brain inositol polyphosphate 4-phosphatase.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Norris FA, Auethavekiat V, Majerus PW", "reference": { "type": "PubMed", "id": "7608176", "url": "https://pubmed.ncbi.nlm.nih.gov/7608176" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0I1-1", "protein_name": "Myotubularin-related protein 12", "gene_name": "MTMR12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXD2-1", "protein_name": "Myotubularin-related protein 10", "gene_name": "MTMR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62784-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "Inpp4a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7608176", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 71 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of a G protein-activated human phosphoinositide-3 kinase.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Stoyanov B, Volinia S, Hanck T, Rubio I, Loubtchenkov M, Malek D, Stoyanova S, Vanhaesebroeck B, Dhand R, Nurnberg B, et al.", "reference": { "type": "PubMed", "id": "7624799", "url": "https://pubmed.ncbi.nlm.nih.gov/7624799" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02452-1", "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y243-1", "protein_name": "RAC-gamma serine/threonine-protein kinase", "gene_name": "AKT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05513-1", "protein_name": "Protein kinase C zeta type", "gene_name": "PRKCZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61586-1", "protein_name": "Transforming protein RhoA", "gene_name": "RHOA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YL7-1", "protein_name": "Podoplanin", "gene_name": "PDPN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P126-1", "protein_name": "C-type lectin domain family 1 member B", "gene_name": "CLEC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43561-1", "protein_name": "Linker for activation of T-cells family member 1", "gene_name": "LAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84095-1", "protein_name": "Rho-related GTP-binding protein RhoG", "gene_name": "RHOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95866-1", "protein_name": "Megakaryocyte and platelet inhibitory receptor G6b", "gene_name": "MPIG6B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31751-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "AKT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06239-1", "protein_name": "Tyrosine-protein kinase Lck", "gene_name": "LCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08123-1", "protein_name": "Collagen alpha-2(I) chain", "gene_name": "COL1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKW4-1", "protein_name": "Guanine nucleotide exchange factor VAV3", "gene_name": "VAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN6-1", "protein_name": "Platelet glycoprotein VI", "gene_name": "GP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62745-1", "protein_name": "Rho-related GTP-binding protein RhoB", "gene_name": "RHOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15153-1", "protein_name": "Ras-related C3 botulinum toxin substrate 2", "gene_name": "RAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13094-1", "protein_name": "Lymphocyte cytosolic protein 2", "gene_name": "LCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15530-1", "protein_name": "3-phosphoinositide-dependent protein kinase 1", "gene_name": "PDPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7624799", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 100 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A human phosphatidylinositol 3-kinase complex related to the yeast Vps34p-Vps15p protein sorting system.", "journal": "The EMBO journal", "date": "1995", "authors": "Volinia S, Dhand R, Vanhaesebroeck B, MacDougall LK, Stein R, Zvelebil MJ, Domin J, Panaretou C, Waterfield MD", "reference": { "type": "PubMed", "id": "7628435", "url": "https://pubmed.ncbi.nlm.nih.gov/7628435" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NBW4-1", "protein_name": "Neutral amino acid transporter 9", "gene_name": "SLC38A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHA4-1", "protein_name": "Ragulator complex protein LAMTOR3", "gene_name": "LAMTOR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0R8-1", "protein_name": "Gamma-aminobutyric acid receptor-associated protein-like 1", "gene_name": "GABARAPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4P8-1", "protein_name": "WD repeat domain phosphoinositide-interacting protein 2", "gene_name": "WIPI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14457-1", "protein_name": "Beclin-1", "gene_name": "BECN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95166-1", "protein_name": "Gamma-aminobutyric acid receptor-associated protein", "gene_name": "GABARAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4P1-1", "protein_name": "Cysteine protease ATG4B", "gene_name": "ATG4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H492-1", "protein_name": "Microtubule-associated protein 1 light chain 3 alpha", "gene_name": "MAP1LC3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q674R7-1", "protein_name": "Autophagy-related protein 9B", "gene_name": "ATG9B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94817-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "ATG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75143-1", "protein_name": "Autophagy-related protein 13", "gene_name": "ATG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0I1-1", "protein_name": "Myotubularin-related protein 12", "gene_name": "MTMR12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQL2-1", "protein_name": "Ras-related GTP-binding protein D", "gene_name": "RRAGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB90-1", "protein_name": "Ras-related GTP-binding protein C", "gene_name": "RRAGC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FZ7-1", "protein_name": "Charged multivesicular body protein 6", "gene_name": "CHMP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUX9-1", "protein_name": "Charged multivesicular body protein 7", "gene_name": "CHMP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY43-1", "protein_name": "Charged multivesicular body protein 4a", "gene_name": "CHMP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3E7-1", "protein_name": "Charged multivesicular body protein 3", "gene_name": "CHMP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43633-1", "protein_name": "Charged multivesicular body protein 2a", "gene_name": "CHMP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQN3-1", "protein_name": "Charged multivesicular body protein 2b", "gene_name": "CHMP2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86TL0-1", "protein_name": "Cysteine protease ATG4D", "gene_name": "ATG4D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92574-1", "protein_name": "Hamartin", "gene_name": "TSC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2Y5-1", "protein_name": "UV radiation resistance-associated gene protein", "gene_name": "UVRAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95352-1", "protein_name": "Ubiquitin-like modifier-activating enzyme ATG7", "gene_name": "ATG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSB4-1", "protein_name": "Autophagy-related protein 101", "gene_name": "ATG101", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYN0-1", "protein_name": "Cysteine protease ATG4A", "gene_name": "ATG4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0Y0-1", "protein_name": "Ubiquitin-like-conjugating enzyme ATG10", "gene_name": "ATG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NT62-1", "protein_name": "Ubiquitin-like-conjugating enzyme ATG3", "gene_name": "ATG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3C6-1", "protein_name": "Autophagy-related protein 9A", "gene_name": "ATG9A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CF2-1", "protein_name": "Charged multivesicular body protein 4c", "gene_name": "CHMP4C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VZM2-1", "protein_name": "Ras-related GTP-binding protein B", "gene_name": "RRAGB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42356-1", "protein_name": "Phosphatidylinositol 4-kinase alpha", "gene_name": "PI4KA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY60-1", "protein_name": "Gamma-aminobutyric acid receptor-associated protein-like 3", "gene_name": "GABARAPL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IAA8-1", "protein_name": "Ragulator complex protein LAMTOR1", "gene_name": "LAMTOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVC4-1", "protein_name": "Target of rapamycin complex subunit LST8", "gene_name": "MLST8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VGL1-1", "protein_name": "Ragulator complex protein LAMTOR4", "gene_name": "LAMTOR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43504-1", "protein_name": "Ragulator complex protein LAMTOR5", "gene_name": "LAMTOR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L523-1", "protein_name": "Ras-related GTP-binding protein A", "gene_name": "RRAGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60520-1", "protein_name": "Gamma-aminobutyric acid receptor-associated protein-like 2", "gene_name": "GABARAPL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1Y0-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N122-1", "protein_name": "Regulatory-associated protein of mTOR", "gene_name": "RPTOR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDY2-1", "protein_name": "RB1-inducible coiled-coil protein 1", "gene_name": "RB1CC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0C7-1", "protein_name": "Activating molecule in BECN1-regulated autophagy protein 1", "gene_name": "AMBRA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q676U5-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "ATG16L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGI9-1", "protein_name": "5'-AMP-activated protein kinase subunit gamma-3", "gene_name": "PRKAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42345-1", "protein_name": "Serine/threonine-protein kinase mTOR", "gene_name": "MTOR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXW4-1", "protein_name": "Microtubule-associated protein 1 light chain 3 gamma", "gene_name": "MAP1LC3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZQ8-1", "protein_name": "Microtubule-associated protein 1 light chain 3 beta", "gene_name": "MAP1LC3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTJ5-1", "protein_name": "Phosphatidylinositol-3-phosphatase SAC1", "gene_name": "SACM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF8-1", "protein_name": "Phosphatidylinositol 4-kinase beta", "gene_name": "PI4KB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5MNZ6-1", "protein_name": "WD repeat domain phosphoinositide-interacting protein 3", "gene_name": "WDR45B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DT6-1", "protein_name": "Cysteine protease ATG4C", "gene_name": "ATG4C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZNE5-1", "protein_name": "Beclin 1-associated autophagy-related key regulator", "gene_name": "ATG14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H444-1", "protein_name": "Charged multivesicular body protein 4b", "gene_name": "CHMP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Q5-1", "protein_name": "Ragulator complex protein LAMTOR2", "gene_name": "LAMTOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15382-1", "protein_name": "GTP-binding protein Rheb", "gene_name": "RHEB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56180-1", "protein_name": "Putative tyrosine-protein phosphatase TPTE", "gene_name": "TPTE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y484-1", "protein_name": "WD repeat domain phosphoinositide-interacting protein 4", "gene_name": "WDR45", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5MNZ9-1", "protein_name": "WD repeat domain phosphoinositide-interacting protein 1", "gene_name": "WIPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRR6-1", "protein_name": "Phosphatidylinositol polyphosphate 5-phosphatase type IV", "gene_name": "INPP5E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXD2-1", "protein_name": "Myotubularin-related protein 10", "gene_name": "MTMR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6XPS3-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2", "gene_name": "TPTE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAA4-1", "protein_name": "Protein Atg16l2", "gene_name": "ATG16L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49815-1", "protein_name": "Tuberin", "gene_name": "TSC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54619-1", "protein_name": "5'-AMP-activated protein kinase subunit gamma-1", "gene_name": "PRKAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43741-1", "protein_name": "5'-AMP-activated protein kinase subunit beta-2", "gene_name": "PRKAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13131-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-1", "gene_name": "PRKAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54646-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-2", "gene_name": "PRKAA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGJ0-1", "protein_name": "5'-AMP-activated protein kinase subunit gamma-2", "gene_name": "PRKAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y478-1", "protein_name": "5'-AMP-activated protein kinase subunit beta-1", "gene_name": "PRKAB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7628435", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 95 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Properties of type II inositol polyphosphate 5-phosphatase.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Jefferson AB, Majerus PW", "reference": { "type": "PubMed", "id": "7721860", "url": "https://pubmed.ncbi.nlm.nih.gov/7721860" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51178-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1", "gene_name": "PLCD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23677-1", "protein_name": "Inositol-trisphosphate 3-kinase A", "gene_name": "ITPKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00722-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2", "gene_name": "PLCB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRC7-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4", "gene_name": "PLCD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YW0-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1", "gene_name": "PLCZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P212-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1", "gene_name": "PLCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ66-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1", "gene_name": "PLCB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75038-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2", "gene_name": "PLCH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KWH8-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1", "gene_name": "PLCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27987-1", "protein_name": "Inositol-trisphosphate 3-kinase B", "gene_name": "ITPKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15147-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4", "gene_name": "PLCB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3E9-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3", "gene_name": "PLCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01970-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3", "gene_name": "PLCB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BZ4-1", "protein_name": "5'-3' exonuclease PLD4", "gene_name": "PLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DU7-1", "protein_name": "Inositol-trisphosphate 3-kinase C", "gene_name": "ITPKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13572-1", "protein_name": "Inositol-tetrakisphosphate 1-kinase", "gene_name": "ITPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 990, "end_pos": 990, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of prenylation and membrane localization; when tested in a heterologous system. Does not affect catalytic activity toward Ins(1,4,5)P3.", "evidence": [ { "database": "UniProtKB", "id": "P32019", "url": "https://www.uniprot.org/uniprotkb/P32019" }, { "database": "PubMed", "id": "7721860", "url": "https://pubmed.ncbi.nlm.nih.gov/7721860" } ], "uniprot_canonical_ac": "P32019-1" } ], "record_id": "pubmed.7721860", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The protein deficient in Lowe syndrome is a phosphatidylinositol-4,5-bisphosphate 5-phosphatase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Zhang X, Jefferson AB, Auethavekiat V, Majerus PW", "reference": { "type": "PubMed", "id": "7761412", "url": "https://pubmed.ncbi.nlm.nih.gov/7761412" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51178-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1", "gene_name": "PLCD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23677-1", "protein_name": "Inositol-trisphosphate 3-kinase A", "gene_name": "ITPKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00722-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2", "gene_name": "PLCB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRC7-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4", "gene_name": "PLCD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YW0-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1", "gene_name": "PLCZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P212-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1", "gene_name": "PLCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ66-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1", "gene_name": "PLCB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42356-1", "protein_name": "Phosphatidylinositol 4-kinase alpha", "gene_name": "PI4KA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75038-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2", "gene_name": "PLCH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KWH8-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1", "gene_name": "PLCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTJ5-1", "protein_name": "Phosphatidylinositol-3-phosphatase SAC1", "gene_name": "SACM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27987-1", "protein_name": "Inositol-trisphosphate 3-kinase B", "gene_name": "ITPKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF8-1", "protein_name": "Phosphatidylinositol 4-kinase beta", "gene_name": "PI4KB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15147-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4", "gene_name": "PLCB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3E9-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3", "gene_name": "PLCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01970-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3", "gene_name": "PLCB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BZ4-1", "protein_name": "5'-3' exonuclease PLD4", "gene_name": "PLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56180-1", "protein_name": "Putative tyrosine-protein phosphatase TPTE", "gene_name": "TPTE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DU7-1", "protein_name": "Inositol-trisphosphate 3-kinase C", "gene_name": "ITPKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13572-1", "protein_name": "Inositol-tetrakisphosphate 1-kinase", "gene_name": "ITPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRR6-1", "protein_name": "Phosphatidylinositol polyphosphate 5-phosphatase type IV", "gene_name": "INPP5E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6XPS3-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2", "gene_name": "TPTE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7761412", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a cDNA encoding the 43-kDa membrane-associated inositol-polyphosphate 5-phosphatase.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Laxminarayan KM, Chan BK, Tetaz T, Bird PI, Mitchell CA", "reference": { "type": "PubMed", "id": "8006039", "url": "https://pubmed.ncbi.nlm.nih.gov/8006039" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8006039", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, heterologous expression, and chromosomal localization of human inositol polyphosphate 1-phosphatase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "York JD, Veile RA, Donis-Keller H, Majerus PW", "reference": { "type": "PubMed", "id": "8390685", "url": "https://pubmed.ncbi.nlm.nih.gov/8390685" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8390685", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification and characterization of the phosphatidylinositol-3,4,5-trisphosphate phosphatase in bovine thymus.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Kabuyama Y, Nakatsu N, Homma Y, Fukui Y", "reference": { "type": "PubMed", "id": "8681945", "url": "https://pubmed.ncbi.nlm.nih.gov/8681945" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8681945", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multiple forms of an inositol polyphosphate 5-phosphatase form signaling complexes with Shc and Grb2.", "journal": "Current biology : CB", "date": "1996", "authors": "Kavanaugh WM, Pot DA, Chin SM, Deuter-Reinhard M, Jefferson AB, Norris FA, Masiarz FR, Cousens LS, Majerus PW, Williams LT", "reference": { "type": "PubMed", "id": "8723348", "url": "https://pubmed.ncbi.nlm.nih.gov/8723348" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51178-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1", "gene_name": "PLCD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23677-1", "protein_name": "Inositol-trisphosphate 3-kinase A", "gene_name": "ITPKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00722-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2", "gene_name": "PLCB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRC7-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4", "gene_name": "PLCD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YW0-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1", "gene_name": "PLCZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P212-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1", "gene_name": "PLCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ66-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1", "gene_name": "PLCB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75038-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2", "gene_name": "PLCH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KWH8-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1", "gene_name": "PLCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27987-1", "protein_name": "Inositol-trisphosphate 3-kinase B", "gene_name": "ITPKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15147-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4", "gene_name": "PLCB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3E9-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3", "gene_name": "PLCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01970-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3", "gene_name": "PLCB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BZ4-1", "protein_name": "5'-3' exonuclease PLD4", "gene_name": "PLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DU7-1", "protein_name": "Inositol-trisphosphate 3-kinase C", "gene_name": "ITPKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13572-1", "protein_name": "Inositol-tetrakisphosphate 1-kinase", "gene_name": "ITPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62993-1", "protein_name": "Growth factor receptor-bound protein 2", "gene_name": "GRB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ES52-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "Inpp5d", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8723348", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 75 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and expression of a human placenta inositol 1,3,4,5-tetrakisphosphate and phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Drayer AL, Pesesse X, De Smedt F, Woscholski R, Parker P, Erneux C", "reference": { "type": "PubMed", "id": "8769125", "url": "https://pubmed.ncbi.nlm.nih.gov/8769125" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51178-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1", "gene_name": "PLCD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23677-1", "protein_name": "Inositol-trisphosphate 3-kinase A", "gene_name": "ITPKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00722-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2", "gene_name": "PLCB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRC7-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4", "gene_name": "PLCD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YW0-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1", "gene_name": "PLCZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P212-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1", "gene_name": "PLCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ66-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1", "gene_name": "PLCB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75038-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2", "gene_name": "PLCH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KWH8-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1", "gene_name": "PLCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27987-1", "protein_name": "Inositol-trisphosphate 3-kinase B", "gene_name": "ITPKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15147-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4", "gene_name": "PLCB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3E9-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3", "gene_name": "PLCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01970-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3", "gene_name": "PLCB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BZ4-1", "protein_name": "5'-3' exonuclease PLD4", "gene_name": "PLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DU7-1", "protein_name": "Inositol-trisphosphate 3-kinase C", "gene_name": "ITPKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13572-1", "protein_name": "Inositol-tetrakisphosphate 1-kinase", "gene_name": "ITPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8769125", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of p150, an adaptor protein for the human phosphatidylinositol (PtdIns) 3-kinase. Substrate presentation by phosphatidylinositol transfer protein to the p150.Ptdins 3-kinase complex.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Panaretou C, Domin J, Cockcroft S, Waterfield MD", "reference": { "type": "PubMed", "id": "8999962", "url": "https://pubmed.ncbi.nlm.nih.gov/8999962" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0I1-1", "protein_name": "Myotubularin-related protein 12", "gene_name": "MTMR12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42356-1", "protein_name": "Phosphatidylinositol 4-kinase alpha", "gene_name": "PI4KA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTJ5-1", "protein_name": "Phosphatidylinositol-3-phosphatase SAC1", "gene_name": "SACM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF8-1", "protein_name": "Phosphatidylinositol 4-kinase beta", "gene_name": "PI4KB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56180-1", "protein_name": "Putative tyrosine-protein phosphatase TPTE", "gene_name": "TPTE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRR6-1", "protein_name": "Phosphatidylinositol polyphosphate 5-phosphatase type IV", "gene_name": "INPP5E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXD2-1", "protein_name": "Myotubularin-related protein 10", "gene_name": "MTMR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6XPS3-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2", "gene_name": "TPTE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8999962", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The G beta gamma sensitivity of a PI3K is dependent upon a tightly associated adaptor, p101.", "journal": "Cell", "date": "1997", "authors": "Stephens LR, Eguinoa A, Erdjument-Bromage H, Lui M, Cooke F, Coadwell J, Smrcka AS, Thelen M, Cadwallader K, Tempst P, Hawkins PT", "reference": { "type": "PubMed", "id": "9094719", "url": "https://pubmed.ncbi.nlm.nih.gov/9094719" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O02696-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Pig" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O02697-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Pig" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9094719", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 55 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "P110delta, a novel phosphoinositide 3-kinase in leukocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Vanhaesebroeck B, Welham MJ, Kotani K, Stein R, Warne PH, Zvelebil MJ, Higashi K, Volinia S, Downward J, Waterfield MD", "reference": { "type": "PubMed", "id": "9113989", "url": "https://pubmed.ncbi.nlm.nih.gov/9113989" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1039, "end_pos": 1039, "kinase_uniprot_canonical_ac": "O00329-1", "kinase_gene_name": "PIK3CD", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00329", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00329" }, { "database": "PubMed", "id": "10064595", "url": "https://pubmed.ncbi.nlm.nih.gov/10064595" }, { "database": "PubMed", "id": "9113989", "url": "https://pubmed.ncbi.nlm.nih.gov/9113989" }, { "database": "UniProtKB", "id": "O00329", "url": "https://www.uniprot.org/uniprotkb/O00329" } ], "site_lbl": "Ser1039", "uniprot_canonical_ac": "O00329-1" } ], "record_id": "pubmed.9113989", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphatidylinositol-4-phosphate 5-kinase isozymes catalyze the synthesis of 3-phosphate-containing phosphatidylinositol signaling molecules.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Zhang X, Loijens JC, Boronenkov IV, Parker GJ, Norris FA, Chen J, Thum O, Prestwich GD, Majerus PW, Anderson RA", "reference": { "type": "PubMed", "id": "9211928", "url": "https://pubmed.ncbi.nlm.nih.gov/9211928" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9211928", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphatidylinositol 3-kinase in bovine photoreceptor rod outer segments.", "journal": "Investigative ophthalmology & visual science", "date": "1997", "authors": "Guo X, Ghalayini AJ, Chen H, Anderson RE", "reference": { "type": "PubMed", "id": "9286278", "url": "https://pubmed.ncbi.nlm.nih.gov/9286278" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9286278", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Norris FA, Atkins RC, Majerus PW", "reference": { "type": "PubMed", "id": "9295334", "url": "https://pubmed.ncbi.nlm.nih.gov/9295334" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0I1-1", "protein_name": "Myotubularin-related protein 12", "gene_name": "MTMR12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H2-1", "protein_name": "Phosphatidylinositide 4-phosphatase SAC2", "gene_name": "INPP5F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QWG5-1", "protein_name": "Type II inositol 3,4-bisphosphate 4-phosphatase", "gene_name": "Inpp4b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXD2-1", "protein_name": "Myotubularin-related protein 10", "gene_name": "MTMR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9295334", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 71 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A new pathway for synthesis of phosphatidylinositol-4,5-bisphosphate.", "journal": "Nature", "date": "1997", "authors": "Rameh LE, Tolias KF, Duckworth BC, Cantley LC", "reference": { "type": "PubMed", "id": "9367159", "url": "https://pubmed.ncbi.nlm.nih.gov/9367159" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P70181-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "Pip5k1b", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ES52-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "Inpp5d", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9367159", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 55 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell lines from kidney proximal tubules of a patient with Lowe syndrome lack OCRL inositol polyphosphate 5-phosphatase and accumulate phosphatidylinositol 4,5-bisphosphate.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhang X, Hartz PA, Philip E, Racusen LC, Majerus PW", "reference": { "type": "PubMed", "id": "9430698", "url": "https://pubmed.ncbi.nlm.nih.gov/9430698" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51178-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1", "gene_name": "PLCD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y216-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR7", "gene_name": "MTMR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49441-1", "protein_name": "Inositol polyphosphate 1-phosphatase", "gene_name": "INPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23677-1", "protein_name": "Inositol-trisphosphate 3-kinase A", "gene_name": "ITPKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14732-1", "protein_name": "Inositol monophosphatase 2", "gene_name": "IMPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29218-1", "protein_name": "Inositol monophosphatase 1", "gene_name": "IMPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00722-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2", "gene_name": "PLCB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRC7-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4", "gene_name": "PLCD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YW0-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1", "gene_name": "PLCZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P212-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1", "gene_name": "PLCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ66-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1", "gene_name": "PLCB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75038-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2", "gene_name": "PLCH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KWH8-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1", "gene_name": "PLCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27987-1", "protein_name": "Inositol-trisphosphate 3-kinase B", "gene_name": "ITPKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15147-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4", "gene_name": "PLCB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3E9-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3", "gene_name": "PLCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01970-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3", "gene_name": "PLCB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BZ4-1", "protein_name": "5'-3' exonuclease PLD4", "gene_name": "PLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DU7-1", "protein_name": "Inositol-trisphosphate 3-kinase C", "gene_name": "ITPKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13572-1", "protein_name": "Inositol-tetrakisphosphate 1-kinase", "gene_name": "ITPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH2-1", "protein_name": "Inositol-3-phosphate synthase 1", "gene_name": "ISYNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14642-1", "protein_name": "Inositol polyphosphate-5-phosphatase A", "gene_name": "INPP5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGB7-1", "protein_name": "Inositol oxygenase", "gene_name": "MIOX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9430698", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of a novel class II phosphoinositide 3-kinase containing C2 domain.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Misawa H, Ohtsubo M, Copeland NG, Gilbert DJ, Jenkins NA, Yoshimura A", "reference": { "type": "PubMed", "id": "9514948", "url": "https://pubmed.ncbi.nlm.nih.gov/9514948" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O70167-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "Pik3c2g", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9514948", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel class II phosphoinositide 3-kinase predominantly expressed in the liver and its enhanced expression during liver regeneration.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Ono F, Nakagawa T, Saito S, Owada Y, Sakagami H, Goto K, Suzuki M, Matsuno S, Kondo H", "reference": { "type": "PubMed", "id": "9516481", "url": "https://pubmed.ncbi.nlm.nih.gov/9516481" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08AM6-1", "protein_name": "Protein VAC14 homolog", "gene_name": "VAC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42356-1", "protein_name": "Phosphatidylinositol 4-kinase alpha", "gene_name": "PI4KA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O70173-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "Pik3c2g", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTJ5-1", "protein_name": "Phosphatidylinositol-3-phosphatase SAC1", "gene_name": "SACM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92562-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I7-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "PIKFYVE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF8-1", "protein_name": "Phosphatidylinositol 4-kinase beta", "gene_name": "PI4KB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56180-1", "protein_name": "Putative tyrosine-protein phosphatase TPTE", "gene_name": "TPTE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRR6-1", "protein_name": "Phosphatidylinositol polyphosphate 5-phosphatase type IV", "gene_name": "INPP5E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6XPS3-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2", "gene_name": "TPTE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9516481", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 66 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of human p55 gamma, a regulatory subunit of phosphatidylinositol 3-kinase, by a yeast two-hybrid library screen with the insulin-like growth factor-I receptor.", "journal": "Gene", "date": "1998", "authors": "Dey BR, Furlanetto RW, Nissley SP", "reference": { "type": "PubMed", "id": "9524259", "url": "https://pubmed.ncbi.nlm.nih.gov/9524259" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9524259", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The tumor suppressor, PTEN/MMAC1, dephosphorylates the lipid second messenger, phosphatidylinositol 3,4,5-trisphosphate.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Maehama T, Dixon JE", "reference": { "type": "PubMed", "id": "9593664", "url": "https://pubmed.ncbi.nlm.nih.gov/9593664" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51178-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1", "gene_name": "PLCD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23677-1", "protein_name": "Inositol-trisphosphate 3-kinase A", "gene_name": "ITPKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00722-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2", "gene_name": "PLCB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRC7-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4", "gene_name": "PLCD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YW0-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1", "gene_name": "PLCZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P212-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1", "gene_name": "PLCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ66-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1", "gene_name": "PLCB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75038-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2", "gene_name": "PLCH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KWH8-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1", "gene_name": "PLCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27987-1", "protein_name": "Inositol-trisphosphate 3-kinase B", "gene_name": "ITPKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15147-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4", "gene_name": "PLCB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3E9-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3", "gene_name": "PLCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01970-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3", "gene_name": "PLCB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BZ4-1", "protein_name": "5'-3' exonuclease PLD4", "gene_name": "PLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DU7-1", "protein_name": "Inositol-trisphosphate 3-kinase C", "gene_name": "ITPKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13572-1", "protein_name": "Inositol-tetrakisphosphate 1-kinase", "gene_name": "ITPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32019-1", "protein_name": "Type II inositol 1,4,5-trisphosphate 5-phosphatase", "gene_name": "INPP5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9593664", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 73 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Type I phosphatidylinositol-4-phosphate 5-kinases synthesize the novel lipids phosphatidylinositol 3,5-bisphosphate and phosphatidylinositol 5-phosphate.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Tolias KF, Rameh LE, Ishihara H, Shibasaki Y, Chen J, Prestwich GD, Cantley LC, Carpenter CL", "reference": { "type": "PubMed", "id": "9660759", "url": "https://pubmed.ncbi.nlm.nih.gov/9660759" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9660759", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Growth factors and insulin stimulate tyrosine phosphorylation of the 51C/SHIP2 protein.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Habib T, Hejna JA, Moses RE, Decker SJ", "reference": { "type": "PubMed", "id": "9660833", "url": "https://pubmed.ncbi.nlm.nih.gov/9660833" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29353-1", "protein_name": "SHC-transforming protein 1", "gene_name": "SHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9660833", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The lipid phosphatase activity of PTEN is critical for its tumor supressor function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Myers MP, Pass I, Batty IH, Van der Kaay J, Stolarov JP, Hemmings BA, Wigler MH, Downes CP, Tonks NK", "reference": { "type": "PubMed", "id": "9811831", "url": "https://pubmed.ncbi.nlm.nih.gov/9811831" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 130, "end_pos": 130, "sequence_org": "R", "sequence_mut": "M", "comment": "Does not affect the ability to inhibit AKT/PKB activation.", "evidence": [ { "database": "UniProtKB", "id": "P60484", "url": "https://www.uniprot.org/uniprotkb/P60484" }, { "database": "PubMed", "id": "9811831", "url": "https://pubmed.ncbi.nlm.nih.gov/9811831" } ], "uniprot_canonical_ac": "P60484-1" } ], "record_id": "pubmed.9811831", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human phosphoinositide 3-kinase C2beta, the role of calcium and the C2 domain in enzyme activity.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Arcaro A, Volinia S, Zvelebil MJ, Stein R, Watton SJ, Layton MJ, Gout I, Ahmadi K, Downward J, Waterfield MD", "reference": { "type": "PubMed", "id": "9830063", "url": "https://pubmed.ncbi.nlm.nih.gov/9830063" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96QG7-1", "protein_name": "Myotubularin-related protein 9", "gene_name": "MTMR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT40-1", "protein_name": "Inositol polyphosphate 5-phosphatase K", "gene_name": "INPP5K", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92835-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1", "gene_name": "INPP5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78356-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 beta", "gene_name": "PIP4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB21-1", "protein_name": "Pleckstrin homology domain-containing family A member 1", "gene_name": "PLEKHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF0-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8", "gene_name": "MTMR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75747-1", "protein_name": "Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma", "gene_name": "PIK3C2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00443-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "PIK3C2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBX8-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma", "gene_name": "PIP4K2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JA3-1", "protein_name": "Pleckstrin homology domain-containing family A member 8", "gene_name": "PLEKHA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15735-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A", "gene_name": "INPP5J", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00750-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta", "gene_name": "PIK3C2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCE2-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14", "gene_name": "MTMR14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU0-1", "protein_name": "Pleckstrin homology domain-containing family A member 5", "gene_name": "PLEKHA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13613-1", "protein_name": "Phosphatidylinositol-3-phosphate phosphatase MTMR1", "gene_name": "MTMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13614-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR2", "gene_name": "MTMR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WG5-1", "protein_name": "Myotubularin-related protein 13", "gene_name": "SBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99755-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha", "gene_name": "PIP5K1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48426-1", "protein_name": "Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha", "gene_name": "PIP4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB20-1", "protein_name": "Pleckstrin homology domain-containing family A member 3", "gene_name": "PLEKHA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTU6-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-alpha", "gene_name": "PI4K2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCG2-1", "protein_name": "Phosphatidylinositol 4-kinase type 2-beta", "gene_name": "PI4K2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T51-1", "protein_name": "RUN and FYVE domain-containing protein 1", "gene_name": "RUFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y217-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR6", "gene_name": "MTMR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15357-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2", "gene_name": "INPPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61106-1", "protein_name": "Ras-related protein Rab-14", "gene_name": "RAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20338-1", "protein_name": "Ras-related protein Rab-4A", "gene_name": "RAB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15056-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ2", "gene_name": "SYNJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB19-1", "protein_name": "Pleckstrin homology domain-containing family A member 2", "gene_name": "PLEKHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51813-1", "protein_name": "Cytoplasmic tyrosine-protein kinase BMX", "gene_name": "BMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13496-1", "protein_name": "Myotubularin", "gene_name": "MTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13615-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3", "gene_name": "MTMR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12923-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 13", "gene_name": "PTPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M7-1", "protein_name": "Pleckstrin homology domain-containing family A member 4", "gene_name": "PLEKHA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14986-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 beta", "gene_name": "PIP5K1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60331-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma", "gene_name": "PIP5K1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H5-1", "protein_name": "Pleckstrin homology domain-containing family A member 6", "gene_name": "PLEKHA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE3-1", "protein_name": "Inositol polyphosphate-4-phosphatase type I A", "gene_name": "INPP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43426-1", "protein_name": "Polyphosphatidylinositol phosphatase SYNJ1", "gene_name": "SYNJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15327-1", "protein_name": "Inositol polyphosphate 4-phosphatase type II", "gene_name": "INPP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96QG7", "url": "https://www.uniprot.org/uniprotkb/Q96QG7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9830063", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LY-6K gene: a novel molecular marker for human breast cancer.", "journal": "Oncology reports", "date": "2006", "authors": "Lee JW, Lee YS, Yoo KH, Lee KH, Park K, Ahn T, Ko C, Park JH", "reference": { "type": "PubMed", "id": "17089039", "url": "https://pubmed.ncbi.nlm.nih.gov/17089039" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DP58-1", "protein_name": "Ly-6/neurotoxin-like protein 1", "gene_name": "LYNX1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP58", "url": "https://www.uniprot.org/uniprotkb/P0DP58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17089039", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activated cholinergic signaling provides a target in squamous cell lung carcinoma.", "journal": "Cancer research", "date": "2008", "authors": "Song P, Sekhon HS, Fu XW, Maier M, Jia Y, Duan J, Proskosil BJ, Gravett C, Lindstrom J, Mark GP, Saha S, Spindel ER", "reference": { "type": "PubMed", "id": "18559515", "url": "https://pubmed.ncbi.nlm.nih.gov/18559515" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DP58-1", "protein_name": "Ly-6/neurotoxin-like protein 1", "gene_name": "LYNX1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP58", "url": "https://www.uniprot.org/uniprotkb/P0DP58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18559515", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Metastatic effect of LY-6K gene in breast cancer cells.", "journal": "International journal of oncology", "date": "2009", "authors": "Choi SH, Kong HK, Park SY, Park JH", "reference": { "type": "PubMed", "id": "19639180", "url": "https://pubmed.ncbi.nlm.nih.gov/19639180" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DP58-1", "protein_name": "Ly-6/neurotoxin-like protein 1", "gene_name": "LYNX1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP58", "url": "https://www.uniprot.org/uniprotkb/P0DP58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19639180", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NMR structure and action on nicotinic acetylcholine receptors of water-soluble domain of human LYNX1.", "journal": "The Journal of biological chemistry", "date": "2011-03-25", "authors": "Lyukmanova Ekaterina N, Shenkarev Zakhar O, Shulepko Mikhail A, Mineev Konstantin S, D'Hoedt Dieter, Kasheverov Igor E, Filkin Sergey Yu, Krivolapova Alexandra P, Janickova Helena, Dolezal Vladimir, Dolgikh Dmitry A, Arseniev Alexander S, Bertrand Daniel, Tsetlin Victor I, Kirpichnikov Mikhail P", "reference": { "type": "PubMed", "id": "21252236", "url": "https://pubmed.ncbi.nlm.nih.gov/21252236" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DP58-1", "protein_name": "Ly-6/neurotoxin-like protein 1", "gene_name": "LYNX1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP58", "url": "https://www.uniprot.org/uniprotkb/P0DP58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21252236", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLEEPLESS is a bifunctional regulator of excitability and cholinergic synaptic transmission.", "journal": "Curr. Biol.", "date": "2014", "authors": "Wu Meilin, Robinson James E, Joiner William J", "reference": { "type": "PubMed", "id": "24613312", "url": "https://pubmed.ncbi.nlm.nih.gov/24613312" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DP58-1", "protein_name": "Ly-6/neurotoxin-like protein 1", "gene_name": "LYNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "B5A5T4-1", "protein_name": "UPAR/Ly6 domain-containing protein qvr", "gene_name": "qvr", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08510-1", "protein_name": "Potassium voltage-gated channel protein Shaker", "gene_name": "Sh", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P16389-1", "protein_name": "Potassium voltage-gated channel subfamily A member 2", "gene_name": "KCNA2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP58", "url": "https://www.uniprot.org/uniprotkb/P0DP58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24613312", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptional regulation of SLURP2, a psoriasis-associated gene, is under control of IL-22 in the skin: A special reference to the nested gene LYNX1.", "journal": "Int. Immunopharmacol.", "date": "2015", "authors": "Moriwaki Y, Takada K, Tsuji S, Kawashima K, Misawa H", "reference": { "type": "PubMed", "id": "26033490", "url": "https://pubmed.ncbi.nlm.nih.gov/26033490" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DP58-1", "protein_name": "Ly-6/neurotoxin-like protein 1", "gene_name": "LYNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP57-1", "protein_name": "Secreted Ly-6/uPAR domain-containing protein 2", "gene_name": "SLURP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP58", "url": "https://www.uniprot.org/uniprotkb/P0DP58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26033490", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isoform-specific mechanisms of \u03b13\u03b24*-nicotinic acetylcholine receptor modulation by the prototoxin lynx1.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2017-04", "authors": "George Andrew A, Bloy Abigail, Miwa Julie M, Lindstrom Jon M, Lukas Ronald J, Whiteaker Paul", "reference": { "type": "PubMed", "id": "28100642", "url": "https://pubmed.ncbi.nlm.nih.gov/28100642" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DP58-1", "protein_name": "Ly-6/neurotoxin-like protein 1", "gene_name": "LYNX1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP58", "url": "https://www.uniprot.org/uniprotkb/P0DP58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28100642", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Water-soluble variant of human Lynx1 induces cell cycle arrest and apoptosis in lung cancer cells via modulation of alpha7 nicotinic acetylcholine receptors.", "journal": "PloS one", "date": "2019", "authors": "Bychkov M, Shenkarev Z, Shulepko M, Shlepova O, Kirpichnikov M, Lyukmanova E", "reference": { "type": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DP58-1", "protein_name": "Ly-6/neurotoxin-like protein 1", "gene_name": "LYNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP58", "url": "https://www.uniprot.org/uniprotkb/P0DP58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5, PRPK, AMPK, NUAK1 and ATM", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "10864201", "url": "https://pubmed.ncbi.nlm.nih.gov/10864201" }, { "database": "PubMed", "id": "15580310", "url": "https://pubmed.ncbi.nlm.nih.gov/15580310" }, { "database": "IntAct", "id": "P04637", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04637*" }, { "database": "PubMed", "id": "19883646", "url": "https://pubmed.ncbi.nlm.nih.gov/19883646" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "15866171", "url": "https://pubmed.ncbi.nlm.nih.gov/15866171" }, { "database": "PubMed", "id": "17591690", "url": "https://pubmed.ncbi.nlm.nih.gov/17591690" }, { "database": "PubMed", "id": "19828454", "url": "https://pubmed.ncbi.nlm.nih.gov/19828454" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PubMed", "id": "9925639", "url": "https://pubmed.ncbi.nlm.nih.gov/9925639" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "10202145", "url": "https://pubmed.ncbi.nlm.nih.gov/10202145" }, { "database": "PubMed", "id": "10606744", "url": "https://pubmed.ncbi.nlm.nih.gov/10606744" }, { "database": "PubMed", "id": "14712210", "url": "https://pubmed.ncbi.nlm.nih.gov/14712210" }, { "database": "PubMed", "id": "15642743", "url": "https://pubmed.ncbi.nlm.nih.gov/15642743" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "10082548", "url": "https://pubmed.ncbi.nlm.nih.gov/10082548" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10435622", "url": "https://pubmed.ncbi.nlm.nih.gov/10435622" }, { "database": "PubMed", "id": "10485486", "url": "https://pubmed.ncbi.nlm.nih.gov/10485486" }, { "database": "PubMed", "id": "10500142", "url": "https://pubmed.ncbi.nlm.nih.gov/10500142" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10544021", "url": "https://pubmed.ncbi.nlm.nih.gov/10544021" }, { "database": "PubMed", "id": "10570149", "url": "https://pubmed.ncbi.nlm.nih.gov/10570149" }, { "database": "PubMed", "id": "10601022", "url": "https://pubmed.ncbi.nlm.nih.gov/10601022" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10713094", "url": "https://pubmed.ncbi.nlm.nih.gov/10713094" }, { "database": "PubMed", "id": "10723129", "url": "https://pubmed.ncbi.nlm.nih.gov/10723129" }, { "database": "PubMed", "id": "10734067", "url": "https://pubmed.ncbi.nlm.nih.gov/10734067" }, { "database": "PubMed", "id": "10734308", "url": "https://pubmed.ncbi.nlm.nih.gov/10734308" }, { "database": "PubMed", "id": "10749144", "url": "https://pubmed.ncbi.nlm.nih.gov/10749144" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10860736", "url": "https://pubmed.ncbi.nlm.nih.gov/10860736" }, { "database": "PubMed", "id": "10930428", "url": "https://pubmed.ncbi.nlm.nih.gov/10930428" }, { "database": "PubMed", "id": "11042698", "url": "https://pubmed.ncbi.nlm.nih.gov/11042698" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11096068", "url": "https://pubmed.ncbi.nlm.nih.gov/11096068" }, { "database": "PubMed", "id": "11099484", "url": "https://pubmed.ncbi.nlm.nih.gov/11099484" }, { "database": "PubMed", "id": "11103796", "url": "https://pubmed.ncbi.nlm.nih.gov/11103796" }, { "database": "PubMed", "id": "11121242", "url": "https://pubmed.ncbi.nlm.nih.gov/11121242" }, { "database": "PubMed", "id": "11149936", "url": "https://pubmed.ncbi.nlm.nih.gov/11149936" }, { "database": "PubMed", "id": "11244509", "url": "https://pubmed.ncbi.nlm.nih.gov/11244509" }, { "database": "PubMed", "id": "11245472", "url": "https://pubmed.ncbi.nlm.nih.gov/11245472" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11313957", "url": "https://pubmed.ncbi.nlm.nih.gov/11313957" }, { "database": "PubMed", "id": "11314044", "url": "https://pubmed.ncbi.nlm.nih.gov/11314044" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11326311", "url": "https://pubmed.ncbi.nlm.nih.gov/11326311" }, { "database": "PubMed", "id": "11397945", "url": "https://pubmed.ncbi.nlm.nih.gov/11397945" }, { "database": "PubMed", "id": "11447225", "url": "https://pubmed.ncbi.nlm.nih.gov/11447225" }, { "database": "PubMed", "id": "11470744", "url": "https://pubmed.ncbi.nlm.nih.gov/11470744" }, { "database": "PubMed", "id": "11483158", "url": "https://pubmed.ncbi.nlm.nih.gov/11483158" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11495913", "url": "https://pubmed.ncbi.nlm.nih.gov/11495913" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11568365", "url": "https://pubmed.ncbi.nlm.nih.gov/11568365" }, { "database": "PubMed", "id": "11583595", "url": "https://pubmed.ncbi.nlm.nih.gov/11583595" }, { "database": "PubMed", "id": "11602639", "url": "https://pubmed.ncbi.nlm.nih.gov/11602639" }, { "database": "PubMed", "id": "11706017", "url": "https://pubmed.ncbi.nlm.nih.gov/11706017" }, { "database": "PubMed", "id": "11709713", "url": "https://pubmed.ncbi.nlm.nih.gov/11709713" }, { "database": "PubMed", "id": "11751391", "url": "https://pubmed.ncbi.nlm.nih.gov/11751391" }, { "database": "PubMed", "id": "11850826", "url": "https://pubmed.ncbi.nlm.nih.gov/11850826" }, { "database": "PubMed", "id": "11857452", "url": "https://pubmed.ncbi.nlm.nih.gov/11857452" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11865061", "url": "https://pubmed.ncbi.nlm.nih.gov/11865061" }, { "database": "PubMed", "id": "11875057", "url": "https://pubmed.ncbi.nlm.nih.gov/11875057" }, { "database": "PubMed", "id": "11877452", "url": "https://pubmed.ncbi.nlm.nih.gov/11877452" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "11927575", "url": "https://pubmed.ncbi.nlm.nih.gov/11927575" }, { "database": "PubMed", "id": "11965244", "url": "https://pubmed.ncbi.nlm.nih.gov/11965244" }, { "database": "PubMed", "id": "11973611", "url": "https://pubmed.ncbi.nlm.nih.gov/11973611" }, { "database": "PubMed", "id": "12066222", "url": "https://pubmed.ncbi.nlm.nih.gov/12066222" }, { "database": "PubMed", "id": "12071847", "url": "https://pubmed.ncbi.nlm.nih.gov/12071847" }, { "database": "PubMed", "id": "12082025", "url": "https://pubmed.ncbi.nlm.nih.gov/12082025" }, { "database": "PubMed", "id": "12082529", "url": "https://pubmed.ncbi.nlm.nih.gov/12082529" }, { "database": "PubMed", "id": "12091386", "url": "https://pubmed.ncbi.nlm.nih.gov/12091386" }, { "database": "PubMed", "id": "12131363", "url": "https://pubmed.ncbi.nlm.nih.gov/12131363" }, { "database": "PubMed", "id": "12145207", "url": "https://pubmed.ncbi.nlm.nih.gov/12145207" }, { "database": "PubMed", "id": "12151394", "url": "https://pubmed.ncbi.nlm.nih.gov/12151394" }, { "database": "PubMed", "id": "12238331", "url": "https://pubmed.ncbi.nlm.nih.gov/12238331" }, { "database": "PubMed", "id": "12381304", "url": "https://pubmed.ncbi.nlm.nih.gov/12381304" }, { "database": "PubMed", "id": "12393500", "url": "https://pubmed.ncbi.nlm.nih.gov/12393500" }, { "database": "PubMed", "id": "12419181", "url": "https://pubmed.ncbi.nlm.nih.gov/12419181" }, { "database": "PubMed", "id": "12427754", "url": "https://pubmed.ncbi.nlm.nih.gov/12427754" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12478472", "url": "https://pubmed.ncbi.nlm.nih.gov/12478472" }, { "database": "PubMed", "id": "12518062", "url": "https://pubmed.ncbi.nlm.nih.gov/12518062" }, { "database": "PubMed", "id": "12519780", "url": "https://pubmed.ncbi.nlm.nih.gov/12519780" }, { "database": "PubMed", "id": "12531896", "url": "https://pubmed.ncbi.nlm.nih.gov/12531896" }, { "database": "PubMed", "id": "12534344", "url": "https://pubmed.ncbi.nlm.nih.gov/12534344" }, { "database": "PubMed", "id": "12584171", "url": "https://pubmed.ncbi.nlm.nih.gov/12584171" }, { "database": "PubMed", "id": "12606123", "url": "https://pubmed.ncbi.nlm.nih.gov/12606123" }, { "database": "PubMed", "id": "12612087", "url": "https://pubmed.ncbi.nlm.nih.gov/12612087" }, { "database": "PubMed", "id": "12644594", "url": "https://pubmed.ncbi.nlm.nih.gov/12644594" }, { "database": "PubMed", "id": "12659830", "url": "https://pubmed.ncbi.nlm.nih.gov/12659830" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12698201", "url": "https://pubmed.ncbi.nlm.nih.gov/12698201" }, { "database": "PubMed", "id": "12702572", "url": "https://pubmed.ncbi.nlm.nih.gov/12702572" }, { "database": "PubMed", "id": "12719724", "url": "https://pubmed.ncbi.nlm.nih.gov/12719724" }, { "database": "PubMed", "id": "12756247", "url": "https://pubmed.ncbi.nlm.nih.gov/12756247" }, { "database": "PubMed", "id": "12767922", "url": "https://pubmed.ncbi.nlm.nih.gov/12767922" }, { "database": "PubMed", "id": "12811820", "url": "https://pubmed.ncbi.nlm.nih.gov/12811820" }, { "database": "PubMed", "id": "12853888", "url": "https://pubmed.ncbi.nlm.nih.gov/12853888" }, { "database": "PubMed", "id": "12857758", "url": "https://pubmed.ncbi.nlm.nih.gov/12857758" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12902982", "url": "https://pubmed.ncbi.nlm.nih.gov/12902982" }, { "database": "PubMed", "id": "12912974", "url": "https://pubmed.ncbi.nlm.nih.gov/12912974" }, { "database": "PubMed", "id": "12919932", "url": "https://pubmed.ncbi.nlm.nih.gov/12919932" }, { "database": "PubMed", "id": "12939400", "url": "https://pubmed.ncbi.nlm.nih.gov/12939400" }, { "database": "PubMed", "id": "12951835", "url": "https://pubmed.ncbi.nlm.nih.gov/12951835" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "12968928", "url": "https://pubmed.ncbi.nlm.nih.gov/12968928" }, { "database": "PubMed", "id": "13678348", "url": "https://pubmed.ncbi.nlm.nih.gov/13678348" }, { "database": "PubMed", "id": "1406679", "url": "https://pubmed.ncbi.nlm.nih.gov/1406679" }, { "database": "PubMed", "id": "14511359", "url": "https://pubmed.ncbi.nlm.nih.gov/14511359" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14527925", "url": "https://pubmed.ncbi.nlm.nih.gov/14527925" }, { "database": "PubMed", "id": "14559802", "url": "https://pubmed.ncbi.nlm.nih.gov/14559802" }, { "database": "PubMed", "id": "14612532", "url": "https://pubmed.ncbi.nlm.nih.gov/14612532" }, { "database": "PubMed", "id": "14617104", "url": "https://pubmed.ncbi.nlm.nih.gov/14617104" }, { "database": "PubMed", "id": "14623946", "url": "https://pubmed.ncbi.nlm.nih.gov/14623946" }, { "database": "PubMed", "id": "14637186", "url": "https://pubmed.ncbi.nlm.nih.gov/14637186" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14755247", "url": "https://pubmed.ncbi.nlm.nih.gov/14755247" }, { "database": "PubMed", "id": "14757188", "url": "https://pubmed.ncbi.nlm.nih.gov/14757188" }, { "database": "PubMed", "id": "14871840", "url": "https://pubmed.ncbi.nlm.nih.gov/14871840" }, { "database": "PubMed", "id": "14965474", "url": "https://pubmed.ncbi.nlm.nih.gov/14965474" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "14968111", "url": "https://pubmed.ncbi.nlm.nih.gov/14968111" }, { "database": "PubMed", "id": "14993250", "url": "https://pubmed.ncbi.nlm.nih.gov/14993250" }, { "database": "PubMed", "id": "15001399", "url": "https://pubmed.ncbi.nlm.nih.gov/15001399" }, { "database": "PubMed", "id": "15026814", "url": "https://pubmed.ncbi.nlm.nih.gov/15026814" }, { "database": "PubMed", "id": "15077171", "url": "https://pubmed.ncbi.nlm.nih.gov/15077171" }, { "database": "PubMed", "id": "15081425", "url": "https://pubmed.ncbi.nlm.nih.gov/15081425" }, { "database": "PubMed", "id": "15095398", "url": "https://pubmed.ncbi.nlm.nih.gov/15095398" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15159397", "url": "https://pubmed.ncbi.nlm.nih.gov/15159397" }, { "database": "PubMed", "id": "15159417", "url": "https://pubmed.ncbi.nlm.nih.gov/15159417" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15178317", "url": "https://pubmed.ncbi.nlm.nih.gov/15178317" }, { "database": "PubMed", "id": "15178764", "url": "https://pubmed.ncbi.nlm.nih.gov/15178764" }, { "database": "PubMed", "id": "15181149", "url": "https://pubmed.ncbi.nlm.nih.gov/15181149" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15199542", "url": "https://pubmed.ncbi.nlm.nih.gov/15199542" }, { "database": "PubMed", "id": "15226436", "url": "https://pubmed.ncbi.nlm.nih.gov/15226436" }, { "database": "PubMed", "id": "15252149", "url": "https://pubmed.ncbi.nlm.nih.gov/15252149" }, { "database": "PubMed", "id": "15254178", "url": "https://pubmed.ncbi.nlm.nih.gov/15254178" }, { "database": "PubMed", "id": "15289875", "url": "https://pubmed.ncbi.nlm.nih.gov/15289875" }, { "database": "PubMed", "id": "15310764", "url": "https://pubmed.ncbi.nlm.nih.gov/15310764" }, { "database": "PubMed", "id": "15322239", "url": "https://pubmed.ncbi.nlm.nih.gov/15322239" }, { "database": "PubMed", "id": "15355354", "url": "https://pubmed.ncbi.nlm.nih.gov/15355354" }, { "database": "PubMed", "id": "15381086", "url": "https://pubmed.ncbi.nlm.nih.gov/15381086" }, { "database": "PubMed", "id": "15456759", "url": "https://pubmed.ncbi.nlm.nih.gov/15456759" }, { "database": "PubMed", "id": "15464845", "url": "https://pubmed.ncbi.nlm.nih.gov/15464845" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15474986", "url": "https://pubmed.ncbi.nlm.nih.gov/15474986" }, { "database": "PubMed", "id": "15489892", "url": "https://pubmed.ncbi.nlm.nih.gov/15489892" }, { "database": "PubMed", "id": "15492510", "url": "https://pubmed.ncbi.nlm.nih.gov/15492510" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15533933", "url": "https://pubmed.ncbi.nlm.nih.gov/15533933" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15542774", "url": "https://pubmed.ncbi.nlm.nih.gov/15542774" }, { "database": "PubMed", "id": "15557124", "url": "https://pubmed.ncbi.nlm.nih.gov/15557124" }, { "database": "PubMed", "id": "15613785", "url": "https://pubmed.ncbi.nlm.nih.gov/15613785" }, { "database": "PubMed", "id": "15650224", "url": "https://pubmed.ncbi.nlm.nih.gov/15650224" }, { "database": "PubMed", "id": "15657356", "url": "https://pubmed.ncbi.nlm.nih.gov/15657356" }, { "database": "PubMed", "id": "15710360", "url": "https://pubmed.ncbi.nlm.nih.gov/15710360" }, { "database": "PubMed", "id": "15713892", "url": "https://pubmed.ncbi.nlm.nih.gov/15713892" }, { "database": "PubMed", "id": "15720815", "url": "https://pubmed.ncbi.nlm.nih.gov/15720815" }, { "database": "PubMed", "id": "15735102", "url": "https://pubmed.ncbi.nlm.nih.gov/15735102" }, { "database": "PubMed", "id": "15752772", "url": "https://pubmed.ncbi.nlm.nih.gov/15752772" }, { "database": "PubMed", "id": "15782130", "url": "https://pubmed.ncbi.nlm.nih.gov/15782130" }, { "database": "PubMed", "id": "15794754", "url": "https://pubmed.ncbi.nlm.nih.gov/15794754" }, { "database": "PubMed", "id": "15795939", "url": "https://pubmed.ncbi.nlm.nih.gov/15795939" }, { "database": "PubMed", "id": "15837074", "url": "https://pubmed.ncbi.nlm.nih.gov/15837074" }, { "database": "PubMed", "id": "15845651", "url": "https://pubmed.ncbi.nlm.nih.gov/15845651" }, { "database": "PubMed", "id": "15867353", "url": "https://pubmed.ncbi.nlm.nih.gov/15867353" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "15908423", "url": "https://pubmed.ncbi.nlm.nih.gov/15908423" }, { "database": "PubMed", "id": "16024610", "url": "https://pubmed.ncbi.nlm.nih.gov/16024610" }, { "database": "PubMed", "id": "16024799", "url": "https://pubmed.ncbi.nlm.nih.gov/16024799" }, { "database": "PubMed", "id": "16043514", "url": "https://pubmed.ncbi.nlm.nih.gov/16043514" }, { "database": "PubMed", "id": "16082226", "url": "https://pubmed.ncbi.nlm.nih.gov/16082226" }, { "database": "PubMed", "id": "16096427", "url": "https://pubmed.ncbi.nlm.nih.gov/16096427" }, { "database": "PubMed", "id": "16103197", "url": "https://pubmed.ncbi.nlm.nih.gov/16103197" }, { "database": "PubMed", "id": "16140041", "url": "https://pubmed.ncbi.nlm.nih.gov/16140041" }, { "database": "PubMed", "id": "16177561", "url": "https://pubmed.ncbi.nlm.nih.gov/16177561" }, { "database": "PubMed", "id": "16179498", "url": "https://pubmed.ncbi.nlm.nih.gov/16179498" }, { "database": "PubMed", "id": "16180010", "url": "https://pubmed.ncbi.nlm.nih.gov/16180010" }, { "database": "PubMed", "id": "16227412", "url": "https://pubmed.ncbi.nlm.nih.gov/16227412" }, { "database": "PubMed", "id": "16229013", "url": "https://pubmed.ncbi.nlm.nih.gov/16229013" }, { "database": "PubMed", "id": "16302093", "url": "https://pubmed.ncbi.nlm.nih.gov/16302093" }, { "database": "PubMed", "id": "16313886", "url": "https://pubmed.ncbi.nlm.nih.gov/16313886" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16322229", "url": "https://pubmed.ncbi.nlm.nih.gov/16322229" }, { "database": "PubMed", "id": "16397295", "url": "https://pubmed.ncbi.nlm.nih.gov/16397295" }, { "database": "PubMed", "id": "16414131", "url": "https://pubmed.ncbi.nlm.nih.gov/16414131" }, { "database": "PubMed", "id": "16433685", "url": "https://pubmed.ncbi.nlm.nih.gov/16433685" }, { "database": "PubMed", "id": "16436515", "url": "https://pubmed.ncbi.nlm.nih.gov/16436515" }, { "database": "PubMed", "id": "16474133", "url": "https://pubmed.ncbi.nlm.nih.gov/16474133" }, { "database": "PubMed", "id": "16489034", "url": "https://pubmed.ncbi.nlm.nih.gov/16489034" }, { "database": "PubMed", "id": "16501611", "url": "https://pubmed.ncbi.nlm.nih.gov/16501611" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16538517", "url": "https://pubmed.ncbi.nlm.nih.gov/16538517" }, { "database": "PubMed", "id": "16584535", "url": "https://pubmed.ncbi.nlm.nih.gov/16584535" }, { "database": "PubMed", "id": "16600182", "url": "https://pubmed.ncbi.nlm.nih.gov/16600182" }, { "database": "PubMed", "id": "16611888", "url": "https://pubmed.ncbi.nlm.nih.gov/16611888" }, { "database": "PubMed", "id": "16618811", "url": "https://pubmed.ncbi.nlm.nih.gov/16618811" }, { "database": "PubMed", "id": "16630142", "url": "https://pubmed.ncbi.nlm.nih.gov/16630142" }, { "database": "PubMed", "id": "16632641", "url": "https://pubmed.ncbi.nlm.nih.gov/16632641" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16705155", "url": "https://pubmed.ncbi.nlm.nih.gov/16705155" }, { "database": "PubMed", "id": "16714289", "url": "https://pubmed.ncbi.nlm.nih.gov/16714289" }, { "database": "PubMed", "id": "16715525", "url": "https://pubmed.ncbi.nlm.nih.gov/16715525" }, { "database": "PubMed", "id": "16731759", "url": "https://pubmed.ncbi.nlm.nih.gov/16731759" }, { "database": "PubMed", "id": "16751801", "url": "https://pubmed.ncbi.nlm.nih.gov/16751801" }, { "database": "PubMed", "id": "16753148", "url": "https://pubmed.ncbi.nlm.nih.gov/16753148" }, { "database": "PubMed", "id": "16777994", "url": "https://pubmed.ncbi.nlm.nih.gov/16777994" }, { "database": "PubMed", "id": "16778146", "url": "https://pubmed.ncbi.nlm.nih.gov/16778146" }, { "database": "PubMed", "id": "16801388", "url": "https://pubmed.ncbi.nlm.nih.gov/16801388" }, { "database": "PubMed", "id": "16814113", "url": "https://pubmed.ncbi.nlm.nih.gov/16814113" }, { "database": "PubMed", "id": "16815295", "url": "https://pubmed.ncbi.nlm.nih.gov/16815295" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16827804", "url": "https://pubmed.ncbi.nlm.nih.gov/16827804" }, { "database": "PubMed", "id": "16891474", "url": "https://pubmed.ncbi.nlm.nih.gov/16891474" }, { "database": "PubMed", "id": "16912307", "url": "https://pubmed.ncbi.nlm.nih.gov/16912307" }, { "database": "PubMed", "id": "16928824", "url": "https://pubmed.ncbi.nlm.nih.gov/16928824" }, { "database": "PubMed", "id": "16966622", "url": "https://pubmed.ncbi.nlm.nih.gov/16966622" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "16971507", "url": "https://pubmed.ncbi.nlm.nih.gov/16971507" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "17113036", "url": "https://pubmed.ncbi.nlm.nih.gov/17113036" }, { "database": "PubMed", "id": "17126818", "url": "https://pubmed.ncbi.nlm.nih.gov/17126818" }, { "database": "PubMed", "id": "17172431", "url": "https://pubmed.ncbi.nlm.nih.gov/17172431" }, { "database": "PubMed", "id": "17174366", "url": "https://pubmed.ncbi.nlm.nih.gov/17174366" }, { "database": "PubMed", "id": "17230520", "url": "https://pubmed.ncbi.nlm.nih.gov/17230520" }, { "database": "PubMed", "id": "17241873", "url": "https://pubmed.ncbi.nlm.nih.gov/17241873" }, { "database": "PubMed", "id": "17257432", "url": "https://pubmed.ncbi.nlm.nih.gov/17257432" }, { "database": "PubMed", "id": "17292432", "url": "https://pubmed.ncbi.nlm.nih.gov/17292432" }, { "database": "PubMed", "id": "17297446", "url": "https://pubmed.ncbi.nlm.nih.gov/17297446" }, { "database": "PubMed", "id": "17301063", "url": "https://pubmed.ncbi.nlm.nih.gov/17301063" }, { "database": "PubMed", "id": "17332930", "url": "https://pubmed.ncbi.nlm.nih.gov/17332930" }, { "database": "PubMed", "id": "17334779", "url": "https://pubmed.ncbi.nlm.nih.gov/17334779" }, { "database": "PubMed", "id": "17456577", "url": "https://pubmed.ncbi.nlm.nih.gov/17456577" }, { "database": "PubMed", "id": "17509529", "url": "https://pubmed.ncbi.nlm.nih.gov/17509529" }, { "database": "PubMed", "id": "17510082", "url": "https://pubmed.ncbi.nlm.nih.gov/17510082" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17512204", "url": "https://pubmed.ncbi.nlm.nih.gov/17512204" }, { "database": "PubMed", "id": "17517898", "url": "https://pubmed.ncbi.nlm.nih.gov/17517898" }, { "database": "PubMed", "id": "17524349", "url": "https://pubmed.ncbi.nlm.nih.gov/17524349" }, { "database": "PubMed", "id": "17535811", "url": "https://pubmed.ncbi.nlm.nih.gov/17535811" }, { "database": "PubMed", "id": "17575952", "url": "https://pubmed.ncbi.nlm.nih.gov/17575952" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17596534", "url": "https://pubmed.ncbi.nlm.nih.gov/17596534" }, { "database": "PubMed", "id": "17610031", "url": "https://pubmed.ncbi.nlm.nih.gov/17610031" }, { "database": "PubMed", "id": "17612589", "url": "https://pubmed.ncbi.nlm.nih.gov/17612589" }, { "database": "PubMed", "id": "17616578", "url": "https://pubmed.ncbi.nlm.nih.gov/17616578" }, { "database": "PubMed", "id": "17668048", "url": "https://pubmed.ncbi.nlm.nih.gov/17668048" }, { "database": "PubMed", "id": "17707793", "url": "https://pubmed.ncbi.nlm.nih.gov/17707793" }, { "database": "PubMed", "id": "17712528", "url": "https://pubmed.ncbi.nlm.nih.gov/17712528" }, { "database": "PubMed", "id": "17727682", "url": "https://pubmed.ncbi.nlm.nih.gov/17727682" }, { "database": "PubMed", "id": "17803907", "url": "https://pubmed.ncbi.nlm.nih.gov/17803907" }, { "database": "PubMed", "id": "17854787", "url": "https://pubmed.ncbi.nlm.nih.gov/17854787" }, { "database": "PubMed", "id": "17855337", "url": "https://pubmed.ncbi.nlm.nih.gov/17855337" }, { "database": "PubMed", "id": "17894897", "url": "https://pubmed.ncbi.nlm.nih.gov/17894897" }, { "database": "PubMed", "id": "17903248", "url": "https://pubmed.ncbi.nlm.nih.gov/17903248" }, { "database": "PubMed", "id": "17918180", "url": "https://pubmed.ncbi.nlm.nih.gov/17918180" }, { "database": "PubMed", "id": "17919456", "url": "https://pubmed.ncbi.nlm.nih.gov/17919456" }, { "database": "PubMed", "id": "17932621", "url": "https://pubmed.ncbi.nlm.nih.gov/17932621" }, { "database": "PubMed", "id": "17932951", "url": "https://pubmed.ncbi.nlm.nih.gov/17932951" }, { "database": "PubMed", "id": "17940507", "url": "https://pubmed.ncbi.nlm.nih.gov/17940507" }, { "database": "PubMed", "id": "17967874", "url": "https://pubmed.ncbi.nlm.nih.gov/17967874" }, { "database": "PubMed", "id": "17971768", "url": "https://pubmed.ncbi.nlm.nih.gov/17971768" }, { "database": "PubMed", "id": "17977830", "url": "https://pubmed.ncbi.nlm.nih.gov/17977830" }, { "database": "PubMed", "id": "18032786", "url": "https://pubmed.ncbi.nlm.nih.gov/18032786" }, { "database": "PubMed", "id": "18048073", "url": "https://pubmed.ncbi.nlm.nih.gov/18048073" }, { "database": "PubMed", "id": "18082226", "url": "https://pubmed.ncbi.nlm.nih.gov/18082226" }, { "database": "PubMed", "id": "18085531", "url": "https://pubmed.ncbi.nlm.nih.gov/18085531" }, { "database": "PubMed", "id": "18187512", "url": "https://pubmed.ncbi.nlm.nih.gov/18187512" }, { "database": "PubMed", "id": "18191923", "url": "https://pubmed.ncbi.nlm.nih.gov/18191923" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18272544", "url": "https://pubmed.ncbi.nlm.nih.gov/18272544" }, { "database": "PubMed", "id": "18289623", "url": "https://pubmed.ncbi.nlm.nih.gov/18289623" }, { "database": "PubMed", "id": "18294283", "url": "https://pubmed.ncbi.nlm.nih.gov/18294283" }, { "database": "PubMed", "id": "18311036", "url": "https://pubmed.ncbi.nlm.nih.gov/18311036" }, { "database": "PubMed", "id": "18339864", "url": "https://pubmed.ncbi.nlm.nih.gov/18339864" }, { "database": "PubMed", "id": "18344606", "url": "https://pubmed.ncbi.nlm.nih.gov/18344606" }, { "database": "PubMed", "id": "18348731", "url": "https://pubmed.ncbi.nlm.nih.gov/18348731" }, { "database": "PubMed", "id": "18366759", "url": "https://pubmed.ncbi.nlm.nih.gov/18366759" }, { "database": "PubMed", "id": "18381438", "url": "https://pubmed.ncbi.nlm.nih.gov/18381438" }, { "database": "PubMed", "id": "18406507", "url": "https://pubmed.ncbi.nlm.nih.gov/18406507" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18446786", "url": "https://pubmed.ncbi.nlm.nih.gov/18446786" }, { "database": "PubMed", "id": "18455128", "url": "https://pubmed.ncbi.nlm.nih.gov/18455128" }, { "database": "PubMed", "id": "18479896", "url": "https://pubmed.ncbi.nlm.nih.gov/18479896" }, { "database": "PubMed", "id": "18497347", "url": "https://pubmed.ncbi.nlm.nih.gov/18497347" }, { "database": "PubMed", "id": "18504176", "url": "https://pubmed.ncbi.nlm.nih.gov/18504176" }, { "database": "PubMed", "id": "18511169", "url": "https://pubmed.ncbi.nlm.nih.gov/18511169" }, { "database": "PubMed", "id": "18519674", "url": "https://pubmed.ncbi.nlm.nih.gov/18519674" }, { "database": "PubMed", "id": "18523653", "url": "https://pubmed.ncbi.nlm.nih.gov/18523653" }, { "database": "PubMed", "id": "18540044", "url": "https://pubmed.ncbi.nlm.nih.gov/18540044" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18585854", "url": "https://pubmed.ncbi.nlm.nih.gov/18585854" }, { "database": "PubMed", "id": "18589416", "url": "https://pubmed.ncbi.nlm.nih.gov/18589416" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18604166", "url": "https://pubmed.ncbi.nlm.nih.gov/18604166" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18642443", "url": "https://pubmed.ncbi.nlm.nih.gov/18642443" }, { "database": "PubMed", "id": "18660513", "url": "https://pubmed.ncbi.nlm.nih.gov/18660513" }, { "database": "PubMed", "id": "18661100", "url": "https://pubmed.ncbi.nlm.nih.gov/18661100" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18760266", "url": "https://pubmed.ncbi.nlm.nih.gov/18760266" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "18785202", "url": "https://pubmed.ncbi.nlm.nih.gov/18785202" }, { "database": "PubMed", "id": "18791269", "url": "https://pubmed.ncbi.nlm.nih.gov/18791269" }, { "database": "PubMed", "id": "18802408", "url": "https://pubmed.ncbi.nlm.nih.gov/18802408" }, { "database": "PubMed", "id": "18847491", "url": "https://pubmed.ncbi.nlm.nih.gov/18847491" }, { "database": "PubMed", "id": "18852884", "url": "https://pubmed.ncbi.nlm.nih.gov/18852884" }, { "database": "PubMed", "id": "18947885", "url": "https://pubmed.ncbi.nlm.nih.gov/18947885" }, { "database": "PubMed", "id": "19064630", "url": "https://pubmed.ncbi.nlm.nih.gov/19064630" }, { "database": "PubMed", "id": "19067706", "url": "https://pubmed.ncbi.nlm.nih.gov/19067706" }, { "database": "PubMed", "id": "19095450", "url": "https://pubmed.ncbi.nlm.nih.gov/19095450" }, { "database": "PubMed", "id": "19112505", "url": "https://pubmed.ncbi.nlm.nih.gov/19112505" }, { "database": "PubMed", "id": "19139065", "url": "https://pubmed.ncbi.nlm.nih.gov/19139065" }, { "database": "PubMed", "id": "19148495", "url": "https://pubmed.ncbi.nlm.nih.gov/19148495" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19166313", "url": "https://pubmed.ncbi.nlm.nih.gov/19166313" }, { "database": "PubMed", "id": "19221002", "url": "https://pubmed.ncbi.nlm.nih.gov/19221002" }, { "database": "PubMed", "id": "19225536", "url": "https://pubmed.ncbi.nlm.nih.gov/19225536" }, { "database": "PubMed", "id": "19295133", "url": "https://pubmed.ncbi.nlm.nih.gov/19295133" }, { "database": "PubMed", "id": "19303885", "url": "https://pubmed.ncbi.nlm.nih.gov/19303885" }, { "database": "PubMed", "id": "19357962", "url": "https://pubmed.ncbi.nlm.nih.gov/19357962" }, { "database": "PubMed", "id": "19363523", "url": "https://pubmed.ncbi.nlm.nih.gov/19363523" }, { "database": "PubMed", "id": "19373864", "url": "https://pubmed.ncbi.nlm.nih.gov/19373864" }, { "database": "PubMed", "id": "19397953", "url": "https://pubmed.ncbi.nlm.nih.gov/19397953" }, { "database": "PubMed", "id": "19398950", "url": "https://pubmed.ncbi.nlm.nih.gov/19398950" }, { "database": "PubMed", "id": "19426797", "url": "https://pubmed.ncbi.nlm.nih.gov/19426797" }, { "database": "PubMed", "id": "19454177", "url": "https://pubmed.ncbi.nlm.nih.gov/19454177" }, { "database": "PubMed", "id": "19459175", "url": "https://pubmed.ncbi.nlm.nih.gov/19459175" }, { "database": "PubMed", "id": "19525231", "url": "https://pubmed.ncbi.nlm.nih.gov/19525231" }, { "database": "PubMed", "id": "19536869", "url": "https://pubmed.ncbi.nlm.nih.gov/19536869" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19649319", "url": "https://pubmed.ncbi.nlm.nih.gov/19649319" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19660097", "url": "https://pubmed.ncbi.nlm.nih.gov/19660097" }, { "database": "PubMed", "id": "19674456", "url": "https://pubmed.ncbi.nlm.nih.gov/19674456" }, { "database": "PubMed", "id": "19705844", "url": "https://pubmed.ncbi.nlm.nih.gov/19705844" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19821510", "url": "https://pubmed.ncbi.nlm.nih.gov/19821510" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19934315", "url": "https://pubmed.ncbi.nlm.nih.gov/19934315" }, { "database": "PubMed", "id": "19952118", "url": "https://pubmed.ncbi.nlm.nih.gov/19952118" }, { "database": "PubMed", "id": "19960411", "url": "https://pubmed.ncbi.nlm.nih.gov/19960411" }, { "database": "PubMed", "id": "20005456", "url": "https://pubmed.ncbi.nlm.nih.gov/20005456" }, { "database": "PubMed", "id": "20005840", "url": "https://pubmed.ncbi.nlm.nih.gov/20005840" }, { "database": "PubMed", "id": "20016737", "url": "https://pubmed.ncbi.nlm.nih.gov/20016737" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20060030", "url": "https://pubmed.ncbi.nlm.nih.gov/20060030" }, { "database": "PubMed", "id": "20085646", "url": "https://pubmed.ncbi.nlm.nih.gov/20085646" }, { "database": "PubMed", "id": "20092938", "url": "https://pubmed.ncbi.nlm.nih.gov/20092938" }, { "database": "PubMed", "id": "20097305", "url": "https://pubmed.ncbi.nlm.nih.gov/20097305" }, { "database": "PubMed", "id": "20123963", "url": "https://pubmed.ncbi.nlm.nih.gov/20123963" }, { "database": "PubMed", "id": "20187950", "url": "https://pubmed.ncbi.nlm.nih.gov/20187950" }, { "database": "PubMed", "id": "20219657", "url": "https://pubmed.ncbi.nlm.nih.gov/20219657" }, { "database": "PubMed", "id": "20226587", "url": "https://pubmed.ncbi.nlm.nih.gov/20226587" }, { "database": "PubMed", "id": "20308316", "url": "https://pubmed.ncbi.nlm.nih.gov/20308316" }, { "database": "PubMed", "id": "20353948", "url": "https://pubmed.ncbi.nlm.nih.gov/20353948" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20413215", "url": "https://pubmed.ncbi.nlm.nih.gov/20413215" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20432447", "url": "https://pubmed.ncbi.nlm.nih.gov/20432447" }, { "database": "PubMed", "id": "20456495", "url": "https://pubmed.ncbi.nlm.nih.gov/20456495" }, { "database": "PubMed", "id": "20484174", "url": "https://pubmed.ncbi.nlm.nih.gov/20484174" }, { "database": "PubMed", "id": "20499882", "url": "https://pubmed.ncbi.nlm.nih.gov/20499882" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20543986", "url": "https://pubmed.ncbi.nlm.nih.gov/20543986" }, { "database": "PubMed", "id": "20549306", "url": "https://pubmed.ncbi.nlm.nih.gov/20549306" }, { "database": "PubMed", "id": "20566882", "url": "https://pubmed.ncbi.nlm.nih.gov/20566882" }, { "database": "PubMed", "id": "20622265", "url": "https://pubmed.ncbi.nlm.nih.gov/20622265" }, { "database": "PubMed", "id": "20663147", "url": "https://pubmed.ncbi.nlm.nih.gov/20663147" }, { "database": "PubMed", "id": "20693977", "url": "https://pubmed.ncbi.nlm.nih.gov/20693977" }, { "database": "PubMed", "id": "20708607", "url": "https://pubmed.ncbi.nlm.nih.gov/20708607" }, { "database": "PubMed", "id": "20717878", "url": "https://pubmed.ncbi.nlm.nih.gov/20717878" }, { "database": "PubMed", "id": "20809980", "url": "https://pubmed.ncbi.nlm.nih.gov/20809980" }, { "database": "PubMed", "id": "20840867", "url": "https://pubmed.ncbi.nlm.nih.gov/20840867" }, { "database": "PubMed", "id": "20886098", "url": "https://pubmed.ncbi.nlm.nih.gov/20886098" }, { "database": "PubMed", "id": "20931131", "url": "https://pubmed.ncbi.nlm.nih.gov/20931131" }, { "database": "PubMed", "id": "20948430", "url": "https://pubmed.ncbi.nlm.nih.gov/20948430" }, { "database": "PubMed", "id": "20974518", "url": "https://pubmed.ncbi.nlm.nih.gov/20974518" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "21045015", "url": "https://pubmed.ncbi.nlm.nih.gov/21045015" }, { "database": "PubMed", "id": "21078665", "url": "https://pubmed.ncbi.nlm.nih.gov/21078665" }, { "database": "PubMed", "id": "21114963", "url": "https://pubmed.ncbi.nlm.nih.gov/21114963" }, { "database": "PubMed", "id": "21118815", "url": "https://pubmed.ncbi.nlm.nih.gov/21118815" }, { "database": "PubMed", "id": "21163364", "url": "https://pubmed.ncbi.nlm.nih.gov/21163364" }, { "database": "PubMed", "id": "21167122", "url": "https://pubmed.ncbi.nlm.nih.gov/21167122" }, { "database": "PubMed", "id": "21225623", "url": "https://pubmed.ncbi.nlm.nih.gov/21225623" }, { "database": "PubMed", "id": "21261644", "url": "https://pubmed.ncbi.nlm.nih.gov/21261644" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21361779", "url": "https://pubmed.ncbi.nlm.nih.gov/21361779" }, { "database": "PubMed", "id": "21368894", "url": "https://pubmed.ncbi.nlm.nih.gov/21368894" }, { "database": "PubMed", "id": "21376392", "url": "https://pubmed.ncbi.nlm.nih.gov/21376392" }, { "database": "PubMed", "id": "21383020", "url": "https://pubmed.ncbi.nlm.nih.gov/21383020" }, { "database": "PubMed", "id": "21383696", "url": "https://pubmed.ncbi.nlm.nih.gov/21383696" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21394211", "url": "https://pubmed.ncbi.nlm.nih.gov/21394211" }, { "database": "PubMed", "id": "21432907", "url": "https://pubmed.ncbi.nlm.nih.gov/21432907" }, { "database": "PubMed", "id": "21451571", "url": "https://pubmed.ncbi.nlm.nih.gov/21451571" }, { "database": "PubMed", "id": "21465263", "url": "https://pubmed.ncbi.nlm.nih.gov/21465263" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21532991", "url": "https://pubmed.ncbi.nlm.nih.gov/21532991" }, { "database": "PubMed", "id": "21549095", "url": "https://pubmed.ncbi.nlm.nih.gov/21549095" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21576488", "url": "https://pubmed.ncbi.nlm.nih.gov/21576488" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21653549", "url": "https://pubmed.ncbi.nlm.nih.gov/21653549" }, { "database": "PubMed", "id": "21663643", "url": "https://pubmed.ncbi.nlm.nih.gov/21663643" }, { "database": "PubMed", "id": "21687937", "url": "https://pubmed.ncbi.nlm.nih.gov/21687937" }, { "database": "PubMed", "id": "21725357", "url": "https://pubmed.ncbi.nlm.nih.gov/21725357" }, { "database": "PubMed", "id": "21783897", "url": "https://pubmed.ncbi.nlm.nih.gov/21783897" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21809388", "url": "https://pubmed.ncbi.nlm.nih.gov/21809388" }, { "database": "PubMed", "id": "21840268", "url": "https://pubmed.ncbi.nlm.nih.gov/21840268" }, { "database": "PubMed", "id": "21857991", "url": "https://pubmed.ncbi.nlm.nih.gov/21857991" }, { "database": "PubMed", "id": "21866568", "url": "https://pubmed.ncbi.nlm.nih.gov/21866568" }, { "database": "PubMed", "id": "21887275", "url": "https://pubmed.ncbi.nlm.nih.gov/21887275" }, { "database": "PubMed", "id": "21909130", "url": "https://pubmed.ncbi.nlm.nih.gov/21909130" }, { "database": "PubMed", "id": "21918620", "url": "https://pubmed.ncbi.nlm.nih.gov/21918620" }, { "database": "PubMed", "id": "21945951", "url": "https://pubmed.ncbi.nlm.nih.gov/21945951" }, { "database": "PubMed", "id": "21960246", "url": "https://pubmed.ncbi.nlm.nih.gov/21960246" }, { "database": "PubMed", "id": "21965754", "url": "https://pubmed.ncbi.nlm.nih.gov/21965754" }, { "database": "PubMed", "id": "21983885", "url": "https://pubmed.ncbi.nlm.nih.gov/21983885" }, { "database": "PubMed", "id": "21997969", "url": "https://pubmed.ncbi.nlm.nih.gov/21997969" }, { "database": "PubMed", "id": "22002314", "url": "https://pubmed.ncbi.nlm.nih.gov/22002314" }, { "database": "PubMed", "id": "22030623", "url": "https://pubmed.ncbi.nlm.nih.gov/22030623" }, { "database": "PubMed", "id": "22114676", "url": "https://pubmed.ncbi.nlm.nih.gov/22114676" }, { "database": "PubMed", "id": "22142405", "url": "https://pubmed.ncbi.nlm.nih.gov/22142405" }, { "database": "PubMed", "id": "22174788", "url": "https://pubmed.ncbi.nlm.nih.gov/22174788" }, { "database": "PubMed", "id": "22190353", "url": "https://pubmed.ncbi.nlm.nih.gov/22190353" }, { "database": "PubMed", "id": "22198295", "url": "https://pubmed.ncbi.nlm.nih.gov/22198295" }, { "database": "PubMed", "id": "22266868", "url": "https://pubmed.ncbi.nlm.nih.gov/22266868" }, { "database": "PubMed", "id": "22288499", "url": "https://pubmed.ncbi.nlm.nih.gov/22288499" }, { "database": "PubMed", "id": "22290291", "url": "https://pubmed.ncbi.nlm.nih.gov/22290291" }, { "database": "PubMed", "id": "22312557", "url": "https://pubmed.ncbi.nlm.nih.gov/22312557" }, { "database": "PubMed", "id": "22331558", "url": "https://pubmed.ncbi.nlm.nih.gov/22331558" }, { "database": "PubMed", "id": "22414726", "url": "https://pubmed.ncbi.nlm.nih.gov/22414726" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22435726", "url": "https://pubmed.ncbi.nlm.nih.gov/22435726" }, { "database": "PubMed", "id": "22447336", "url": "https://pubmed.ncbi.nlm.nih.gov/22447336" }, { "database": "PubMed", "id": "22514710", "url": "https://pubmed.ncbi.nlm.nih.gov/22514710" }, { "database": "PubMed", "id": "22523681", "url": "https://pubmed.ncbi.nlm.nih.gov/22523681" }, { "database": "PubMed", "id": "22555805", "url": "https://pubmed.ncbi.nlm.nih.gov/22555805" }, { "database": "PubMed", "id": "22564437", "url": "https://pubmed.ncbi.nlm.nih.gov/22564437" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22622028", "url": "https://pubmed.ncbi.nlm.nih.gov/22622028" }, { "database": "PubMed", "id": "22627294", "url": "https://pubmed.ncbi.nlm.nih.gov/22627294" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22662266", "url": "https://pubmed.ncbi.nlm.nih.gov/22662266" }, { "database": "PubMed", "id": "22722496", "url": "https://pubmed.ncbi.nlm.nih.gov/22722496" }, { "database": "PubMed", "id": "22767080", "url": "https://pubmed.ncbi.nlm.nih.gov/22767080" }, { "database": "PubMed", "id": "22768036", "url": "https://pubmed.ncbi.nlm.nih.gov/22768036" }, { "database": "PubMed", "id": "22797063", "url": "https://pubmed.ncbi.nlm.nih.gov/22797063" }, { "database": "PubMed", "id": "22807682", "url": "https://pubmed.ncbi.nlm.nih.gov/22807682" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22848370", "url": "https://pubmed.ncbi.nlm.nih.gov/22848370" }, { "database": "PubMed", "id": "22859938", "url": "https://pubmed.ncbi.nlm.nih.gov/22859938" }, { "database": "PubMed", "id": "22888789", "url": "https://pubmed.ncbi.nlm.nih.gov/22888789" }, { "database": "PubMed", "id": "22911714", "url": "https://pubmed.ncbi.nlm.nih.gov/22911714" }, { "database": "PubMed", "id": "22947118", "url": "https://pubmed.ncbi.nlm.nih.gov/22947118" }, { "database": "PubMed", "id": "22954457", "url": "https://pubmed.ncbi.nlm.nih.gov/22954457" }, { "database": "PubMed", "id": "22962590", "url": "https://pubmed.ncbi.nlm.nih.gov/22962590" }, { "database": "PubMed", "id": "22983795", "url": "https://pubmed.ncbi.nlm.nih.gov/22983795" }, { "database": "PubMed", "id": "22996738", "url": "https://pubmed.ncbi.nlm.nih.gov/22996738" }, { "database": "PubMed", "id": "23027622", "url": "https://pubmed.ncbi.nlm.nih.gov/23027622" }, { "database": "PubMed", "id": "23028738", "url": "https://pubmed.ncbi.nlm.nih.gov/23028738" }, { "database": "PubMed", "id": "23034333", "url": "https://pubmed.ncbi.nlm.nih.gov/23034333" }, { "database": "PubMed", "id": "23050037", "url": "https://pubmed.ncbi.nlm.nih.gov/23050037" }, { "database": "PubMed", "id": "23091651", "url": "https://pubmed.ncbi.nlm.nih.gov/23091651" }, { "database": "PubMed", "id": "23108402", "url": "https://pubmed.ncbi.nlm.nih.gov/23108402" }, { "database": "PubMed", "id": "23124353", "url": "https://pubmed.ncbi.nlm.nih.gov/23124353" }, { "database": "PubMed", "id": "23128467", "url": "https://pubmed.ncbi.nlm.nih.gov/23128467" }, { "database": "PubMed", "id": "23139272", "url": "https://pubmed.ncbi.nlm.nih.gov/23139272" }, { "database": "PubMed", "id": "23194110", "url": "https://pubmed.ncbi.nlm.nih.gov/23194110" }, { "database": "PubMed", "id": "23238993", "url": "https://pubmed.ncbi.nlm.nih.gov/23238993" }, { "database": "PubMed", "id": "23263852", "url": "https://pubmed.ncbi.nlm.nih.gov/23263852" }, { "database": "PubMed", "id": "23300887", "url": "https://pubmed.ncbi.nlm.nih.gov/23300887" }, { "database": "PubMed", "id": "23318437", "url": "https://pubmed.ncbi.nlm.nih.gov/23318437" }, { "database": "PubMed", "id": "23319600", "url": "https://pubmed.ncbi.nlm.nih.gov/23319600" }, { "database": "PubMed", "id": "23340843", "url": "https://pubmed.ncbi.nlm.nih.gov/23340843" }, { "database": "PubMed", "id": "23342042", "url": "https://pubmed.ncbi.nlm.nih.gov/23342042" }, { "database": "PubMed", "id": "23351152", "url": "https://pubmed.ncbi.nlm.nih.gov/23351152" }, { "database": "PubMed", "id": "23359208", "url": "https://pubmed.ncbi.nlm.nih.gov/23359208" }, { "database": "PubMed", "id": "23425510", "url": "https://pubmed.ncbi.nlm.nih.gov/23425510" }, { "database": "PubMed", "id": "23434831", "url": "https://pubmed.ncbi.nlm.nih.gov/23434831" }, { "database": "PubMed", "id": "23451179", "url": "https://pubmed.ncbi.nlm.nih.gov/23451179" }, { "database": "PubMed", "id": "23483203", "url": "https://pubmed.ncbi.nlm.nih.gov/23483203" }, { "database": "PubMed", "id": "23495037", "url": "https://pubmed.ncbi.nlm.nih.gov/23495037" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23555949", "url": "https://pubmed.ncbi.nlm.nih.gov/23555949" }, { "database": "PubMed", "id": "23557329", "url": "https://pubmed.ncbi.nlm.nih.gov/23557329" }, { "database": "PubMed", "id": "23566959", "url": "https://pubmed.ncbi.nlm.nih.gov/23566959" }, { "database": "PubMed", "id": "23589839", "url": "https://pubmed.ncbi.nlm.nih.gov/23589839" }, { "database": "PubMed", "id": "23599430", "url": "https://pubmed.ncbi.nlm.nih.gov/23599430" }, { "database": "PubMed", "id": "23610071", "url": "https://pubmed.ncbi.nlm.nih.gov/23610071" }, { "database": "PubMed", "id": "23612976", "url": "https://pubmed.ncbi.nlm.nih.gov/23612976" }, { "database": "PubMed", "id": "23618908", "url": "https://pubmed.ncbi.nlm.nih.gov/23618908" }, { "database": "PubMed", "id": "23640457", "url": "https://pubmed.ncbi.nlm.nih.gov/23640457" }, { "database": "PubMed", "id": "23646139", "url": "https://pubmed.ncbi.nlm.nih.gov/23646139" }, { "database": "PubMed", "id": "23652278", "url": "https://pubmed.ncbi.nlm.nih.gov/23652278" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23666755", "url": "https://pubmed.ncbi.nlm.nih.gov/23666755" }, { "database": "PubMed", "id": "23676219", "url": "https://pubmed.ncbi.nlm.nih.gov/23676219" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23737838", "url": "https://pubmed.ncbi.nlm.nih.gov/23737838" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23759592", "url": "https://pubmed.ncbi.nlm.nih.gov/23759592" }, { "database": "PubMed", "id": "23785417", "url": "https://pubmed.ncbi.nlm.nih.gov/23785417" }, { "database": "PubMed", "id": "23800953", "url": "https://pubmed.ncbi.nlm.nih.gov/23800953" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23852422", "url": "https://pubmed.ncbi.nlm.nih.gov/23852422" }, { "database": "PubMed", "id": "23874235", "url": "https://pubmed.ncbi.nlm.nih.gov/23874235" }, { "database": "PubMed", "id": "23883471", "url": "https://pubmed.ncbi.nlm.nih.gov/23883471" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "23915323", "url": "https://pubmed.ncbi.nlm.nih.gov/23915323" }, { "database": "PubMed", "id": "23949216", "url": "https://pubmed.ncbi.nlm.nih.gov/23949216" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24024154", "url": "https://pubmed.ncbi.nlm.nih.gov/24024154" }, { "database": "PubMed", "id": "24037342", "url": "https://pubmed.ncbi.nlm.nih.gov/24037342" }, { "database": "PubMed", "id": "24040083", "url": "https://pubmed.ncbi.nlm.nih.gov/24040083" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24086708", "url": "https://pubmed.ncbi.nlm.nih.gov/24086708" }, { "database": "PubMed", "id": "24089038", "url": "https://pubmed.ncbi.nlm.nih.gov/24089038" }, { "database": "PubMed", "id": "24096875", "url": "https://pubmed.ncbi.nlm.nih.gov/24096875" }, { "database": "PubMed", "id": "24129246", "url": "https://pubmed.ncbi.nlm.nih.gov/24129246" }, { "database": "PubMed", "id": "24156017", "url": "https://pubmed.ncbi.nlm.nih.gov/24156017" }, { "database": "PubMed", "id": "24157877", "url": "https://pubmed.ncbi.nlm.nih.gov/24157877" }, { "database": "PubMed", "id": "24194914", "url": "https://pubmed.ncbi.nlm.nih.gov/24194914" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24205157", "url": "https://pubmed.ncbi.nlm.nih.gov/24205157" }, { "database": "PubMed", "id": "24223226", "url": "https://pubmed.ncbi.nlm.nih.gov/24223226" }, { "database": "PubMed", "id": "24244715", "url": "https://pubmed.ncbi.nlm.nih.gov/24244715" }, { "database": "PubMed", "id": "24248600", "url": "https://pubmed.ncbi.nlm.nih.gov/24248600" }, { "database": "PubMed", "id": "24264057", "url": "https://pubmed.ncbi.nlm.nih.gov/24264057" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24313628", "url": "https://pubmed.ncbi.nlm.nih.gov/24313628" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24379680", "url": "https://pubmed.ncbi.nlm.nih.gov/24379680" }, { "database": "PubMed", "id": "24380814", "url": "https://pubmed.ncbi.nlm.nih.gov/24380814" }, { "database": "PubMed", "id": "24391984", "url": "https://pubmed.ncbi.nlm.nih.gov/24391984" }, { "database": "PubMed", "id": "24403123", "url": "https://pubmed.ncbi.nlm.nih.gov/24403123" }, { "database": "PubMed", "id": "24413150", "url": "https://pubmed.ncbi.nlm.nih.gov/24413150" }, { "database": "PubMed", "id": "24445528", "url": "https://pubmed.ncbi.nlm.nih.gov/24445528" }, { "database": "PubMed", "id": "24447148", "url": "https://pubmed.ncbi.nlm.nih.gov/24447148" }, { "database": "PubMed", "id": "24456610", "url": "https://pubmed.ncbi.nlm.nih.gov/24456610" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24480460", "url": "https://pubmed.ncbi.nlm.nih.gov/24480460" }, { "database": "PubMed", "id": "24553354", "url": "https://pubmed.ncbi.nlm.nih.gov/24553354" }, { "database": "PubMed", "id": "24555657", "url": "https://pubmed.ncbi.nlm.nih.gov/24555657" }, { "database": "PubMed", "id": "24556689", "url": "https://pubmed.ncbi.nlm.nih.gov/24556689" }, { "database": "PubMed", "id": "24587255", "url": "https://pubmed.ncbi.nlm.nih.gov/24587255" }, { "database": "PubMed", "id": "24603648", "url": "https://pubmed.ncbi.nlm.nih.gov/24603648" }, { "database": "PubMed", "id": "24608431", "url": "https://pubmed.ncbi.nlm.nih.gov/24608431" }, { "database": "PubMed", "id": "24613410", "url": "https://pubmed.ncbi.nlm.nih.gov/24613410" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24657168", "url": "https://pubmed.ncbi.nlm.nih.gov/24657168" }, { "database": "PubMed", "id": "24682933", "url": "https://pubmed.ncbi.nlm.nih.gov/24682933" }, { "database": "PubMed", "id": "24691657", "url": "https://pubmed.ncbi.nlm.nih.gov/24691657" }, { "database": "PubMed", "id": "24717393", "url": "https://pubmed.ncbi.nlm.nih.gov/24717393" }, { "database": "PubMed", "id": "24722580", "url": "https://pubmed.ncbi.nlm.nih.gov/24722580" }, { "database": "PubMed", "id": "24759730", "url": "https://pubmed.ncbi.nlm.nih.gov/24759730" }, { "database": "PubMed", "id": "24796485", "url": "https://pubmed.ncbi.nlm.nih.gov/24796485" }, { "database": "PubMed", "id": "24797517", "url": "https://pubmed.ncbi.nlm.nih.gov/24797517" }, { "database": "PubMed", "id": "24801380", "url": "https://pubmed.ncbi.nlm.nih.gov/24801380" }, { "database": "PubMed", "id": "24810057", "url": "https://pubmed.ncbi.nlm.nih.gov/24810057" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24867336", "url": "https://pubmed.ncbi.nlm.nih.gov/24867336" }, { "database": "PubMed", "id": "24885082", "url": "https://pubmed.ncbi.nlm.nih.gov/24885082" }, { "database": "PubMed", "id": "24886358", "url": "https://pubmed.ncbi.nlm.nih.gov/24886358" }, { "database": "PubMed", "id": "24905183", "url": "https://pubmed.ncbi.nlm.nih.gov/24905183" }, { "database": "PubMed", "id": "24926985", "url": "https://pubmed.ncbi.nlm.nih.gov/24926985" }, { "database": "PubMed", "id": "24928858", "url": "https://pubmed.ncbi.nlm.nih.gov/24928858" }, { "database": "PubMed", "id": "24932684", "url": "https://pubmed.ncbi.nlm.nih.gov/24932684" }, { "database": "PubMed", "id": "24934860", "url": "https://pubmed.ncbi.nlm.nih.gov/24934860" }, { "database": "PubMed", "id": "24956278", "url": "https://pubmed.ncbi.nlm.nih.gov/24956278" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "24971451", "url": "https://pubmed.ncbi.nlm.nih.gov/24971451" }, { "database": "PubMed", "id": "25051404", "url": "https://pubmed.ncbi.nlm.nih.gov/25051404" }, { "database": "PubMed", "id": "25078064", "url": "https://pubmed.ncbi.nlm.nih.gov/25078064" }, { "database": "PubMed", "id": "25112877", "url": "https://pubmed.ncbi.nlm.nih.gov/25112877" }, { "database": "PubMed", "id": "25143403", "url": "https://pubmed.ncbi.nlm.nih.gov/25143403" }, { "database": "PubMed", "id": "25198662", "url": "https://pubmed.ncbi.nlm.nih.gov/25198662" }, { "database": "PubMed", "id": "25221641", "url": "https://pubmed.ncbi.nlm.nih.gov/25221641" }, { "database": "PubMed", "id": "25227113", "url": "https://pubmed.ncbi.nlm.nih.gov/25227113" }, { "database": "PubMed", "id": "25275589", "url": "https://pubmed.ncbi.nlm.nih.gov/25275589" }, { "database": "PubMed", "id": "25277183", "url": "https://pubmed.ncbi.nlm.nih.gov/25277183" }, { "database": "PubMed", "id": "25277184", "url": "https://pubmed.ncbi.nlm.nih.gov/25277184" }, { "database": "PubMed", "id": "25294809", "url": "https://pubmed.ncbi.nlm.nih.gov/25294809" }, { "database": "PubMed", "id": "25311384", "url": "https://pubmed.ncbi.nlm.nih.gov/25311384" }, { "database": "PubMed", "id": "25319447", "url": "https://pubmed.ncbi.nlm.nih.gov/25319447" }, { "database": "PubMed", "id": "25331851", "url": "https://pubmed.ncbi.nlm.nih.gov/25331851" }, { "database": "PubMed", "id": "25341038", "url": "https://pubmed.ncbi.nlm.nih.gov/25341038" }, { "database": "PubMed", "id": "25372714", "url": "https://pubmed.ncbi.nlm.nih.gov/25372714" }, { "database": "PubMed", "id": "25412311", "url": "https://pubmed.ncbi.nlm.nih.gov/25412311" }, { "database": "PubMed", "id": "25486198", "url": "https://pubmed.ncbi.nlm.nih.gov/25486198" }, { "database": "PubMed", "id": "25489053", "url": "https://pubmed.ncbi.nlm.nih.gov/25489053" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25524025", "url": "https://pubmed.ncbi.nlm.nih.gov/25524025" }, { "database": "PubMed", "id": "25603347", "url": "https://pubmed.ncbi.nlm.nih.gov/25603347" }, { "database": "PubMed", "id": "25605022", "url": "https://pubmed.ncbi.nlm.nih.gov/25605022" }, { "database": "PubMed", "id": "25617667", "url": "https://pubmed.ncbi.nlm.nih.gov/25617667" }, { "database": "PubMed", "id": "25637534", "url": "https://pubmed.ncbi.nlm.nih.gov/25637534" }, { "database": "PubMed", "id": "25639717", "url": "https://pubmed.ncbi.nlm.nih.gov/25639717" }, { "database": "PubMed", "id": "25650067", "url": "https://pubmed.ncbi.nlm.nih.gov/25650067" }, { "database": "PubMed", "id": "25658463", "url": "https://pubmed.ncbi.nlm.nih.gov/25658463" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25674209", "url": "https://pubmed.ncbi.nlm.nih.gov/25674209" }, { "database": "PubMed", "id": "25742468", "url": "https://pubmed.ncbi.nlm.nih.gov/25742468" }, { "database": "PubMed", "id": "25761368", "url": "https://pubmed.ncbi.nlm.nih.gov/25761368" }, { "database": "PubMed", "id": "25769181", "url": "https://pubmed.ncbi.nlm.nih.gov/25769181" }, { "database": "PubMed", "id": "25807079", "url": "https://pubmed.ncbi.nlm.nih.gov/25807079" }, { "database": "PubMed", "id": "25840449", "url": "https://pubmed.ncbi.nlm.nih.gov/25840449" }, { "database": "PubMed", "id": "25852310", "url": "https://pubmed.ncbi.nlm.nih.gov/25852310" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "25867071", "url": "https://pubmed.ncbi.nlm.nih.gov/25867071" }, { "database": "PubMed", "id": "25883152", "url": "https://pubmed.ncbi.nlm.nih.gov/25883152" }, { "database": "PubMed", "id": "25888625", "url": "https://pubmed.ncbi.nlm.nih.gov/25888625" }, { "database": "PubMed", "id": "25916852", "url": "https://pubmed.ncbi.nlm.nih.gov/25916852" }, { "database": "PubMed", "id": "25929783", "url": "https://pubmed.ncbi.nlm.nih.gov/25929783" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "25980443", "url": "https://pubmed.ncbi.nlm.nih.gov/25980443" }, { "database": "PubMed", "id": "25993660", "url": "https://pubmed.ncbi.nlm.nih.gov/25993660" }, { "database": "PubMed", "id": "26006237", "url": "https://pubmed.ncbi.nlm.nih.gov/26006237" }, { "database": "PubMed", "id": "26024660", "url": "https://pubmed.ncbi.nlm.nih.gov/26024660" }, { "database": "PubMed", "id": "26041883", "url": "https://pubmed.ncbi.nlm.nih.gov/26041883" }, { "database": "PubMed", "id": "26042776", "url": "https://pubmed.ncbi.nlm.nih.gov/26042776" }, { "database": "PubMed", "id": "26059686", "url": "https://pubmed.ncbi.nlm.nih.gov/26059686" }, { "database": "PubMed", "id": "26062651", "url": "https://pubmed.ncbi.nlm.nih.gov/26062651" }, { "database": "PubMed", "id": "26070322", "url": "https://pubmed.ncbi.nlm.nih.gov/26070322" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26095524", "url": "https://pubmed.ncbi.nlm.nih.gov/26095524" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26113041", "url": "https://pubmed.ncbi.nlm.nih.gov/26113041" }, { "database": "PubMed", "id": "26138448", "url": "https://pubmed.ncbi.nlm.nih.gov/26138448" }, { "database": "PubMed", "id": "26144554", "url": "https://pubmed.ncbi.nlm.nih.gov/26144554" }, { "database": "PubMed", "id": "26181367", "url": "https://pubmed.ncbi.nlm.nih.gov/26181367" }, { "database": "PubMed", "id": "26193055", "url": "https://pubmed.ncbi.nlm.nih.gov/26193055" }, { "database": "PubMed", "id": "26230405", "url": "https://pubmed.ncbi.nlm.nih.gov/26230405" }, { "database": "PubMed", "id": "26231043", "url": "https://pubmed.ncbi.nlm.nih.gov/26231043" }, { "database": "PubMed", "id": "26244501", "url": "https://pubmed.ncbi.nlm.nih.gov/26244501" }, { "database": "PubMed", "id": "26261212", "url": "https://pubmed.ncbi.nlm.nih.gov/26261212" }, { "database": "PubMed", "id": "26297485", "url": "https://pubmed.ncbi.nlm.nih.gov/26297485" }, { "database": "PubMed", "id": "26327815", "url": "https://pubmed.ncbi.nlm.nih.gov/26327815" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26387611", "url": "https://pubmed.ncbi.nlm.nih.gov/26387611" }, { "database": "PubMed", "id": "26391003", "url": "https://pubmed.ncbi.nlm.nih.gov/26391003" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26408200", "url": "https://pubmed.ncbi.nlm.nih.gov/26408200" }, { "database": "PubMed", "id": "26415230", "url": "https://pubmed.ncbi.nlm.nih.gov/26415230" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26456774", "url": "https://pubmed.ncbi.nlm.nih.gov/26456774" }, { "database": "PubMed", "id": "26459859", "url": "https://pubmed.ncbi.nlm.nih.gov/26459859" }, { "database": "PubMed", "id": "26471002", "url": "https://pubmed.ncbi.nlm.nih.gov/26471002" }, { "database": "PubMed", "id": "26485768", "url": "https://pubmed.ncbi.nlm.nih.gov/26485768" }, { "database": "PubMed", "id": "26510776", "url": "https://pubmed.ncbi.nlm.nih.gov/26510776" }, { "database": "PubMed", "id": "26522181", "url": "https://pubmed.ncbi.nlm.nih.gov/26522181" }, { "database": "PubMed", "id": "26540344", "url": "https://pubmed.ncbi.nlm.nih.gov/26540344" }, { "database": "PubMed", "id": "26571493", "url": "https://pubmed.ncbi.nlm.nih.gov/26571493" }, { "database": "PubMed", "id": "26598601", "url": "https://pubmed.ncbi.nlm.nih.gov/26598601" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26687066", "url": "https://pubmed.ncbi.nlm.nih.gov/26687066" }, { "database": "PubMed", "id": "26699757", "url": "https://pubmed.ncbi.nlm.nih.gov/26699757" }, { "database": "PubMed", "id": "26714930", "url": "https://pubmed.ncbi.nlm.nih.gov/26714930" }, { "database": "PubMed", "id": "26716417", "url": "https://pubmed.ncbi.nlm.nih.gov/26716417" }, { "database": "PubMed", "id": "26734838", "url": "https://pubmed.ncbi.nlm.nih.gov/26734838" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26832796", "url": "https://pubmed.ncbi.nlm.nih.gov/26832796" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "26876197", "url": "https://pubmed.ncbi.nlm.nih.gov/26876197" }, { "database": "PubMed", "id": "26883108", "url": "https://pubmed.ncbi.nlm.nih.gov/26883108" }, { "database": "PubMed", "id": "26909609", "url": "https://pubmed.ncbi.nlm.nih.gov/26909609" }, { "database": "PubMed", "id": "26928575", "url": "https://pubmed.ncbi.nlm.nih.gov/26928575" }, { "database": "PubMed", "id": "26967060", "url": "https://pubmed.ncbi.nlm.nih.gov/26967060" }, { "database": "PubMed", "id": "26974310", "url": "https://pubmed.ncbi.nlm.nih.gov/26974310" }, { "database": "PubMed", "id": "26982737", "url": "https://pubmed.ncbi.nlm.nih.gov/26982737" }, { "database": "PubMed", "id": "26984736", "url": "https://pubmed.ncbi.nlm.nih.gov/26984736" }, { "database": "PubMed", "id": "26988910", "url": "https://pubmed.ncbi.nlm.nih.gov/26988910" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "27031960", "url": "https://pubmed.ncbi.nlm.nih.gov/27031960" }, { "database": "PubMed", "id": "27054339", "url": "https://pubmed.ncbi.nlm.nih.gov/27054339" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27119009", "url": "https://pubmed.ncbi.nlm.nih.gov/27119009" }, { "database": "PubMed", "id": "27127932", "url": "https://pubmed.ncbi.nlm.nih.gov/27127932" }, { "database": "PubMed", "id": "27176768", "url": "https://pubmed.ncbi.nlm.nih.gov/27176768" }, { "database": "PubMed", "id": "27183917", "url": "https://pubmed.ncbi.nlm.nih.gov/27183917" }, { "database": "PubMed", "id": "27195669", "url": "https://pubmed.ncbi.nlm.nih.gov/27195669" }, { "database": "PubMed", "id": "27221050", "url": "https://pubmed.ncbi.nlm.nih.gov/27221050" }, { "database": "PubMed", "id": "27223263", "url": "https://pubmed.ncbi.nlm.nih.gov/27223263" }, { "database": "PubMed", "id": "27270209", "url": "https://pubmed.ncbi.nlm.nih.gov/27270209" }, { "database": "PubMed", "id": "27270636", "url": "https://pubmed.ncbi.nlm.nih.gov/27270636" }, { "database": "PubMed", "id": "27283986", "url": "https://pubmed.ncbi.nlm.nih.gov/27283986" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27314341", "url": "https://pubmed.ncbi.nlm.nih.gov/27314341" }, { "database": "PubMed", "id": "27323823", "url": "https://pubmed.ncbi.nlm.nih.gov/27323823" }, { "database": "PubMed", "id": "27344169", "url": "https://pubmed.ncbi.nlm.nih.gov/27344169" }, { "database": "PubMed", "id": "27346849", "url": "https://pubmed.ncbi.nlm.nih.gov/27346849" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27399772", "url": "https://pubmed.ncbi.nlm.nih.gov/27399772" }, { "database": "PubMed", "id": "27402273", "url": "https://pubmed.ncbi.nlm.nih.gov/27402273" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27511909", "url": "https://pubmed.ncbi.nlm.nih.gov/27511909" }, { "database": "PubMed", "id": "27517620", "url": "https://pubmed.ncbi.nlm.nih.gov/27517620" }, { "database": "PubMed", "id": "27542238", "url": "https://pubmed.ncbi.nlm.nih.gov/27542238" }, { "database": "PubMed", "id": "27545311", "url": "https://pubmed.ncbi.nlm.nih.gov/27545311" }, { "database": "PubMed", "id": "27551445", "url": "https://pubmed.ncbi.nlm.nih.gov/27551445" }, { "database": "PubMed", "id": "27556362", "url": "https://pubmed.ncbi.nlm.nih.gov/27556362" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27611229", "url": "https://pubmed.ncbi.nlm.nih.gov/27611229" }, { "database": "PubMed", "id": "27626308", "url": "https://pubmed.ncbi.nlm.nih.gov/27626308" }, { "database": "PubMed", "id": "27644130", "url": "https://pubmed.ncbi.nlm.nih.gov/27644130" }, { "database": "PubMed", "id": "27656146", "url": "https://pubmed.ncbi.nlm.nih.gov/27656146" }, { "database": "PubMed", "id": "27659536", "url": "https://pubmed.ncbi.nlm.nih.gov/27659536" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "27721412", "url": "https://pubmed.ncbi.nlm.nih.gov/27721412" }, { "database": "PubMed", "id": "27742673", "url": "https://pubmed.ncbi.nlm.nih.gov/27742673" }, { "database": "PubMed", "id": "27763560", "url": "https://pubmed.ncbi.nlm.nih.gov/27763560" }, { "database": "PubMed", "id": "27769050", "url": "https://pubmed.ncbi.nlm.nih.gov/27769050" }, { "database": "PubMed", "id": "27810895", "url": "https://pubmed.ncbi.nlm.nih.gov/27810895" }, { "database": "PubMed", "id": "27863490", "url": "https://pubmed.ncbi.nlm.nih.gov/27863490" }, { "database": "PubMed", "id": "27902328", "url": "https://pubmed.ncbi.nlm.nih.gov/27902328" }, { "database": "PubMed", "id": "27906186", "url": "https://pubmed.ncbi.nlm.nih.gov/27906186" }, { "database": "PubMed", "id": "27991505", "url": "https://pubmed.ncbi.nlm.nih.gov/27991505" }, { "database": "PubMed", "id": "28031409", "url": "https://pubmed.ncbi.nlm.nih.gov/28031409" }, { "database": "PubMed", "id": "28038466", "url": "https://pubmed.ncbi.nlm.nih.gov/28038466" }, { "database": "PubMed", "id": "28102346", "url": "https://pubmed.ncbi.nlm.nih.gov/28102346" }, { "database": "PubMed", "id": "28118604", "url": "https://pubmed.ncbi.nlm.nih.gov/28118604" }, { "database": "PubMed", "id": "28131798", "url": "https://pubmed.ncbi.nlm.nih.gov/28131798" }, { "database": "PubMed", "id": "28177473", "url": "https://pubmed.ncbi.nlm.nih.gov/28177473" }, { "database": "PubMed", "id": "28182004", "url": "https://pubmed.ncbi.nlm.nih.gov/28182004" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28187444", "url": "https://pubmed.ncbi.nlm.nih.gov/28187444" }, { "database": "PubMed", "id": "28208611", "url": "https://pubmed.ncbi.nlm.nih.gov/28208611" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28259974", "url": "https://pubmed.ncbi.nlm.nih.gov/28259974" }, { "database": "PubMed", "id": "28284059", "url": "https://pubmed.ncbi.nlm.nih.gov/28284059" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28369097", "url": "https://pubmed.ncbi.nlm.nih.gov/28369097" }, { "database": "PubMed", "id": "28381880", "url": "https://pubmed.ncbi.nlm.nih.gov/28381880" }, { "database": "PubMed", "id": "28455491", "url": "https://pubmed.ncbi.nlm.nih.gov/28455491" }, { "database": "PubMed", "id": "28466226", "url": "https://pubmed.ncbi.nlm.nih.gov/28466226" }, { "database": "PubMed", "id": "28468838", "url": "https://pubmed.ncbi.nlm.nih.gov/28468838" }, { "database": "PubMed", "id": "28475405", "url": "https://pubmed.ncbi.nlm.nih.gov/28475405" }, { "database": "PubMed", "id": "28535155", "url": "https://pubmed.ncbi.nlm.nih.gov/28535155" }, { "database": "PubMed", "id": "28605833", "url": "https://pubmed.ncbi.nlm.nih.gov/28605833" }, { "database": "PubMed", "id": "28656213", "url": "https://pubmed.ncbi.nlm.nih.gov/28656213" }, { "database": "PubMed", "id": "28667090", "url": "https://pubmed.ncbi.nlm.nih.gov/28667090" }, { "database": "PubMed", "id": "28714848", "url": "https://pubmed.ncbi.nlm.nih.gov/28714848" }, { "database": "PubMed", "id": "28715492", "url": "https://pubmed.ncbi.nlm.nih.gov/28715492" }, { "database": "PubMed", "id": "28726723", "url": "https://pubmed.ncbi.nlm.nih.gov/28726723" }, { "database": "PubMed", "id": "28759712", "url": "https://pubmed.ncbi.nlm.nih.gov/28759712" }, { "database": "PubMed", "id": "28790359", "url": "https://pubmed.ncbi.nlm.nih.gov/28790359" }, { "database": "PubMed", "id": "28794470", "url": "https://pubmed.ncbi.nlm.nih.gov/28794470" }, { "database": "PubMed", "id": "28797070", "url": "https://pubmed.ncbi.nlm.nih.gov/28797070" }, { "database": "PubMed", "id": "28801242", "url": "https://pubmed.ncbi.nlm.nih.gov/28801242" }, { "database": "PubMed", "id": "28837154", "url": "https://pubmed.ncbi.nlm.nih.gov/28837154" }, { "database": "PubMed", "id": "28842590", "url": "https://pubmed.ncbi.nlm.nih.gov/28842590" }, { "database": "PubMed", "id": "28843398", "url": "https://pubmed.ncbi.nlm.nih.gov/28843398" }, { "database": "PubMed", "id": "28888100", "url": "https://pubmed.ncbi.nlm.nih.gov/28888100" }, { "database": "PubMed", "id": "28904350", "url": "https://pubmed.ncbi.nlm.nih.gov/28904350" }, { "database": "PubMed", "id": "28915553", "url": "https://pubmed.ncbi.nlm.nih.gov/28915553" }, { "database": "PubMed", "id": "28915564", "url": "https://pubmed.ncbi.nlm.nih.gov/28915564" }, { "database": "PubMed", "id": "28926586", "url": "https://pubmed.ncbi.nlm.nih.gov/28926586" }, { "database": "PubMed", "id": "28930974", "url": "https://pubmed.ncbi.nlm.nih.gov/28930974" }, { "database": "PubMed", "id": "28968425", "url": "https://pubmed.ncbi.nlm.nih.gov/28968425" }, { "database": "PubMed", "id": "28971953", "url": "https://pubmed.ncbi.nlm.nih.gov/28971953" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "28973015", "url": "https://pubmed.ncbi.nlm.nih.gov/28973015" }, { "database": "PubMed", "id": "28979163", "url": "https://pubmed.ncbi.nlm.nih.gov/28979163" }, { "database": "PubMed", "id": "28981110", "url": "https://pubmed.ncbi.nlm.nih.gov/28981110" }, { "database": "PubMed", "id": "28985345", "url": "https://pubmed.ncbi.nlm.nih.gov/28985345" }, { "database": "PubMed", "id": "28993697", "url": "https://pubmed.ncbi.nlm.nih.gov/28993697" }, { "database": "PubMed", "id": "29030986", "url": "https://pubmed.ncbi.nlm.nih.gov/29030986" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29069457", "url": "https://pubmed.ncbi.nlm.nih.gov/29069457" }, { "database": "PubMed", "id": "29081404", "url": "https://pubmed.ncbi.nlm.nih.gov/29081404" }, { "database": "PubMed", "id": "29096294", "url": "https://pubmed.ncbi.nlm.nih.gov/29096294" }, { "database": "PubMed", "id": "29127423", "url": "https://pubmed.ncbi.nlm.nih.gov/29127423" }, { "database": "PubMed", "id": "29133857", "url": "https://pubmed.ncbi.nlm.nih.gov/29133857" }, { "database": "PubMed", "id": "29156743", "url": "https://pubmed.ncbi.nlm.nih.gov/29156743" }, { "database": "PubMed", "id": "29170254", "url": "https://pubmed.ncbi.nlm.nih.gov/29170254" }, { "database": "PubMed", "id": "29170437", "url": "https://pubmed.ncbi.nlm.nih.gov/29170437" }, { "database": "PubMed", "id": "29212215", "url": "https://pubmed.ncbi.nlm.nih.gov/29212215" }, { "database": "PubMed", "id": "29213352", "url": "https://pubmed.ncbi.nlm.nih.gov/29213352" }, { "database": "PubMed", "id": "29221109", "url": "https://pubmed.ncbi.nlm.nih.gov/29221109" }, { "database": "PubMed", "id": "29233996", "url": "https://pubmed.ncbi.nlm.nih.gov/29233996" }, { "database": "PubMed", "id": "29235570", "url": "https://pubmed.ncbi.nlm.nih.gov/29235570" }, { "database": "PubMed", "id": "29242151", "url": "https://pubmed.ncbi.nlm.nih.gov/29242151" }, { "database": "PubMed", "id": "29262653", "url": "https://pubmed.ncbi.nlm.nih.gov/29262653" }, { "database": "PubMed", "id": "29282022", "url": "https://pubmed.ncbi.nlm.nih.gov/29282022" }, { "database": "PubMed", "id": "29298131", "url": "https://pubmed.ncbi.nlm.nih.gov/29298131" }, { "database": "PubMed", "id": "29311824", "url": "https://pubmed.ncbi.nlm.nih.gov/29311824" }, { "database": "PubMed", "id": "29317830", "url": "https://pubmed.ncbi.nlm.nih.gov/29317830" }, { "database": "PubMed", "id": "29368980", "url": "https://pubmed.ncbi.nlm.nih.gov/29368980" }, { "database": "PubMed", "id": "29383186", "url": "https://pubmed.ncbi.nlm.nih.gov/29383186" }, { "database": "PubMed", "id": "29391428", "url": "https://pubmed.ncbi.nlm.nih.gov/29391428" }, { "database": "PubMed", "id": "29444163", "url": "https://pubmed.ncbi.nlm.nih.gov/29444163" }, { "database": "PubMed", "id": "29445107", "url": "https://pubmed.ncbi.nlm.nih.gov/29445107" }, { "database": "PubMed", "id": "29467390", "url": "https://pubmed.ncbi.nlm.nih.gov/29467390" }, { "database": "PubMed", "id": "29555944", "url": "https://pubmed.ncbi.nlm.nih.gov/29555944" }, { "database": "PubMed", "id": "29568955", "url": "https://pubmed.ncbi.nlm.nih.gov/29568955" }, { "database": "PubMed", "id": "29622681", "url": "https://pubmed.ncbi.nlm.nih.gov/29622681" }, { "database": "PubMed", "id": "29675670", "url": "https://pubmed.ncbi.nlm.nih.gov/29675670" }, { "database": "PubMed", "id": "29705090", "url": "https://pubmed.ncbi.nlm.nih.gov/29705090" }, { "database": "PubMed", "id": "29774100", "url": "https://pubmed.ncbi.nlm.nih.gov/29774100" }, { "database": "PubMed", "id": "29849909", "url": "https://pubmed.ncbi.nlm.nih.gov/29849909" }, { "database": "PubMed", "id": "29879550", "url": "https://pubmed.ncbi.nlm.nih.gov/29879550" }, { "database": "PubMed", "id": "29890668", "url": "https://pubmed.ncbi.nlm.nih.gov/29890668" }, { "database": "PubMed", "id": "29899847", "url": "https://pubmed.ncbi.nlm.nih.gov/29899847" }, { "database": "PubMed", "id": "29937996", "url": "https://pubmed.ncbi.nlm.nih.gov/29937996" }, { "database": "PubMed", "id": "29963241", "url": "https://pubmed.ncbi.nlm.nih.gov/29963241" }, { "database": "PubMed", "id": "30003648", "url": "https://pubmed.ncbi.nlm.nih.gov/30003648" }, { "database": "PubMed", "id": "30018737", "url": "https://pubmed.ncbi.nlm.nih.gov/30018737" }, { "database": "PubMed", "id": "30045945", "url": "https://pubmed.ncbi.nlm.nih.gov/30045945" }, { "database": "PubMed", "id": "30049386", "url": "https://pubmed.ncbi.nlm.nih.gov/30049386" }, { "database": "PubMed", "id": "30057418", "url": "https://pubmed.ncbi.nlm.nih.gov/30057418" }, { "database": "PubMed", "id": "30067985", "url": "https://pubmed.ncbi.nlm.nih.gov/30067985" }, { "database": "PubMed", "id": "30093397", "url": "https://pubmed.ncbi.nlm.nih.gov/30093397" }, { "database": "PubMed", "id": "30108207", "url": "https://pubmed.ncbi.nlm.nih.gov/30108207" }, { "database": "PubMed", "id": "30142917", "url": "https://pubmed.ncbi.nlm.nih.gov/30142917" }, { "database": "PubMed", "id": "30166519", "url": "https://pubmed.ncbi.nlm.nih.gov/30166519" }, { "database": "PubMed", "id": "30177839", "url": "https://pubmed.ncbi.nlm.nih.gov/30177839" }, { "database": "PubMed", "id": "30193098", "url": "https://pubmed.ncbi.nlm.nih.gov/30193098" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30252118", "url": "https://pubmed.ncbi.nlm.nih.gov/30252118" }, { "database": "PubMed", "id": "30254375", "url": "https://pubmed.ncbi.nlm.nih.gov/30254375" }, { "database": "PubMed", "id": "30261716", "url": "https://pubmed.ncbi.nlm.nih.gov/30261716" }, { "database": "PubMed", "id": "30272263", "url": "https://pubmed.ncbi.nlm.nih.gov/30272263" }, { "database": "PubMed", "id": "30337688", "url": "https://pubmed.ncbi.nlm.nih.gov/30337688" }, { "database": "PubMed", "id": "30375398", "url": "https://pubmed.ncbi.nlm.nih.gov/30375398" }, { "database": "PubMed", "id": "30380295", "url": "https://pubmed.ncbi.nlm.nih.gov/30380295" }, { "database": "PubMed", "id": "30388705", "url": "https://pubmed.ncbi.nlm.nih.gov/30388705" }, { "database": "PubMed", "id": "30400903", "url": "https://pubmed.ncbi.nlm.nih.gov/30400903" }, { "database": "PubMed", "id": "30424508", "url": "https://pubmed.ncbi.nlm.nih.gov/30424508" }, { "database": "PubMed", "id": "30476192", "url": "https://pubmed.ncbi.nlm.nih.gov/30476192" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30513611", "url": "https://pubmed.ncbi.nlm.nih.gov/30513611" }, { "database": "PubMed", "id": "30520728", "url": "https://pubmed.ncbi.nlm.nih.gov/30520728" }, { "database": "PubMed", "id": "30532707", "url": "https://pubmed.ncbi.nlm.nih.gov/30532707" }, { "database": "PubMed", "id": "30538965", "url": "https://pubmed.ncbi.nlm.nih.gov/30538965" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30585287", "url": "https://pubmed.ncbi.nlm.nih.gov/30585287" }, { "database": "PubMed", "id": "30587121", "url": "https://pubmed.ncbi.nlm.nih.gov/30587121" }, { "database": "PubMed", "id": "30665195", "url": "https://pubmed.ncbi.nlm.nih.gov/30665195" }, { "database": "PubMed", "id": "30666155", "url": "https://pubmed.ncbi.nlm.nih.gov/30666155" }, { "database": "PubMed", "id": "30717309", "url": "https://pubmed.ncbi.nlm.nih.gov/30717309" }, { "database": "PubMed", "id": "30728460", "url": "https://pubmed.ncbi.nlm.nih.gov/30728460" }, { "database": "PubMed", "id": "30733851", "url": "https://pubmed.ncbi.nlm.nih.gov/30733851" }, { "database": "PubMed", "id": "30808373", "url": "https://pubmed.ncbi.nlm.nih.gov/30808373" }, { "database": "PubMed", "id": "30813936", "url": "https://pubmed.ncbi.nlm.nih.gov/30813936" }, { "database": "PubMed", "id": "30854784", "url": "https://pubmed.ncbi.nlm.nih.gov/30854784" }, { "database": "PubMed", "id": "30868056", "url": "https://pubmed.ncbi.nlm.nih.gov/30868056" }, { "database": "PubMed", "id": "30881947", "url": "https://pubmed.ncbi.nlm.nih.gov/30881947" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "30932278", "url": "https://pubmed.ncbi.nlm.nih.gov/30932278" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30966857", "url": "https://pubmed.ncbi.nlm.nih.gov/30966857" }, { "database": "PubMed", "id": "30975543", "url": "https://pubmed.ncbi.nlm.nih.gov/30975543" }, { "database": "PubMed", "id": "30982228", "url": "https://pubmed.ncbi.nlm.nih.gov/30982228" }, { "database": "PubMed", "id": "31039479", "url": "https://pubmed.ncbi.nlm.nih.gov/31039479" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31111215", "url": "https://pubmed.ncbi.nlm.nih.gov/31111215" }, { "database": "PubMed", "id": "31120902", "url": "https://pubmed.ncbi.nlm.nih.gov/31120902" }, { "database": "PubMed", "id": "31138113", "url": "https://pubmed.ncbi.nlm.nih.gov/31138113" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31217894", "url": "https://pubmed.ncbi.nlm.nih.gov/31217894" }, { "database": "PubMed", "id": "31231694", "url": "https://pubmed.ncbi.nlm.nih.gov/31231694" }, { "database": "PubMed", "id": "31336690", "url": "https://pubmed.ncbi.nlm.nih.gov/31336690" }, { "database": "PubMed", "id": "31360122", "url": "https://pubmed.ncbi.nlm.nih.gov/31360122" }, { "database": "PubMed", "id": "31366902", "url": "https://pubmed.ncbi.nlm.nih.gov/31366902" }, { "database": "PubMed", "id": "31379409", "url": "https://pubmed.ncbi.nlm.nih.gov/31379409" }, { "database": "PubMed", "id": "31388677", "url": "https://pubmed.ncbi.nlm.nih.gov/31388677" }, { "database": "PubMed", "id": "31421458", "url": "https://pubmed.ncbi.nlm.nih.gov/31421458" }, { "database": "PubMed", "id": "31462218", "url": "https://pubmed.ncbi.nlm.nih.gov/31462218" }, { "database": "PubMed", "id": "31551768", "url": "https://pubmed.ncbi.nlm.nih.gov/31551768" }, { "database": "PubMed", "id": "31594538", "url": "https://pubmed.ncbi.nlm.nih.gov/31594538" }, { "database": "PubMed", "id": "31596196", "url": "https://pubmed.ncbi.nlm.nih.gov/31596196" }, { "database": "PubMed", "id": "31615975", "url": "https://pubmed.ncbi.nlm.nih.gov/31615975" }, { "database": "PubMed", "id": "31699974", "url": "https://pubmed.ncbi.nlm.nih.gov/31699974" }, { "database": "PubMed", "id": "31804459", "url": "https://pubmed.ncbi.nlm.nih.gov/31804459" }, { "database": "PubMed", "id": "31821701", "url": "https://pubmed.ncbi.nlm.nih.gov/31821701" }, { "database": "PubMed", "id": "31844686", "url": "https://pubmed.ncbi.nlm.nih.gov/31844686" }, { "database": "PubMed", "id": "31847237", "url": "https://pubmed.ncbi.nlm.nih.gov/31847237" }, { "database": "PubMed", "id": "31861721", "url": "https://pubmed.ncbi.nlm.nih.gov/31861721" }, { "database": "PubMed", "id": "31979361", "url": "https://pubmed.ncbi.nlm.nih.gov/31979361" }, { "database": "PubMed", "id": "32001678", "url": "https://pubmed.ncbi.nlm.nih.gov/32001678" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32054925", "url": "https://pubmed.ncbi.nlm.nih.gov/32054925" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32168910", "url": "https://pubmed.ncbi.nlm.nih.gov/32168910" }, { "database": "PubMed", "id": "32213959", "url": "https://pubmed.ncbi.nlm.nih.gov/32213959" }, { "database": "PubMed", "id": "32260204", "url": "https://pubmed.ncbi.nlm.nih.gov/32260204" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32427887", "url": "https://pubmed.ncbi.nlm.nih.gov/32427887" }, { "database": "PubMed", "id": "32432260", "url": "https://pubmed.ncbi.nlm.nih.gov/32432260" }, { "database": "PubMed", "id": "32492656", "url": "https://pubmed.ncbi.nlm.nih.gov/32492656" }, { "database": "PubMed", "id": "32560563", "url": "https://pubmed.ncbi.nlm.nih.gov/32560563" }, { "database": "PubMed", "id": "32605139", "url": "https://pubmed.ncbi.nlm.nih.gov/32605139" }, { "database": "PubMed", "id": "32617134", "url": "https://pubmed.ncbi.nlm.nih.gov/32617134" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32724100", "url": "https://pubmed.ncbi.nlm.nih.gov/32724100" }, { "database": "PubMed", "id": "32733438", "url": "https://pubmed.ncbi.nlm.nih.gov/32733438" }, { "database": "PubMed", "id": "32735894", "url": "https://pubmed.ncbi.nlm.nih.gov/32735894" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863918", "url": "https://pubmed.ncbi.nlm.nih.gov/32863918" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "32929340", "url": "https://pubmed.ncbi.nlm.nih.gov/32929340" }, { "database": "PubMed", "id": "32945487", "url": "https://pubmed.ncbi.nlm.nih.gov/32945487" }, { "database": "PubMed", "id": "32978372", "url": "https://pubmed.ncbi.nlm.nih.gov/32978372" }, { "database": "PubMed", "id": "33014050", "url": "https://pubmed.ncbi.nlm.nih.gov/33014050" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33061640", "url": "https://pubmed.ncbi.nlm.nih.gov/33061640" }, { "database": "PubMed", "id": "33074128", "url": "https://pubmed.ncbi.nlm.nih.gov/33074128" }, { "database": "PubMed", "id": "33085644", "url": "https://pubmed.ncbi.nlm.nih.gov/33085644" }, { "database": "PubMed", "id": "33097607", "url": "https://pubmed.ncbi.nlm.nih.gov/33097607" }, { "database": "PubMed", "id": "33110364", "url": "https://pubmed.ncbi.nlm.nih.gov/33110364" }, { "database": "PubMed", "id": "33146634", "url": "https://pubmed.ncbi.nlm.nih.gov/33146634" }, { "database": "PubMed", "id": "33166398", "url": "https://pubmed.ncbi.nlm.nih.gov/33166398" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33245719", "url": "https://pubmed.ncbi.nlm.nih.gov/33245719" }, { "database": "PubMed", "id": "33251333", "url": "https://pubmed.ncbi.nlm.nih.gov/33251333" }, { "database": "PubMed", "id": "33297931", "url": "https://pubmed.ncbi.nlm.nih.gov/33297931" }, { "database": "PubMed", "id": "33303632", "url": "https://pubmed.ncbi.nlm.nih.gov/33303632" }, { "database": "PubMed", "id": "33391525", "url": "https://pubmed.ncbi.nlm.nih.gov/33391525" }, { "database": "PubMed", "id": "33396303", "url": "https://pubmed.ncbi.nlm.nih.gov/33396303" }, { "database": "PubMed", "id": "33411764", "url": "https://pubmed.ncbi.nlm.nih.gov/33411764" }, { "database": "PubMed", "id": "33431809", "url": "https://pubmed.ncbi.nlm.nih.gov/33431809" }, { "database": "PubMed", "id": "33503543", "url": "https://pubmed.ncbi.nlm.nih.gov/33503543" }, { "database": "PubMed", "id": "33536467", "url": "https://pubmed.ncbi.nlm.nih.gov/33536467" }, { "database": "PubMed", "id": "33585229", "url": "https://pubmed.ncbi.nlm.nih.gov/33585229" }, { "database": "PubMed", "id": "33669867", "url": "https://pubmed.ncbi.nlm.nih.gov/33669867" }, { "database": "PubMed", "id": "33745968", "url": "https://pubmed.ncbi.nlm.nih.gov/33745968" }, { "database": "PubMed", "id": "33761896", "url": "https://pubmed.ncbi.nlm.nih.gov/33761896" }, { "database": "PubMed", "id": "33804124", "url": "https://pubmed.ncbi.nlm.nih.gov/33804124" }, { "database": "PubMed", "id": "33808426", "url": "https://pubmed.ncbi.nlm.nih.gov/33808426" }, { "database": "PubMed", "id": "33850227", "url": "https://pubmed.ncbi.nlm.nih.gov/33850227" }, { "database": "PubMed", "id": "33898425", "url": "https://pubmed.ncbi.nlm.nih.gov/33898425" }, { "database": "PubMed", "id": "33899121", "url": "https://pubmed.ncbi.nlm.nih.gov/33899121" }, { "database": "PubMed", "id": "33982778", "url": "https://pubmed.ncbi.nlm.nih.gov/33982778" }, { "database": "PubMed", "id": "33982878", "url": "https://pubmed.ncbi.nlm.nih.gov/33982878" }, { "database": "PubMed", "id": "34103468", "url": "https://pubmed.ncbi.nlm.nih.gov/34103468" }, { "database": "PubMed", "id": "34930892", "url": "https://pubmed.ncbi.nlm.nih.gov/34930892" }, { "database": "PubMed", "id": "35143532", "url": "https://pubmed.ncbi.nlm.nih.gov/35143532" }, { "database": "PubMed", "id": "35312310", "url": "https://pubmed.ncbi.nlm.nih.gov/35312310" }, { "database": "PubMed", "id": "35752942", "url": "https://pubmed.ncbi.nlm.nih.gov/35752942" }, { "database": "PubMed", "id": "35792512", "url": "https://pubmed.ncbi.nlm.nih.gov/35792512" }, { "database": "PubMed", "id": "35829882", "url": "https://pubmed.ncbi.nlm.nih.gov/35829882" }, { "database": "PubMed", "id": "35834822", "url": "https://pubmed.ncbi.nlm.nih.gov/35834822" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "36094323", "url": "https://pubmed.ncbi.nlm.nih.gov/36094323" }, { "database": "PubMed", "id": "36293376", "url": "https://pubmed.ncbi.nlm.nih.gov/36293376" }, { "database": "PubMed", "id": "36300938", "url": "https://pubmed.ncbi.nlm.nih.gov/36300938" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8502477", "url": "https://pubmed.ncbi.nlm.nih.gov/8502477" }, { "database": "PubMed", "id": "9407038", "url": "https://pubmed.ncbi.nlm.nih.gov/9407038" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9733514", "url": "https://pubmed.ncbi.nlm.nih.gov/9733514" }, { "database": "PubMed", "id": "9733515", "url": "https://pubmed.ncbi.nlm.nih.gov/9733515" }, { "database": "PubMed", "id": "9830059", "url": "https://pubmed.ncbi.nlm.nih.gov/9830059" }, { "database": "PubMed", "id": "9843217", "url": "https://pubmed.ncbi.nlm.nih.gov/9843217" }, { "database": "PubMed", "id": "11554766", "url": "https://pubmed.ncbi.nlm.nih.gov/11554766" } ], "site_lbl": "Ser15", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 392, "end_pos": 392, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK2, CDK2 and NUAK1", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "11239457", "url": "https://pubmed.ncbi.nlm.nih.gov/11239457" }, { "database": "PubMed", "id": "12393879", "url": "https://pubmed.ncbi.nlm.nih.gov/12393879" }, { "database": "PubMed", "id": "16552184", "url": "https://pubmed.ncbi.nlm.nih.gov/16552184" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10559267", "url": "https://pubmed.ncbi.nlm.nih.gov/10559267" }, { "database": "PubMed", "id": "10597229", "url": "https://pubmed.ncbi.nlm.nih.gov/10597229" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10747897", "url": "https://pubmed.ncbi.nlm.nih.gov/10747897" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10884347", "url": "https://pubmed.ncbi.nlm.nih.gov/10884347" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11508859", "url": "https://pubmed.ncbi.nlm.nih.gov/11508859" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11741290", "url": "https://pubmed.ncbi.nlm.nih.gov/11741290" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "12081208", "url": "https://pubmed.ncbi.nlm.nih.gov/12081208" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12776195", "url": "https://pubmed.ncbi.nlm.nih.gov/12776195" }, { "database": "PubMed", "id": "12792782", "url": "https://pubmed.ncbi.nlm.nih.gov/12792782" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12898523", "url": "https://pubmed.ncbi.nlm.nih.gov/12898523" }, { "database": "PubMed", "id": "12937839", "url": "https://pubmed.ncbi.nlm.nih.gov/12937839" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14640983", "url": "https://pubmed.ncbi.nlm.nih.gov/14640983" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "15038834", "url": "https://pubmed.ncbi.nlm.nih.gov/15038834" }, { "database": "PubMed", "id": "15064747", "url": "https://pubmed.ncbi.nlm.nih.gov/15064747" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15709766", "url": "https://pubmed.ncbi.nlm.nih.gov/15709766" }, { "database": "PubMed", "id": "15837201", "url": "https://pubmed.ncbi.nlm.nih.gov/15837201" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "16082409", "url": "https://pubmed.ncbi.nlm.nih.gov/16082409" }, { "database": "PubMed", "id": "16299809", "url": "https://pubmed.ncbi.nlm.nih.gov/16299809" }, { "database": "PubMed", "id": "16319070", "url": "https://pubmed.ncbi.nlm.nih.gov/16319070" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16741955", "url": "https://pubmed.ncbi.nlm.nih.gov/16741955" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "17051326", "url": "https://pubmed.ncbi.nlm.nih.gov/17051326" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17180249", "url": "https://pubmed.ncbi.nlm.nih.gov/17180249" }, { "database": "PubMed", "id": "17237827", "url": "https://pubmed.ncbi.nlm.nih.gov/17237827" }, { "database": "PubMed", "id": "17341630", "url": "https://pubmed.ncbi.nlm.nih.gov/17341630" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17523842", "url": "https://pubmed.ncbi.nlm.nih.gov/17523842" }, { "database": "PubMed", "id": "17565390", "url": "https://pubmed.ncbi.nlm.nih.gov/17565390" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17966099", "url": "https://pubmed.ncbi.nlm.nih.gov/17966099" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18443131", "url": "https://pubmed.ncbi.nlm.nih.gov/18443131" }, { "database": "PubMed", "id": "18472237", "url": "https://pubmed.ncbi.nlm.nih.gov/18472237" }, { "database": "PubMed", "id": "18495777", "url": "https://pubmed.ncbi.nlm.nih.gov/18495777" }, { "database": "PubMed", "id": "18523266", "url": "https://pubmed.ncbi.nlm.nih.gov/18523266" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18718914", "url": "https://pubmed.ncbi.nlm.nih.gov/18718914" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19253369", "url": "https://pubmed.ncbi.nlm.nih.gov/19253369" }, { "database": "PubMed", "id": "19428812", "url": "https://pubmed.ncbi.nlm.nih.gov/19428812" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19834494", "url": "https://pubmed.ncbi.nlm.nih.gov/19834494" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19932175", "url": "https://pubmed.ncbi.nlm.nih.gov/19932175" }, { "database": "PubMed", "id": "20009884", "url": "https://pubmed.ncbi.nlm.nih.gov/20009884" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20234175", "url": "https://pubmed.ncbi.nlm.nih.gov/20234175" }, { "database": "PubMed", "id": "20346999", "url": "https://pubmed.ncbi.nlm.nih.gov/20346999" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20810912", "url": "https://pubmed.ncbi.nlm.nih.gov/20810912" }, { "database": "PubMed", "id": "21084272", "url": "https://pubmed.ncbi.nlm.nih.gov/21084272" }, { "database": "PubMed", "id": "21210663", "url": "https://pubmed.ncbi.nlm.nih.gov/21210663" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21339981", "url": "https://pubmed.ncbi.nlm.nih.gov/21339981" }, { "database": "PubMed", "id": "21455220", "url": "https://pubmed.ncbi.nlm.nih.gov/21455220" }, { "database": "PubMed", "id": "21457773", "url": "https://pubmed.ncbi.nlm.nih.gov/21457773" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21769452", "url": "https://pubmed.ncbi.nlm.nih.gov/21769452" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21832239", "url": "https://pubmed.ncbi.nlm.nih.gov/21832239" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22914926", "url": "https://pubmed.ncbi.nlm.nih.gov/22914926" }, { "database": "PubMed", "id": "23414419", "url": "https://pubmed.ncbi.nlm.nih.gov/23414419" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23565200", "url": "https://pubmed.ncbi.nlm.nih.gov/23565200" }, { "database": "PubMed", "id": "23603988", "url": "https://pubmed.ncbi.nlm.nih.gov/23603988" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24286312", "url": "https://pubmed.ncbi.nlm.nih.gov/24286312" }, { "database": "PubMed", "id": "24362252", "url": "https://pubmed.ncbi.nlm.nih.gov/24362252" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24473091", "url": "https://pubmed.ncbi.nlm.nih.gov/24473091" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "25139266", "url": "https://pubmed.ncbi.nlm.nih.gov/25139266" }, { "database": "PubMed", "id": "25311616", "url": "https://pubmed.ncbi.nlm.nih.gov/25311616" }, { "database": "PubMed", "id": "25429619", "url": "https://pubmed.ncbi.nlm.nih.gov/25429619" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25633290", "url": "https://pubmed.ncbi.nlm.nih.gov/25633290" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26936915", "url": "https://pubmed.ncbi.nlm.nih.gov/26936915" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28498467", "url": "https://pubmed.ncbi.nlm.nih.gov/28498467" }, { "database": "PubMed", "id": "28878400", "url": "https://pubmed.ncbi.nlm.nih.gov/28878400" }, { "database": "PubMed", "id": "28937686", "url": "https://pubmed.ncbi.nlm.nih.gov/28937686" }, { "database": "PubMed", "id": "29033320", "url": "https://pubmed.ncbi.nlm.nih.gov/29033320" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "30096294", "url": "https://pubmed.ncbi.nlm.nih.gov/30096294" }, { "database": "PubMed", "id": "30416048", "url": "https://pubmed.ncbi.nlm.nih.gov/30416048" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30725256", "url": "https://pubmed.ncbi.nlm.nih.gov/30725256" }, { "database": "PubMed", "id": "30942456", "url": "https://pubmed.ncbi.nlm.nih.gov/30942456" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31496797", "url": "https://pubmed.ncbi.nlm.nih.gov/31496797" }, { "database": "PubMed", "id": "31617338", "url": "https://pubmed.ncbi.nlm.nih.gov/31617338" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32181328", "url": "https://pubmed.ncbi.nlm.nih.gov/32181328" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32681102", "url": "https://pubmed.ncbi.nlm.nih.gov/32681102" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863216", "url": "https://pubmed.ncbi.nlm.nih.gov/32863216" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33209651", "url": "https://pubmed.ncbi.nlm.nih.gov/33209651" }, { "database": "PubMed", "id": "33266043", "url": "https://pubmed.ncbi.nlm.nih.gov/33266043" }, { "database": "PubMed", "id": "33303565", "url": "https://pubmed.ncbi.nlm.nih.gov/33303565" }, { "database": "PubMed", "id": "34209868", "url": "https://pubmed.ncbi.nlm.nih.gov/34209868" }, { "database": "PubMed", "id": "34216619", "url": "https://pubmed.ncbi.nlm.nih.gov/34216619" }, { "database": "PubMed", "id": "35618207", "url": "https://pubmed.ncbi.nlm.nih.gov/35618207" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "35902040", "url": "https://pubmed.ncbi.nlm.nih.gov/35902040" }, { "database": "PubMed", "id": "36058261", "url": "https://pubmed.ncbi.nlm.nih.gov/36058261" }, { "database": "PubMed", "id": "36399430", "url": "https://pubmed.ncbi.nlm.nih.gov/36399430" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8956076", "url": "https://pubmed.ncbi.nlm.nih.gov/8956076" }, { "database": "PubMed", "id": "9246643", "url": "https://pubmed.ncbi.nlm.nih.gov/9246643" }, { "database": "PubMed", "id": "9254608", "url": "https://pubmed.ncbi.nlm.nih.gov/9254608" }, { "database": "PubMed", "id": "9467949", "url": "https://pubmed.ncbi.nlm.nih.gov/9467949" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9747884", "url": "https://pubmed.ncbi.nlm.nih.gov/9747884" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "22214662", "url": "https://pubmed.ncbi.nlm.nih.gov/22214662" } ], "site_lbl": "Ser392", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5, DYRK2, HIPK2 and PKC/PRKCG", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "17591690", "url": "https://pubmed.ncbi.nlm.nih.gov/17591690" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "15642743", "url": "https://pubmed.ncbi.nlm.nih.gov/15642743" }, { "database": "PubMed", "id": "10581258", "url": "https://pubmed.ncbi.nlm.nih.gov/10581258" }, { "database": "PubMed", "id": "11030628", "url": "https://pubmed.ncbi.nlm.nih.gov/11030628" }, { "database": "PubMed", "id": "11511362", "url": "https://pubmed.ncbi.nlm.nih.gov/11511362" }, { "database": "PubMed", "id": "11740489", "url": "https://pubmed.ncbi.nlm.nih.gov/11740489" }, { "database": "PubMed", "id": "11780126", "url": "https://pubmed.ncbi.nlm.nih.gov/11780126" }, { "database": "PubMed", "id": "11875057", "url": "https://pubmed.ncbi.nlm.nih.gov/11875057" }, { "database": "PubMed", "id": "12021785", "url": "https://pubmed.ncbi.nlm.nih.gov/12021785" }, { "database": "PubMed", "id": "12093737", "url": "https://pubmed.ncbi.nlm.nih.gov/12093737" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12782576", "url": "https://pubmed.ncbi.nlm.nih.gov/12782576" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12907596", "url": "https://pubmed.ncbi.nlm.nih.gov/12907596" }, { "database": "PubMed", "id": "12927814", "url": "https://pubmed.ncbi.nlm.nih.gov/12927814" }, { "database": "PubMed", "id": "14729469", "url": "https://pubmed.ncbi.nlm.nih.gov/14729469" }, { "database": "PubMed", "id": "14749479", "url": "https://pubmed.ncbi.nlm.nih.gov/14749479" }, { "database": "PubMed", "id": "14993250", "url": "https://pubmed.ncbi.nlm.nih.gov/14993250" }, { "database": "PubMed", "id": "15026814", "url": "https://pubmed.ncbi.nlm.nih.gov/15026814" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15274301", "url": "https://pubmed.ncbi.nlm.nih.gov/15274301" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15526030", "url": "https://pubmed.ncbi.nlm.nih.gov/15526030" }, { "database": "PubMed", "id": "15608685", "url": "https://pubmed.ncbi.nlm.nih.gov/15608685" }, { "database": "PubMed", "id": "15657359", "url": "https://pubmed.ncbi.nlm.nih.gov/15657359" }, { "database": "PubMed", "id": "15657900", "url": "https://pubmed.ncbi.nlm.nih.gov/15657900" }, { "database": "PubMed", "id": "15766567", "url": "https://pubmed.ncbi.nlm.nih.gov/15766567" }, { "database": "PubMed", "id": "15843377", "url": "https://pubmed.ncbi.nlm.nih.gov/15843377" }, { "database": "PubMed", "id": "15897882", "url": "https://pubmed.ncbi.nlm.nih.gov/15897882" }, { "database": "PubMed", "id": "16219768", "url": "https://pubmed.ncbi.nlm.nih.gov/16219768" }, { "database": "PubMed", "id": "16247456", "url": "https://pubmed.ncbi.nlm.nih.gov/16247456" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16377624", "url": "https://pubmed.ncbi.nlm.nih.gov/16377624" }, { "database": "PubMed", "id": "16601678", "url": "https://pubmed.ncbi.nlm.nih.gov/16601678" }, { "database": "PubMed", "id": "16738336", "url": "https://pubmed.ncbi.nlm.nih.gov/16738336" }, { "database": "PubMed", "id": "16793543", "url": "https://pubmed.ncbi.nlm.nih.gov/16793543" }, { "database": "PubMed", "id": "17031575", "url": "https://pubmed.ncbi.nlm.nih.gov/17031575" }, { "database": "PubMed", "id": "17051326", "url": "https://pubmed.ncbi.nlm.nih.gov/17051326" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17117479", "url": "https://pubmed.ncbi.nlm.nih.gov/17117479" }, { "database": "PubMed", "id": "17332358", "url": "https://pubmed.ncbi.nlm.nih.gov/17332358" }, { "database": "PubMed", "id": "17349958", "url": "https://pubmed.ncbi.nlm.nih.gov/17349958" }, { "database": "PubMed", "id": "17349959", "url": "https://pubmed.ncbi.nlm.nih.gov/17349959" }, { "database": "PubMed", "id": "17404016", "url": "https://pubmed.ncbi.nlm.nih.gov/17404016" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17567906", "url": "https://pubmed.ncbi.nlm.nih.gov/17567906" }, { "database": "PubMed", "id": "17584297", "url": "https://pubmed.ncbi.nlm.nih.gov/17584297" }, { "database": "PubMed", "id": "17932951", "url": "https://pubmed.ncbi.nlm.nih.gov/17932951" }, { "database": "PubMed", "id": "17971768", "url": "https://pubmed.ncbi.nlm.nih.gov/17971768" }, { "database": "PubMed", "id": "18056705", "url": "https://pubmed.ncbi.nlm.nih.gov/18056705" }, { "database": "PubMed", "id": "18216278", "url": "https://pubmed.ncbi.nlm.nih.gov/18216278" }, { "database": "PubMed", "id": "18311036", "url": "https://pubmed.ncbi.nlm.nih.gov/18311036" }, { "database": "PubMed", "id": "18363705", "url": "https://pubmed.ncbi.nlm.nih.gov/18363705" }, { "database": "PubMed", "id": "18395248", "url": "https://pubmed.ncbi.nlm.nih.gov/18395248" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18599021", "url": "https://pubmed.ncbi.nlm.nih.gov/18599021" }, { "database": "PubMed", "id": "18642443", "url": "https://pubmed.ncbi.nlm.nih.gov/18642443" }, { "database": "PubMed", "id": "18760266", "url": "https://pubmed.ncbi.nlm.nih.gov/18760266" }, { "database": "PubMed", "id": "18761330", "url": "https://pubmed.ncbi.nlm.nih.gov/18761330" }, { "database": "PubMed", "id": "18846503", "url": "https://pubmed.ncbi.nlm.nih.gov/18846503" }, { "database": "PubMed", "id": "19139122", "url": "https://pubmed.ncbi.nlm.nih.gov/19139122" }, { "database": "PubMed", "id": "19197384", "url": "https://pubmed.ncbi.nlm.nih.gov/19197384" }, { "database": "PubMed", "id": "19287975", "url": "https://pubmed.ncbi.nlm.nih.gov/19287975" }, { "database": "PubMed", "id": "19325714", "url": "https://pubmed.ncbi.nlm.nih.gov/19325714" }, { "database": "PubMed", "id": "19328784", "url": "https://pubmed.ncbi.nlm.nih.gov/19328784" }, { "database": "PubMed", "id": "19363523", "url": "https://pubmed.ncbi.nlm.nih.gov/19363523" }, { "database": "PubMed", "id": "19521340", "url": "https://pubmed.ncbi.nlm.nih.gov/19521340" }, { "database": "PubMed", "id": "19525231", "url": "https://pubmed.ncbi.nlm.nih.gov/19525231" }, { "database": "PubMed", "id": "19668373", "url": "https://pubmed.ncbi.nlm.nih.gov/19668373" }, { "database": "PubMed", "id": "19724778", "url": "https://pubmed.ncbi.nlm.nih.gov/19724778" }, { "database": "PubMed", "id": "19857493", "url": "https://pubmed.ncbi.nlm.nih.gov/19857493" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19887911", "url": "https://pubmed.ncbi.nlm.nih.gov/19887911" }, { "database": "PubMed", "id": "19903847", "url": "https://pubmed.ncbi.nlm.nih.gov/19903847" }, { "database": "PubMed", "id": "19965871", "url": "https://pubmed.ncbi.nlm.nih.gov/19965871" }, { "database": "PubMed", "id": "20018442", "url": "https://pubmed.ncbi.nlm.nih.gov/20018442" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20123963", "url": "https://pubmed.ncbi.nlm.nih.gov/20123963" }, { "database": "PubMed", "id": "20171273", "url": "https://pubmed.ncbi.nlm.nih.gov/20171273" }, { "database": "PubMed", "id": "20234185", "url": "https://pubmed.ncbi.nlm.nih.gov/20234185" }, { "database": "PubMed", "id": "20673369", "url": "https://pubmed.ncbi.nlm.nih.gov/20673369" }, { "database": "PubMed", "id": "21057547", "url": "https://pubmed.ncbi.nlm.nih.gov/21057547" }, { "database": "PubMed", "id": "21080333", "url": "https://pubmed.ncbi.nlm.nih.gov/21080333" }, { "database": "PubMed", "id": "21173028", "url": "https://pubmed.ncbi.nlm.nih.gov/21173028" }, { "database": "PubMed", "id": "21192925", "url": "https://pubmed.ncbi.nlm.nih.gov/21192925" }, { "database": "PubMed", "id": "21308739", "url": "https://pubmed.ncbi.nlm.nih.gov/21308739" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21394211", "url": "https://pubmed.ncbi.nlm.nih.gov/21394211" }, { "database": "PubMed", "id": "21451571", "url": "https://pubmed.ncbi.nlm.nih.gov/21451571" }, { "database": "PubMed", "id": "21539808", "url": "https://pubmed.ncbi.nlm.nih.gov/21539808" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21576488", "url": "https://pubmed.ncbi.nlm.nih.gov/21576488" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21602882", "url": "https://pubmed.ncbi.nlm.nih.gov/21602882" }, { "database": "PubMed", "id": "21698151", "url": "https://pubmed.ncbi.nlm.nih.gov/21698151" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21903158", "url": "https://pubmed.ncbi.nlm.nih.gov/21903158" }, { "database": "PubMed", "id": "22011578", "url": "https://pubmed.ncbi.nlm.nih.gov/22011578" }, { "database": "PubMed", "id": "22110707", "url": "https://pubmed.ncbi.nlm.nih.gov/22110707" }, { "database": "PubMed", "id": "22166212", "url": "https://pubmed.ncbi.nlm.nih.gov/22166212" }, { "database": "PubMed", "id": "22244155", "url": "https://pubmed.ncbi.nlm.nih.gov/22244155" }, { "database": "PubMed", "id": "22331558", "url": "https://pubmed.ncbi.nlm.nih.gov/22331558" }, { "database": "PubMed", "id": "22397410", "url": "https://pubmed.ncbi.nlm.nih.gov/22397410" }, { "database": "PubMed", "id": "22435726", "url": "https://pubmed.ncbi.nlm.nih.gov/22435726" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22662219", "url": "https://pubmed.ncbi.nlm.nih.gov/22662219" }, { "database": "PubMed", "id": "22797063", "url": "https://pubmed.ncbi.nlm.nih.gov/22797063" }, { "database": "PubMed", "id": "22878263", "url": "https://pubmed.ncbi.nlm.nih.gov/22878263" }, { "database": "PubMed", "id": "22935610", "url": "https://pubmed.ncbi.nlm.nih.gov/22935610" }, { "database": "PubMed", "id": "23030661", "url": "https://pubmed.ncbi.nlm.nih.gov/23030661" }, { "database": "PubMed", "id": "23536002", "url": "https://pubmed.ncbi.nlm.nih.gov/23536002" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23666755", "url": "https://pubmed.ncbi.nlm.nih.gov/23666755" }, { "database": "PubMed", "id": "23703384", "url": "https://pubmed.ncbi.nlm.nih.gov/23703384" }, { "database": "PubMed", "id": "23717325", "url": "https://pubmed.ncbi.nlm.nih.gov/23717325" }, { "database": "PubMed", "id": "23800173", "url": "https://pubmed.ncbi.nlm.nih.gov/23800173" }, { "database": "PubMed", "id": "23826318", "url": "https://pubmed.ncbi.nlm.nih.gov/23826318" }, { "database": "PubMed", "id": "23883471", "url": "https://pubmed.ncbi.nlm.nih.gov/23883471" }, { "database": "PubMed", "id": "24196445", "url": "https://pubmed.ncbi.nlm.nih.gov/24196445" }, { "database": "PubMed", "id": "24379358", "url": "https://pubmed.ncbi.nlm.nih.gov/24379358" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24726920", "url": "https://pubmed.ncbi.nlm.nih.gov/24726920" }, { "database": "PubMed", "id": "24810057", "url": "https://pubmed.ncbi.nlm.nih.gov/24810057" }, { "database": "PubMed", "id": "24829283", "url": "https://pubmed.ncbi.nlm.nih.gov/24829283" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24905183", "url": "https://pubmed.ncbi.nlm.nih.gov/24905183" }, { "database": "PubMed", "id": "24915467", "url": "https://pubmed.ncbi.nlm.nih.gov/24915467" }, { "database": "PubMed", "id": "24922063", "url": "https://pubmed.ncbi.nlm.nih.gov/24922063" }, { "database": "PubMed", "id": "24952595", "url": "https://pubmed.ncbi.nlm.nih.gov/24952595" }, { "database": "PubMed", "id": "25260780", "url": "https://pubmed.ncbi.nlm.nih.gov/25260780" }, { "database": "PubMed", "id": "25294809", "url": "https://pubmed.ncbi.nlm.nih.gov/25294809" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25778922", "url": "https://pubmed.ncbi.nlm.nih.gov/25778922" }, { "database": "PubMed", "id": "25852310", "url": "https://pubmed.ncbi.nlm.nih.gov/25852310" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "25944899", "url": "https://pubmed.ncbi.nlm.nih.gov/25944899" }, { "database": "PubMed", "id": "25989210", "url": "https://pubmed.ncbi.nlm.nih.gov/25989210" }, { "database": "PubMed", "id": "26006237", "url": "https://pubmed.ncbi.nlm.nih.gov/26006237" }, { "database": "PubMed", "id": "26029824", "url": "https://pubmed.ncbi.nlm.nih.gov/26029824" }, { "database": "PubMed", "id": "26042776", "url": "https://pubmed.ncbi.nlm.nih.gov/26042776" }, { "database": "PubMed", "id": "26112218", "url": "https://pubmed.ncbi.nlm.nih.gov/26112218" }, { "database": "PubMed", "id": "26113041", "url": "https://pubmed.ncbi.nlm.nih.gov/26113041" }, { "database": "PubMed", "id": "26138448", "url": "https://pubmed.ncbi.nlm.nih.gov/26138448" }, { "database": "PubMed", "id": "26230405", "url": "https://pubmed.ncbi.nlm.nih.gov/26230405" }, { "database": "PubMed", "id": "26231043", "url": "https://pubmed.ncbi.nlm.nih.gov/26231043" }, { "database": "PubMed", "id": "26297485", "url": "https://pubmed.ncbi.nlm.nih.gov/26297485" }, { "database": "PubMed", "id": "26386653", "url": "https://pubmed.ncbi.nlm.nih.gov/26386653" }, { "database": "PubMed", "id": "26716417", "url": "https://pubmed.ncbi.nlm.nih.gov/26716417" }, { "database": "PubMed", "id": "26967060", "url": "https://pubmed.ncbi.nlm.nih.gov/26967060" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "27238720", "url": "https://pubmed.ncbi.nlm.nih.gov/27238720" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27659536", "url": "https://pubmed.ncbi.nlm.nih.gov/27659536" }, { "database": "PubMed", "id": "27766434", "url": "https://pubmed.ncbi.nlm.nih.gov/27766434" }, { "database": "PubMed", "id": "27787517", "url": "https://pubmed.ncbi.nlm.nih.gov/27787517" }, { "database": "PubMed", "id": "28035068", "url": "https://pubmed.ncbi.nlm.nih.gov/28035068" }, { "database": "PubMed", "id": "28060750", "url": "https://pubmed.ncbi.nlm.nih.gov/28060750" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28477117", "url": "https://pubmed.ncbi.nlm.nih.gov/28477117" }, { "database": "PubMed", "id": "29156763", "url": "https://pubmed.ncbi.nlm.nih.gov/29156763" }, { "database": "PubMed", "id": "29899847", "url": "https://pubmed.ncbi.nlm.nih.gov/29899847" }, { "database": "PubMed", "id": "30096294", "url": "https://pubmed.ncbi.nlm.nih.gov/30096294" }, { "database": "PubMed", "id": "30142917", "url": "https://pubmed.ncbi.nlm.nih.gov/30142917" }, { "database": "PubMed", "id": "30254375", "url": "https://pubmed.ncbi.nlm.nih.gov/30254375" }, { "database": "PubMed", "id": "30338379", "url": "https://pubmed.ncbi.nlm.nih.gov/30338379" }, { "database": "PubMed", "id": "30520728", "url": "https://pubmed.ncbi.nlm.nih.gov/30520728" }, { "database": "PubMed", "id": "30585287", "url": "https://pubmed.ncbi.nlm.nih.gov/30585287" }, { "database": "PubMed", "id": "30587121", "url": "https://pubmed.ncbi.nlm.nih.gov/30587121" }, { "database": "PubMed", "id": "30718466", "url": "https://pubmed.ncbi.nlm.nih.gov/30718466" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31462218", "url": "https://pubmed.ncbi.nlm.nih.gov/31462218" }, { "database": "PubMed", "id": "31466709", "url": "https://pubmed.ncbi.nlm.nih.gov/31466709" }, { "database": "PubMed", "id": "31804459", "url": "https://pubmed.ncbi.nlm.nih.gov/31804459" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32213959", "url": "https://pubmed.ncbi.nlm.nih.gov/32213959" }, { "database": "PubMed", "id": "32260204", "url": "https://pubmed.ncbi.nlm.nih.gov/32260204" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32681102", "url": "https://pubmed.ncbi.nlm.nih.gov/32681102" }, { "database": "PubMed", "id": "32873775", "url": "https://pubmed.ncbi.nlm.nih.gov/32873775" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "33063904", "url": "https://pubmed.ncbi.nlm.nih.gov/33063904" }, { "database": "PubMed", "id": "33110364", "url": "https://pubmed.ncbi.nlm.nih.gov/33110364" }, { "database": "PubMed", "id": "33245719", "url": "https://pubmed.ncbi.nlm.nih.gov/33245719" }, { "database": "PubMed", "id": "33443163", "url": "https://pubmed.ncbi.nlm.nih.gov/33443163" }, { "database": "PubMed", "id": "33591310", "url": "https://pubmed.ncbi.nlm.nih.gov/33591310" }, { "database": "PubMed", "id": "34947995", "url": "https://pubmed.ncbi.nlm.nih.gov/34947995" }, { "database": "PubMed", "id": "35065218", "url": "https://pubmed.ncbi.nlm.nih.gov/35065218" }, { "database": "PubMed", "id": "35227287", "url": "https://pubmed.ncbi.nlm.nih.gov/35227287" }, { "database": "PubMed", "id": "36164647", "url": "https://pubmed.ncbi.nlm.nih.gov/36164647" } ], "site_lbl": "Ser46", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5, PRPK, AMPK, NUAK1 and ATM", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "10864201", "url": "https://pubmed.ncbi.nlm.nih.gov/10864201" }, { "database": "PubMed", "id": "15580310", "url": "https://pubmed.ncbi.nlm.nih.gov/15580310" }, { "database": "IntAct", "id": "P04637", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04637*" }, { "database": "PubMed", "id": "19883646", "url": "https://pubmed.ncbi.nlm.nih.gov/19883646" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "15866171", "url": "https://pubmed.ncbi.nlm.nih.gov/15866171" }, { "database": "PubMed", "id": "17591690", "url": "https://pubmed.ncbi.nlm.nih.gov/17591690" }, { "database": "PubMed", "id": "19828454", "url": "https://pubmed.ncbi.nlm.nih.gov/19828454" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PubMed", "id": "9925639", "url": "https://pubmed.ncbi.nlm.nih.gov/9925639" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "10202145", "url": "https://pubmed.ncbi.nlm.nih.gov/10202145" }, { "database": "PubMed", "id": "10606744", "url": "https://pubmed.ncbi.nlm.nih.gov/10606744" }, { "database": "PubMed", "id": "14712210", "url": "https://pubmed.ncbi.nlm.nih.gov/14712210" }, { "database": "PubMed", "id": "15642743", "url": "https://pubmed.ncbi.nlm.nih.gov/15642743" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "10082548", "url": "https://pubmed.ncbi.nlm.nih.gov/10082548" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10435622", "url": "https://pubmed.ncbi.nlm.nih.gov/10435622" }, { "database": "PubMed", "id": "10485486", "url": "https://pubmed.ncbi.nlm.nih.gov/10485486" }, { "database": "PubMed", "id": "10500142", "url": "https://pubmed.ncbi.nlm.nih.gov/10500142" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10544021", "url": "https://pubmed.ncbi.nlm.nih.gov/10544021" }, { "database": "PubMed", "id": "10570149", "url": "https://pubmed.ncbi.nlm.nih.gov/10570149" }, { "database": "PubMed", "id": "10601022", "url": "https://pubmed.ncbi.nlm.nih.gov/10601022" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10713094", "url": "https://pubmed.ncbi.nlm.nih.gov/10713094" }, { "database": "PubMed", "id": "10723129", "url": "https://pubmed.ncbi.nlm.nih.gov/10723129" }, { "database": "PubMed", "id": "10734067", "url": "https://pubmed.ncbi.nlm.nih.gov/10734067" }, { "database": "PubMed", "id": "10734308", "url": "https://pubmed.ncbi.nlm.nih.gov/10734308" }, { "database": "PubMed", "id": "10749144", "url": "https://pubmed.ncbi.nlm.nih.gov/10749144" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10860736", "url": "https://pubmed.ncbi.nlm.nih.gov/10860736" }, { "database": "PubMed", "id": "10930428", "url": "https://pubmed.ncbi.nlm.nih.gov/10930428" }, { "database": "PubMed", "id": "11042698", "url": "https://pubmed.ncbi.nlm.nih.gov/11042698" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11096068", "url": "https://pubmed.ncbi.nlm.nih.gov/11096068" }, { "database": "PubMed", "id": "11099484", "url": "https://pubmed.ncbi.nlm.nih.gov/11099484" }, { "database": "PubMed", "id": "11103796", "url": "https://pubmed.ncbi.nlm.nih.gov/11103796" }, { "database": "PubMed", "id": "11121242", "url": "https://pubmed.ncbi.nlm.nih.gov/11121242" }, { "database": "PubMed", "id": "11149936", "url": "https://pubmed.ncbi.nlm.nih.gov/11149936" }, { "database": "PubMed", "id": "11244509", "url": "https://pubmed.ncbi.nlm.nih.gov/11244509" }, { "database": "PubMed", "id": "11245472", "url": "https://pubmed.ncbi.nlm.nih.gov/11245472" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11313957", "url": "https://pubmed.ncbi.nlm.nih.gov/11313957" }, { "database": "PubMed", "id": "11314044", "url": "https://pubmed.ncbi.nlm.nih.gov/11314044" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11326311", "url": "https://pubmed.ncbi.nlm.nih.gov/11326311" }, { "database": "PubMed", "id": "11397945", "url": "https://pubmed.ncbi.nlm.nih.gov/11397945" }, { "database": "PubMed", "id": "11447225", "url": "https://pubmed.ncbi.nlm.nih.gov/11447225" }, { "database": "PubMed", "id": "11470744", "url": "https://pubmed.ncbi.nlm.nih.gov/11470744" }, { "database": "PubMed", "id": "11483158", "url": "https://pubmed.ncbi.nlm.nih.gov/11483158" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11495913", "url": "https://pubmed.ncbi.nlm.nih.gov/11495913" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11568365", "url": "https://pubmed.ncbi.nlm.nih.gov/11568365" }, { "database": "PubMed", "id": "11583595", "url": "https://pubmed.ncbi.nlm.nih.gov/11583595" }, { "database": "PubMed", "id": "11602639", "url": "https://pubmed.ncbi.nlm.nih.gov/11602639" }, { "database": "PubMed", "id": "11706017", "url": "https://pubmed.ncbi.nlm.nih.gov/11706017" }, { "database": "PubMed", "id": "11709713", "url": "https://pubmed.ncbi.nlm.nih.gov/11709713" }, { "database": "PubMed", "id": "11751391", "url": "https://pubmed.ncbi.nlm.nih.gov/11751391" }, { "database": "PubMed", "id": "11850826", "url": "https://pubmed.ncbi.nlm.nih.gov/11850826" }, { "database": "PubMed", "id": "11857452", "url": "https://pubmed.ncbi.nlm.nih.gov/11857452" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11865061", "url": "https://pubmed.ncbi.nlm.nih.gov/11865061" }, { "database": "PubMed", "id": "11875057", "url": "https://pubmed.ncbi.nlm.nih.gov/11875057" }, { "database": "PubMed", "id": "11877452", "url": "https://pubmed.ncbi.nlm.nih.gov/11877452" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "11927575", "url": "https://pubmed.ncbi.nlm.nih.gov/11927575" }, { "database": "PubMed", "id": "11965244", "url": "https://pubmed.ncbi.nlm.nih.gov/11965244" }, { "database": "PubMed", "id": "11973611", "url": "https://pubmed.ncbi.nlm.nih.gov/11973611" }, { "database": "PubMed", "id": "12066222", "url": "https://pubmed.ncbi.nlm.nih.gov/12066222" }, { "database": "PubMed", "id": "12071847", "url": "https://pubmed.ncbi.nlm.nih.gov/12071847" }, { "database": "PubMed", "id": "12082025", "url": "https://pubmed.ncbi.nlm.nih.gov/12082025" }, { "database": "PubMed", "id": "12082529", "url": "https://pubmed.ncbi.nlm.nih.gov/12082529" }, { "database": "PubMed", "id": "12091386", "url": "https://pubmed.ncbi.nlm.nih.gov/12091386" }, { "database": "PubMed", "id": "12131363", "url": "https://pubmed.ncbi.nlm.nih.gov/12131363" }, { "database": "PubMed", "id": "12145207", "url": "https://pubmed.ncbi.nlm.nih.gov/12145207" }, { "database": "PubMed", "id": "12151394", "url": "https://pubmed.ncbi.nlm.nih.gov/12151394" }, { "database": "PubMed", "id": "12238331", "url": "https://pubmed.ncbi.nlm.nih.gov/12238331" }, { "database": "PubMed", "id": "12381304", "url": "https://pubmed.ncbi.nlm.nih.gov/12381304" }, { "database": "PubMed", "id": "12393500", "url": "https://pubmed.ncbi.nlm.nih.gov/12393500" }, { "database": "PubMed", "id": "12419181", "url": "https://pubmed.ncbi.nlm.nih.gov/12419181" }, { "database": "PubMed", "id": "12427754", "url": "https://pubmed.ncbi.nlm.nih.gov/12427754" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12478472", "url": "https://pubmed.ncbi.nlm.nih.gov/12478472" }, { "database": "PubMed", "id": "12518062", "url": "https://pubmed.ncbi.nlm.nih.gov/12518062" }, { "database": "PubMed", "id": "12519780", "url": "https://pubmed.ncbi.nlm.nih.gov/12519780" }, { "database": "PubMed", "id": "12531896", "url": "https://pubmed.ncbi.nlm.nih.gov/12531896" }, { "database": "PubMed", "id": "12534344", "url": "https://pubmed.ncbi.nlm.nih.gov/12534344" }, { "database": "PubMed", "id": "12584171", "url": "https://pubmed.ncbi.nlm.nih.gov/12584171" }, { "database": "PubMed", "id": "12606123", "url": "https://pubmed.ncbi.nlm.nih.gov/12606123" }, { "database": "PubMed", "id": "12612087", "url": "https://pubmed.ncbi.nlm.nih.gov/12612087" }, { "database": "PubMed", "id": "12644594", "url": "https://pubmed.ncbi.nlm.nih.gov/12644594" }, { "database": "PubMed", "id": "12659830", "url": "https://pubmed.ncbi.nlm.nih.gov/12659830" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12698201", "url": "https://pubmed.ncbi.nlm.nih.gov/12698201" }, { "database": "PubMed", "id": "12702572", "url": "https://pubmed.ncbi.nlm.nih.gov/12702572" }, { "database": "PubMed", "id": "12719724", "url": "https://pubmed.ncbi.nlm.nih.gov/12719724" }, { "database": "PubMed", "id": "12756247", "url": "https://pubmed.ncbi.nlm.nih.gov/12756247" }, { "database": "PubMed", "id": "12767922", "url": "https://pubmed.ncbi.nlm.nih.gov/12767922" }, { "database": "PubMed", "id": "12811820", "url": "https://pubmed.ncbi.nlm.nih.gov/12811820" }, { "database": "PubMed", "id": "12853888", "url": "https://pubmed.ncbi.nlm.nih.gov/12853888" }, { "database": "PubMed", "id": "12857758", "url": "https://pubmed.ncbi.nlm.nih.gov/12857758" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12902982", "url": "https://pubmed.ncbi.nlm.nih.gov/12902982" }, { "database": "PubMed", "id": "12912974", "url": "https://pubmed.ncbi.nlm.nih.gov/12912974" }, { "database": "PubMed", "id": "12919932", "url": "https://pubmed.ncbi.nlm.nih.gov/12919932" }, { "database": "PubMed", "id": "12939400", "url": "https://pubmed.ncbi.nlm.nih.gov/12939400" }, { "database": "PubMed", "id": "12951835", "url": "https://pubmed.ncbi.nlm.nih.gov/12951835" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "12968928", "url": "https://pubmed.ncbi.nlm.nih.gov/12968928" }, { "database": "PubMed", "id": "13678348", "url": "https://pubmed.ncbi.nlm.nih.gov/13678348" }, { "database": "PubMed", "id": "1406679", "url": "https://pubmed.ncbi.nlm.nih.gov/1406679" }, { "database": "PubMed", "id": "14511359", "url": "https://pubmed.ncbi.nlm.nih.gov/14511359" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14527925", "url": "https://pubmed.ncbi.nlm.nih.gov/14527925" }, { "database": "PubMed", "id": "14559802", "url": "https://pubmed.ncbi.nlm.nih.gov/14559802" }, { "database": "PubMed", "id": "14612532", "url": "https://pubmed.ncbi.nlm.nih.gov/14612532" }, { "database": "PubMed", "id": "14617104", "url": "https://pubmed.ncbi.nlm.nih.gov/14617104" }, { "database": "PubMed", "id": "14623946", "url": "https://pubmed.ncbi.nlm.nih.gov/14623946" }, { "database": "PubMed", "id": "14637186", "url": "https://pubmed.ncbi.nlm.nih.gov/14637186" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14755247", "url": "https://pubmed.ncbi.nlm.nih.gov/14755247" }, { "database": "PubMed", "id": "14757188", "url": "https://pubmed.ncbi.nlm.nih.gov/14757188" }, { "database": "PubMed", "id": "14871840", "url": "https://pubmed.ncbi.nlm.nih.gov/14871840" }, { "database": "PubMed", "id": "14965474", "url": "https://pubmed.ncbi.nlm.nih.gov/14965474" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "14968111", "url": "https://pubmed.ncbi.nlm.nih.gov/14968111" }, { "database": "PubMed", "id": "14993250", "url": "https://pubmed.ncbi.nlm.nih.gov/14993250" }, { "database": "PubMed", "id": "15001399", "url": "https://pubmed.ncbi.nlm.nih.gov/15001399" }, { "database": "PubMed", "id": "15026814", "url": "https://pubmed.ncbi.nlm.nih.gov/15026814" }, { "database": "PubMed", "id": "15077171", "url": "https://pubmed.ncbi.nlm.nih.gov/15077171" }, { "database": "PubMed", "id": "15081425", "url": "https://pubmed.ncbi.nlm.nih.gov/15081425" }, { "database": "PubMed", "id": "15095398", "url": "https://pubmed.ncbi.nlm.nih.gov/15095398" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15159397", "url": "https://pubmed.ncbi.nlm.nih.gov/15159397" }, { "database": "PubMed", "id": "15159417", "url": "https://pubmed.ncbi.nlm.nih.gov/15159417" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15178317", "url": "https://pubmed.ncbi.nlm.nih.gov/15178317" }, { "database": "PubMed", "id": "15178764", "url": "https://pubmed.ncbi.nlm.nih.gov/15178764" }, { "database": "PubMed", "id": "15181149", "url": "https://pubmed.ncbi.nlm.nih.gov/15181149" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15199542", "url": "https://pubmed.ncbi.nlm.nih.gov/15199542" }, { "database": "PubMed", "id": "15226436", "url": "https://pubmed.ncbi.nlm.nih.gov/15226436" }, { "database": "PubMed", "id": "15252149", "url": "https://pubmed.ncbi.nlm.nih.gov/15252149" }, { "database": "PubMed", "id": "15254178", "url": "https://pubmed.ncbi.nlm.nih.gov/15254178" }, { "database": "PubMed", "id": "15289875", "url": "https://pubmed.ncbi.nlm.nih.gov/15289875" }, { "database": "PubMed", "id": "15310764", "url": "https://pubmed.ncbi.nlm.nih.gov/15310764" }, { "database": "PubMed", "id": "15322239", "url": "https://pubmed.ncbi.nlm.nih.gov/15322239" }, { "database": "PubMed", "id": "15355354", "url": "https://pubmed.ncbi.nlm.nih.gov/15355354" }, { "database": "PubMed", "id": "15381086", "url": "https://pubmed.ncbi.nlm.nih.gov/15381086" }, { "database": "PubMed", "id": "15456759", "url": "https://pubmed.ncbi.nlm.nih.gov/15456759" }, { "database": "PubMed", "id": "15464845", "url": "https://pubmed.ncbi.nlm.nih.gov/15464845" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15474986", "url": "https://pubmed.ncbi.nlm.nih.gov/15474986" }, { "database": "PubMed", "id": "15489892", "url": "https://pubmed.ncbi.nlm.nih.gov/15489892" }, { "database": "PubMed", "id": "15492510", "url": "https://pubmed.ncbi.nlm.nih.gov/15492510" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15533933", "url": "https://pubmed.ncbi.nlm.nih.gov/15533933" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15542774", "url": "https://pubmed.ncbi.nlm.nih.gov/15542774" }, { "database": "PubMed", "id": "15557124", "url": "https://pubmed.ncbi.nlm.nih.gov/15557124" }, { "database": "PubMed", "id": "15613785", "url": "https://pubmed.ncbi.nlm.nih.gov/15613785" }, { "database": "PubMed", "id": "15650224", "url": "https://pubmed.ncbi.nlm.nih.gov/15650224" }, { "database": "PubMed", "id": "15657356", "url": "https://pubmed.ncbi.nlm.nih.gov/15657356" }, { "database": "PubMed", "id": "15710360", "url": "https://pubmed.ncbi.nlm.nih.gov/15710360" }, { "database": "PubMed", "id": "15713892", "url": "https://pubmed.ncbi.nlm.nih.gov/15713892" }, { "database": "PubMed", "id": "15720815", "url": "https://pubmed.ncbi.nlm.nih.gov/15720815" }, { "database": "PubMed", "id": "15735102", "url": "https://pubmed.ncbi.nlm.nih.gov/15735102" }, { "database": "PubMed", "id": "15752772", "url": "https://pubmed.ncbi.nlm.nih.gov/15752772" }, { "database": "PubMed", "id": "15782130", "url": "https://pubmed.ncbi.nlm.nih.gov/15782130" }, { "database": "PubMed", "id": "15794754", "url": "https://pubmed.ncbi.nlm.nih.gov/15794754" }, { "database": "PubMed", "id": "15795939", "url": "https://pubmed.ncbi.nlm.nih.gov/15795939" }, { "database": "PubMed", "id": "15837074", "url": "https://pubmed.ncbi.nlm.nih.gov/15837074" }, { "database": "PubMed", "id": "15845651", "url": "https://pubmed.ncbi.nlm.nih.gov/15845651" }, { "database": "PubMed", "id": "15867353", "url": "https://pubmed.ncbi.nlm.nih.gov/15867353" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "15908423", "url": "https://pubmed.ncbi.nlm.nih.gov/15908423" }, { "database": "PubMed", "id": "16024610", "url": "https://pubmed.ncbi.nlm.nih.gov/16024610" }, { "database": "PubMed", "id": "16024799", "url": "https://pubmed.ncbi.nlm.nih.gov/16024799" }, { "database": "PubMed", "id": "16043514", "url": "https://pubmed.ncbi.nlm.nih.gov/16043514" }, { "database": "PubMed", "id": "16082226", "url": "https://pubmed.ncbi.nlm.nih.gov/16082226" }, { "database": "PubMed", "id": "16096427", "url": "https://pubmed.ncbi.nlm.nih.gov/16096427" }, { "database": "PubMed", "id": "16103197", "url": "https://pubmed.ncbi.nlm.nih.gov/16103197" }, { "database": "PubMed", "id": "16140041", "url": "https://pubmed.ncbi.nlm.nih.gov/16140041" }, { "database": "PubMed", "id": "16177561", "url": "https://pubmed.ncbi.nlm.nih.gov/16177561" }, { "database": "PubMed", "id": "16179498", "url": "https://pubmed.ncbi.nlm.nih.gov/16179498" }, { "database": "PubMed", "id": "16180010", "url": "https://pubmed.ncbi.nlm.nih.gov/16180010" }, { "database": "PubMed", "id": "16227412", "url": "https://pubmed.ncbi.nlm.nih.gov/16227412" }, { "database": "PubMed", "id": "16229013", "url": "https://pubmed.ncbi.nlm.nih.gov/16229013" }, { "database": "PubMed", "id": "16302093", "url": "https://pubmed.ncbi.nlm.nih.gov/16302093" }, { "database": "PubMed", "id": "16313886", "url": "https://pubmed.ncbi.nlm.nih.gov/16313886" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16322229", "url": "https://pubmed.ncbi.nlm.nih.gov/16322229" }, { "database": "PubMed", "id": "16397295", "url": "https://pubmed.ncbi.nlm.nih.gov/16397295" }, { "database": "PubMed", "id": "16414131", "url": "https://pubmed.ncbi.nlm.nih.gov/16414131" }, { "database": "PubMed", "id": "16433685", "url": "https://pubmed.ncbi.nlm.nih.gov/16433685" }, { "database": "PubMed", "id": "16436515", "url": "https://pubmed.ncbi.nlm.nih.gov/16436515" }, { "database": "PubMed", "id": "16474133", "url": "https://pubmed.ncbi.nlm.nih.gov/16474133" }, { "database": "PubMed", "id": "16489034", "url": "https://pubmed.ncbi.nlm.nih.gov/16489034" }, { "database": "PubMed", "id": "16501611", "url": "https://pubmed.ncbi.nlm.nih.gov/16501611" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16538517", "url": "https://pubmed.ncbi.nlm.nih.gov/16538517" }, { "database": "PubMed", "id": "16584535", "url": "https://pubmed.ncbi.nlm.nih.gov/16584535" }, { "database": "PubMed", "id": "16600182", "url": "https://pubmed.ncbi.nlm.nih.gov/16600182" }, { "database": "PubMed", "id": "16611888", "url": "https://pubmed.ncbi.nlm.nih.gov/16611888" }, { "database": "PubMed", "id": "16618811", "url": "https://pubmed.ncbi.nlm.nih.gov/16618811" }, { "database": "PubMed", "id": "16630142", "url": "https://pubmed.ncbi.nlm.nih.gov/16630142" }, { "database": "PubMed", "id": "16632641", "url": "https://pubmed.ncbi.nlm.nih.gov/16632641" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16705155", "url": "https://pubmed.ncbi.nlm.nih.gov/16705155" }, { "database": "PubMed", "id": "16714289", "url": "https://pubmed.ncbi.nlm.nih.gov/16714289" }, { "database": "PubMed", "id": "16715525", "url": "https://pubmed.ncbi.nlm.nih.gov/16715525" }, { "database": "PubMed", "id": "16731759", "url": "https://pubmed.ncbi.nlm.nih.gov/16731759" }, { "database": "PubMed", "id": "16751801", "url": "https://pubmed.ncbi.nlm.nih.gov/16751801" }, { "database": "PubMed", "id": "16753148", "url": "https://pubmed.ncbi.nlm.nih.gov/16753148" }, { "database": "PubMed", "id": "16777994", "url": "https://pubmed.ncbi.nlm.nih.gov/16777994" }, { "database": "PubMed", "id": "16778146", "url": "https://pubmed.ncbi.nlm.nih.gov/16778146" }, { "database": "PubMed", "id": "16801388", "url": "https://pubmed.ncbi.nlm.nih.gov/16801388" }, { "database": "PubMed", "id": "16814113", "url": "https://pubmed.ncbi.nlm.nih.gov/16814113" }, { "database": "PubMed", "id": "16815295", "url": "https://pubmed.ncbi.nlm.nih.gov/16815295" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16827804", "url": "https://pubmed.ncbi.nlm.nih.gov/16827804" }, { "database": "PubMed", "id": "16891474", "url": "https://pubmed.ncbi.nlm.nih.gov/16891474" }, { "database": "PubMed", "id": "16912307", "url": "https://pubmed.ncbi.nlm.nih.gov/16912307" }, { "database": "PubMed", "id": "16928824", "url": "https://pubmed.ncbi.nlm.nih.gov/16928824" }, { "database": "PubMed", "id": "16966622", "url": "https://pubmed.ncbi.nlm.nih.gov/16966622" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "16971507", "url": "https://pubmed.ncbi.nlm.nih.gov/16971507" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "17113036", "url": "https://pubmed.ncbi.nlm.nih.gov/17113036" }, { "database": "PubMed", "id": "17126818", "url": "https://pubmed.ncbi.nlm.nih.gov/17126818" }, { "database": "PubMed", "id": "17172431", "url": "https://pubmed.ncbi.nlm.nih.gov/17172431" }, { "database": "PubMed", "id": "17174366", "url": "https://pubmed.ncbi.nlm.nih.gov/17174366" }, { "database": "PubMed", "id": "17230520", "url": "https://pubmed.ncbi.nlm.nih.gov/17230520" }, { "database": "PubMed", "id": "17241873", "url": "https://pubmed.ncbi.nlm.nih.gov/17241873" }, { "database": "PubMed", "id": "17257432", "url": "https://pubmed.ncbi.nlm.nih.gov/17257432" }, { "database": "PubMed", "id": "17292432", "url": "https://pubmed.ncbi.nlm.nih.gov/17292432" }, { "database": "PubMed", "id": "17297446", "url": "https://pubmed.ncbi.nlm.nih.gov/17297446" }, { "database": "PubMed", "id": "17301063", "url": "https://pubmed.ncbi.nlm.nih.gov/17301063" }, { "database": "PubMed", "id": "17332930", "url": "https://pubmed.ncbi.nlm.nih.gov/17332930" }, { "database": "PubMed", "id": "17334779", "url": "https://pubmed.ncbi.nlm.nih.gov/17334779" }, { "database": "PubMed", "id": "17456577", "url": "https://pubmed.ncbi.nlm.nih.gov/17456577" }, { "database": "PubMed", "id": "17509529", "url": "https://pubmed.ncbi.nlm.nih.gov/17509529" }, { "database": "PubMed", "id": "17510082", "url": "https://pubmed.ncbi.nlm.nih.gov/17510082" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17512204", "url": "https://pubmed.ncbi.nlm.nih.gov/17512204" }, { "database": "PubMed", "id": "17517898", "url": "https://pubmed.ncbi.nlm.nih.gov/17517898" }, { "database": "PubMed", "id": "17524349", "url": "https://pubmed.ncbi.nlm.nih.gov/17524349" }, { "database": "PubMed", "id": "17535811", "url": "https://pubmed.ncbi.nlm.nih.gov/17535811" }, { "database": "PubMed", "id": "17575952", "url": "https://pubmed.ncbi.nlm.nih.gov/17575952" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17596534", "url": "https://pubmed.ncbi.nlm.nih.gov/17596534" }, { "database": "PubMed", "id": "17610031", "url": "https://pubmed.ncbi.nlm.nih.gov/17610031" }, { "database": "PubMed", "id": "17612589", "url": "https://pubmed.ncbi.nlm.nih.gov/17612589" }, { "database": "PubMed", "id": "17616578", "url": "https://pubmed.ncbi.nlm.nih.gov/17616578" }, { "database": "PubMed", "id": "17668048", "url": "https://pubmed.ncbi.nlm.nih.gov/17668048" }, { "database": "PubMed", "id": "17707793", "url": "https://pubmed.ncbi.nlm.nih.gov/17707793" }, { "database": "PubMed", "id": "17712528", "url": "https://pubmed.ncbi.nlm.nih.gov/17712528" }, { "database": "PubMed", "id": "17727682", "url": "https://pubmed.ncbi.nlm.nih.gov/17727682" }, { "database": "PubMed", "id": "17803907", "url": "https://pubmed.ncbi.nlm.nih.gov/17803907" }, { "database": "PubMed", "id": "17854787", "url": "https://pubmed.ncbi.nlm.nih.gov/17854787" }, { "database": "PubMed", "id": "17855337", "url": "https://pubmed.ncbi.nlm.nih.gov/17855337" }, { "database": "PubMed", "id": "17894897", "url": "https://pubmed.ncbi.nlm.nih.gov/17894897" }, { "database": "PubMed", "id": "17903248", "url": "https://pubmed.ncbi.nlm.nih.gov/17903248" }, { "database": "PubMed", "id": "17918180", "url": "https://pubmed.ncbi.nlm.nih.gov/17918180" }, { "database": "PubMed", "id": "17919456", "url": "https://pubmed.ncbi.nlm.nih.gov/17919456" }, { "database": "PubMed", "id": "17932621", "url": "https://pubmed.ncbi.nlm.nih.gov/17932621" }, { "database": "PubMed", "id": "17932951", "url": "https://pubmed.ncbi.nlm.nih.gov/17932951" }, { "database": "PubMed", "id": "17940507", "url": "https://pubmed.ncbi.nlm.nih.gov/17940507" }, { "database": "PubMed", "id": "17967874", "url": "https://pubmed.ncbi.nlm.nih.gov/17967874" }, { "database": "PubMed", "id": "17971768", "url": "https://pubmed.ncbi.nlm.nih.gov/17971768" }, { "database": "PubMed", "id": "17977830", "url": "https://pubmed.ncbi.nlm.nih.gov/17977830" }, { "database": "PubMed", "id": "18032786", "url": "https://pubmed.ncbi.nlm.nih.gov/18032786" }, { "database": "PubMed", "id": "18048073", "url": "https://pubmed.ncbi.nlm.nih.gov/18048073" }, { "database": "PubMed", "id": "18082226", "url": "https://pubmed.ncbi.nlm.nih.gov/18082226" }, { "database": "PubMed", "id": "18085531", "url": "https://pubmed.ncbi.nlm.nih.gov/18085531" }, { "database": "PubMed", "id": "18187512", "url": "https://pubmed.ncbi.nlm.nih.gov/18187512" }, { "database": "PubMed", "id": "18191923", "url": "https://pubmed.ncbi.nlm.nih.gov/18191923" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18272544", "url": "https://pubmed.ncbi.nlm.nih.gov/18272544" }, { "database": "PubMed", "id": "18289623", "url": "https://pubmed.ncbi.nlm.nih.gov/18289623" }, { "database": "PubMed", "id": "18294283", "url": "https://pubmed.ncbi.nlm.nih.gov/18294283" }, { "database": "PubMed", "id": "18311036", "url": "https://pubmed.ncbi.nlm.nih.gov/18311036" }, { "database": "PubMed", "id": "18339864", "url": "https://pubmed.ncbi.nlm.nih.gov/18339864" }, { "database": "PubMed", "id": "18344606", "url": "https://pubmed.ncbi.nlm.nih.gov/18344606" }, { "database": "PubMed", "id": "18348731", "url": "https://pubmed.ncbi.nlm.nih.gov/18348731" }, { "database": "PubMed", "id": "18366759", "url": "https://pubmed.ncbi.nlm.nih.gov/18366759" }, { "database": "PubMed", "id": "18381438", "url": "https://pubmed.ncbi.nlm.nih.gov/18381438" }, { "database": "PubMed", "id": "18406507", "url": "https://pubmed.ncbi.nlm.nih.gov/18406507" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18446786", "url": "https://pubmed.ncbi.nlm.nih.gov/18446786" }, { "database": "PubMed", "id": "18455128", "url": "https://pubmed.ncbi.nlm.nih.gov/18455128" }, { "database": "PubMed", "id": "18479896", "url": "https://pubmed.ncbi.nlm.nih.gov/18479896" }, { "database": "PubMed", "id": "18497347", "url": "https://pubmed.ncbi.nlm.nih.gov/18497347" }, { "database": "PubMed", "id": "18504176", "url": "https://pubmed.ncbi.nlm.nih.gov/18504176" }, { "database": "PubMed", "id": "18511169", "url": "https://pubmed.ncbi.nlm.nih.gov/18511169" }, { "database": "PubMed", "id": "18519674", "url": "https://pubmed.ncbi.nlm.nih.gov/18519674" }, { "database": "PubMed", "id": "18523653", "url": "https://pubmed.ncbi.nlm.nih.gov/18523653" }, { "database": "PubMed", "id": "18540044", "url": "https://pubmed.ncbi.nlm.nih.gov/18540044" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18585854", "url": "https://pubmed.ncbi.nlm.nih.gov/18585854" }, { "database": "PubMed", "id": "18589416", "url": "https://pubmed.ncbi.nlm.nih.gov/18589416" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18604166", "url": "https://pubmed.ncbi.nlm.nih.gov/18604166" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18642443", "url": "https://pubmed.ncbi.nlm.nih.gov/18642443" }, { "database": "PubMed", "id": "18660513", "url": "https://pubmed.ncbi.nlm.nih.gov/18660513" }, { "database": "PubMed", "id": "18661100", "url": "https://pubmed.ncbi.nlm.nih.gov/18661100" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18760266", "url": "https://pubmed.ncbi.nlm.nih.gov/18760266" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "18785202", "url": "https://pubmed.ncbi.nlm.nih.gov/18785202" }, { "database": "PubMed", "id": "18791269", "url": "https://pubmed.ncbi.nlm.nih.gov/18791269" }, { "database": "PubMed", "id": "18802408", "url": "https://pubmed.ncbi.nlm.nih.gov/18802408" }, { "database": "PubMed", "id": "18847491", "url": "https://pubmed.ncbi.nlm.nih.gov/18847491" }, { "database": "PubMed", "id": "18852884", "url": "https://pubmed.ncbi.nlm.nih.gov/18852884" }, { "database": "PubMed", "id": "18947885", "url": "https://pubmed.ncbi.nlm.nih.gov/18947885" }, { "database": "PubMed", "id": "19064630", "url": "https://pubmed.ncbi.nlm.nih.gov/19064630" }, { "database": "PubMed", "id": "19067706", "url": "https://pubmed.ncbi.nlm.nih.gov/19067706" }, { "database": "PubMed", "id": "19095450", "url": "https://pubmed.ncbi.nlm.nih.gov/19095450" }, { "database": "PubMed", "id": "19112505", "url": "https://pubmed.ncbi.nlm.nih.gov/19112505" }, { "database": "PubMed", "id": "19139065", "url": "https://pubmed.ncbi.nlm.nih.gov/19139065" }, { "database": "PubMed", "id": "19148495", "url": "https://pubmed.ncbi.nlm.nih.gov/19148495" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19166313", "url": "https://pubmed.ncbi.nlm.nih.gov/19166313" }, { "database": "PubMed", "id": "19221002", "url": "https://pubmed.ncbi.nlm.nih.gov/19221002" }, { "database": "PubMed", "id": "19225536", "url": "https://pubmed.ncbi.nlm.nih.gov/19225536" }, { "database": "PubMed", "id": "19295133", "url": "https://pubmed.ncbi.nlm.nih.gov/19295133" }, { "database": "PubMed", "id": "19303885", "url": "https://pubmed.ncbi.nlm.nih.gov/19303885" }, { "database": "PubMed", "id": "19357962", "url": "https://pubmed.ncbi.nlm.nih.gov/19357962" }, { "database": "PubMed", "id": "19363523", "url": "https://pubmed.ncbi.nlm.nih.gov/19363523" }, { "database": "PubMed", "id": "19373864", "url": "https://pubmed.ncbi.nlm.nih.gov/19373864" }, { "database": "PubMed", "id": "19397953", "url": "https://pubmed.ncbi.nlm.nih.gov/19397953" }, { "database": "PubMed", "id": "19398950", "url": "https://pubmed.ncbi.nlm.nih.gov/19398950" }, { "database": "PubMed", "id": "19426797", "url": "https://pubmed.ncbi.nlm.nih.gov/19426797" }, { "database": "PubMed", "id": "19454177", "url": "https://pubmed.ncbi.nlm.nih.gov/19454177" }, { "database": "PubMed", "id": "19459175", "url": "https://pubmed.ncbi.nlm.nih.gov/19459175" }, { "database": "PubMed", "id": "19525231", "url": "https://pubmed.ncbi.nlm.nih.gov/19525231" }, { "database": "PubMed", "id": "19536869", "url": "https://pubmed.ncbi.nlm.nih.gov/19536869" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19649319", "url": "https://pubmed.ncbi.nlm.nih.gov/19649319" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19660097", "url": "https://pubmed.ncbi.nlm.nih.gov/19660097" }, { "database": "PubMed", "id": "19674456", "url": "https://pubmed.ncbi.nlm.nih.gov/19674456" }, { "database": "PubMed", "id": "19705844", "url": "https://pubmed.ncbi.nlm.nih.gov/19705844" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19821510", "url": "https://pubmed.ncbi.nlm.nih.gov/19821510" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19934315", "url": "https://pubmed.ncbi.nlm.nih.gov/19934315" }, { "database": "PubMed", "id": "19952118", "url": "https://pubmed.ncbi.nlm.nih.gov/19952118" }, { "database": "PubMed", "id": "19960411", "url": "https://pubmed.ncbi.nlm.nih.gov/19960411" }, { "database": "PubMed", "id": "20005456", "url": "https://pubmed.ncbi.nlm.nih.gov/20005456" }, { "database": "PubMed", "id": "20005840", "url": "https://pubmed.ncbi.nlm.nih.gov/20005840" }, { "database": "PubMed", "id": "20016737", "url": "https://pubmed.ncbi.nlm.nih.gov/20016737" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20060030", "url": "https://pubmed.ncbi.nlm.nih.gov/20060030" }, { "database": "PubMed", "id": "20085646", "url": "https://pubmed.ncbi.nlm.nih.gov/20085646" }, { "database": "PubMed", "id": "20092938", "url": "https://pubmed.ncbi.nlm.nih.gov/20092938" }, { "database": "PubMed", "id": "20097305", "url": "https://pubmed.ncbi.nlm.nih.gov/20097305" }, { "database": "PubMed", "id": "20123963", "url": "https://pubmed.ncbi.nlm.nih.gov/20123963" }, { "database": "PubMed", "id": "20187950", "url": "https://pubmed.ncbi.nlm.nih.gov/20187950" }, { "database": "PubMed", "id": "20219657", "url": "https://pubmed.ncbi.nlm.nih.gov/20219657" }, { "database": "PubMed", "id": "20226587", "url": "https://pubmed.ncbi.nlm.nih.gov/20226587" }, { "database": "PubMed", "id": "20308316", "url": "https://pubmed.ncbi.nlm.nih.gov/20308316" }, { "database": "PubMed", "id": "20353948", "url": "https://pubmed.ncbi.nlm.nih.gov/20353948" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20413215", "url": "https://pubmed.ncbi.nlm.nih.gov/20413215" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20432447", "url": "https://pubmed.ncbi.nlm.nih.gov/20432447" }, { "database": "PubMed", "id": "20456495", "url": "https://pubmed.ncbi.nlm.nih.gov/20456495" }, { "database": "PubMed", "id": "20484174", "url": "https://pubmed.ncbi.nlm.nih.gov/20484174" }, { "database": "PubMed", "id": "20499882", "url": "https://pubmed.ncbi.nlm.nih.gov/20499882" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20543986", "url": "https://pubmed.ncbi.nlm.nih.gov/20543986" }, { "database": "PubMed", "id": "20549306", "url": "https://pubmed.ncbi.nlm.nih.gov/20549306" }, { "database": "PubMed", "id": "20566882", "url": "https://pubmed.ncbi.nlm.nih.gov/20566882" }, { "database": "PubMed", "id": "20622265", "url": "https://pubmed.ncbi.nlm.nih.gov/20622265" }, { "database": "PubMed", "id": "20663147", "url": "https://pubmed.ncbi.nlm.nih.gov/20663147" }, { "database": "PubMed", "id": "20693977", "url": "https://pubmed.ncbi.nlm.nih.gov/20693977" }, { "database": "PubMed", "id": "20708607", "url": "https://pubmed.ncbi.nlm.nih.gov/20708607" }, { "database": "PubMed", "id": "20717878", "url": "https://pubmed.ncbi.nlm.nih.gov/20717878" }, { "database": "PubMed", "id": "20809980", "url": "https://pubmed.ncbi.nlm.nih.gov/20809980" }, { "database": "PubMed", "id": "20840867", "url": "https://pubmed.ncbi.nlm.nih.gov/20840867" }, { "database": "PubMed", "id": "20886098", "url": "https://pubmed.ncbi.nlm.nih.gov/20886098" }, { "database": "PubMed", "id": "20931131", "url": "https://pubmed.ncbi.nlm.nih.gov/20931131" }, { "database": "PubMed", "id": "20948430", "url": "https://pubmed.ncbi.nlm.nih.gov/20948430" }, { "database": "PubMed", "id": "20974518", "url": "https://pubmed.ncbi.nlm.nih.gov/20974518" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "21045015", "url": "https://pubmed.ncbi.nlm.nih.gov/21045015" }, { "database": "PubMed", "id": "21078665", "url": "https://pubmed.ncbi.nlm.nih.gov/21078665" }, { "database": "PubMed", "id": "21114963", "url": "https://pubmed.ncbi.nlm.nih.gov/21114963" }, { "database": "PubMed", "id": "21118815", "url": "https://pubmed.ncbi.nlm.nih.gov/21118815" }, { "database": "PubMed", "id": "21163364", "url": "https://pubmed.ncbi.nlm.nih.gov/21163364" }, { "database": "PubMed", "id": "21167122", "url": "https://pubmed.ncbi.nlm.nih.gov/21167122" }, { "database": "PubMed", "id": "21225623", "url": "https://pubmed.ncbi.nlm.nih.gov/21225623" }, { "database": "PubMed", "id": "21261644", "url": "https://pubmed.ncbi.nlm.nih.gov/21261644" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21361779", "url": "https://pubmed.ncbi.nlm.nih.gov/21361779" }, { "database": "PubMed", "id": "21368894", "url": "https://pubmed.ncbi.nlm.nih.gov/21368894" }, { "database": "PubMed", "id": "21376392", "url": "https://pubmed.ncbi.nlm.nih.gov/21376392" }, { "database": "PubMed", "id": "21383020", "url": "https://pubmed.ncbi.nlm.nih.gov/21383020" }, { "database": "PubMed", "id": "21383696", "url": "https://pubmed.ncbi.nlm.nih.gov/21383696" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21394211", "url": "https://pubmed.ncbi.nlm.nih.gov/21394211" }, { "database": "PubMed", "id": "21432907", "url": "https://pubmed.ncbi.nlm.nih.gov/21432907" }, { "database": "PubMed", "id": "21451571", "url": "https://pubmed.ncbi.nlm.nih.gov/21451571" }, { "database": "PubMed", "id": "21465263", "url": "https://pubmed.ncbi.nlm.nih.gov/21465263" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21532991", "url": "https://pubmed.ncbi.nlm.nih.gov/21532991" }, { "database": "PubMed", "id": "21549095", "url": "https://pubmed.ncbi.nlm.nih.gov/21549095" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21576488", "url": "https://pubmed.ncbi.nlm.nih.gov/21576488" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21653549", "url": "https://pubmed.ncbi.nlm.nih.gov/21653549" }, { "database": "PubMed", "id": "21663643", "url": "https://pubmed.ncbi.nlm.nih.gov/21663643" }, { "database": "PubMed", "id": "21687937", "url": "https://pubmed.ncbi.nlm.nih.gov/21687937" }, { "database": "PubMed", "id": "21725357", "url": "https://pubmed.ncbi.nlm.nih.gov/21725357" }, { "database": "PubMed", "id": "21783897", "url": "https://pubmed.ncbi.nlm.nih.gov/21783897" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21809388", "url": "https://pubmed.ncbi.nlm.nih.gov/21809388" }, { "database": "PubMed", "id": "21840268", "url": "https://pubmed.ncbi.nlm.nih.gov/21840268" }, { "database": "PubMed", "id": "21857991", "url": "https://pubmed.ncbi.nlm.nih.gov/21857991" }, { "database": "PubMed", "id": "21866568", "url": "https://pubmed.ncbi.nlm.nih.gov/21866568" }, { "database": "PubMed", "id": "21887275", "url": "https://pubmed.ncbi.nlm.nih.gov/21887275" }, { "database": "PubMed", "id": "21909130", "url": "https://pubmed.ncbi.nlm.nih.gov/21909130" }, { "database": "PubMed", "id": "21918620", "url": "https://pubmed.ncbi.nlm.nih.gov/21918620" }, { "database": "PubMed", "id": "21945951", "url": "https://pubmed.ncbi.nlm.nih.gov/21945951" }, { "database": "PubMed", "id": "21960246", "url": "https://pubmed.ncbi.nlm.nih.gov/21960246" }, { "database": "PubMed", "id": "21965754", "url": "https://pubmed.ncbi.nlm.nih.gov/21965754" }, { "database": "PubMed", "id": "21983885", "url": "https://pubmed.ncbi.nlm.nih.gov/21983885" }, { "database": "PubMed", "id": "21997969", "url": "https://pubmed.ncbi.nlm.nih.gov/21997969" }, { "database": "PubMed", "id": "22002314", "url": "https://pubmed.ncbi.nlm.nih.gov/22002314" }, { "database": "PubMed", "id": "22030623", "url": "https://pubmed.ncbi.nlm.nih.gov/22030623" }, { "database": "PubMed", "id": "22114676", "url": "https://pubmed.ncbi.nlm.nih.gov/22114676" }, { "database": "PubMed", "id": "22142405", "url": "https://pubmed.ncbi.nlm.nih.gov/22142405" }, { "database": "PubMed", "id": "22174788", "url": "https://pubmed.ncbi.nlm.nih.gov/22174788" }, { "database": "PubMed", "id": "22190353", "url": "https://pubmed.ncbi.nlm.nih.gov/22190353" }, { "database": "PubMed", "id": "22198295", "url": "https://pubmed.ncbi.nlm.nih.gov/22198295" }, { "database": "PubMed", "id": "22266868", "url": "https://pubmed.ncbi.nlm.nih.gov/22266868" }, { "database": "PubMed", "id": "22288499", "url": "https://pubmed.ncbi.nlm.nih.gov/22288499" }, { "database": "PubMed", "id": "22290291", "url": "https://pubmed.ncbi.nlm.nih.gov/22290291" }, { "database": "PubMed", "id": "22312557", "url": "https://pubmed.ncbi.nlm.nih.gov/22312557" }, { "database": "PubMed", "id": "22331558", "url": "https://pubmed.ncbi.nlm.nih.gov/22331558" }, { "database": "PubMed", "id": "22414726", "url": "https://pubmed.ncbi.nlm.nih.gov/22414726" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22435726", "url": "https://pubmed.ncbi.nlm.nih.gov/22435726" }, { "database": "PubMed", "id": "22447336", "url": "https://pubmed.ncbi.nlm.nih.gov/22447336" }, { "database": "PubMed", "id": "22514710", "url": "https://pubmed.ncbi.nlm.nih.gov/22514710" }, { "database": "PubMed", "id": "22523681", "url": "https://pubmed.ncbi.nlm.nih.gov/22523681" }, { "database": "PubMed", "id": "22555805", "url": "https://pubmed.ncbi.nlm.nih.gov/22555805" }, { "database": "PubMed", "id": "22564437", "url": "https://pubmed.ncbi.nlm.nih.gov/22564437" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22622028", "url": "https://pubmed.ncbi.nlm.nih.gov/22622028" }, { "database": "PubMed", "id": "22627294", "url": "https://pubmed.ncbi.nlm.nih.gov/22627294" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22662266", "url": "https://pubmed.ncbi.nlm.nih.gov/22662266" }, { "database": "PubMed", "id": "22722496", "url": "https://pubmed.ncbi.nlm.nih.gov/22722496" }, { "database": "PubMed", "id": "22767080", "url": "https://pubmed.ncbi.nlm.nih.gov/22767080" }, { "database": "PubMed", "id": "22768036", "url": "https://pubmed.ncbi.nlm.nih.gov/22768036" }, { "database": "PubMed", "id": "22797063", "url": "https://pubmed.ncbi.nlm.nih.gov/22797063" }, { "database": "PubMed", "id": "22807682", "url": "https://pubmed.ncbi.nlm.nih.gov/22807682" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22848370", "url": "https://pubmed.ncbi.nlm.nih.gov/22848370" }, { "database": "PubMed", "id": "22859938", "url": "https://pubmed.ncbi.nlm.nih.gov/22859938" }, { "database": "PubMed", "id": "22888789", "url": "https://pubmed.ncbi.nlm.nih.gov/22888789" }, { "database": "PubMed", "id": "22911714", "url": "https://pubmed.ncbi.nlm.nih.gov/22911714" }, { "database": "PubMed", "id": "22947118", "url": "https://pubmed.ncbi.nlm.nih.gov/22947118" }, { "database": "PubMed", "id": "22954457", "url": "https://pubmed.ncbi.nlm.nih.gov/22954457" }, { "database": "PubMed", "id": "22962590", "url": "https://pubmed.ncbi.nlm.nih.gov/22962590" }, { "database": "PubMed", "id": "22983795", "url": "https://pubmed.ncbi.nlm.nih.gov/22983795" }, { "database": "PubMed", "id": "22996738", "url": "https://pubmed.ncbi.nlm.nih.gov/22996738" }, { "database": "PubMed", "id": "23027622", "url": "https://pubmed.ncbi.nlm.nih.gov/23027622" }, { "database": "PubMed", "id": "23028738", "url": "https://pubmed.ncbi.nlm.nih.gov/23028738" }, { "database": "PubMed", "id": "23034333", "url": "https://pubmed.ncbi.nlm.nih.gov/23034333" }, { "database": "PubMed", "id": "23050037", "url": "https://pubmed.ncbi.nlm.nih.gov/23050037" }, { "database": "PubMed", "id": "23091651", "url": "https://pubmed.ncbi.nlm.nih.gov/23091651" }, { "database": "PubMed", "id": "23108402", "url": "https://pubmed.ncbi.nlm.nih.gov/23108402" }, { "database": "PubMed", "id": "23124353", "url": "https://pubmed.ncbi.nlm.nih.gov/23124353" }, { "database": "PubMed", "id": "23128467", "url": "https://pubmed.ncbi.nlm.nih.gov/23128467" }, { "database": "PubMed", "id": "23139272", "url": "https://pubmed.ncbi.nlm.nih.gov/23139272" }, { "database": "PubMed", "id": "23194110", "url": "https://pubmed.ncbi.nlm.nih.gov/23194110" }, { "database": "PubMed", "id": "23238993", "url": "https://pubmed.ncbi.nlm.nih.gov/23238993" }, { "database": "PubMed", "id": "23263852", "url": "https://pubmed.ncbi.nlm.nih.gov/23263852" }, { "database": "PubMed", "id": "23300887", "url": "https://pubmed.ncbi.nlm.nih.gov/23300887" }, { "database": "PubMed", "id": "23318437", "url": "https://pubmed.ncbi.nlm.nih.gov/23318437" }, { "database": "PubMed", "id": "23319600", "url": "https://pubmed.ncbi.nlm.nih.gov/23319600" }, { "database": "PubMed", "id": "23340843", "url": "https://pubmed.ncbi.nlm.nih.gov/23340843" }, { "database": "PubMed", "id": "23342042", "url": "https://pubmed.ncbi.nlm.nih.gov/23342042" }, { "database": "PubMed", "id": "23351152", "url": "https://pubmed.ncbi.nlm.nih.gov/23351152" }, { "database": "PubMed", "id": "23359208", "url": "https://pubmed.ncbi.nlm.nih.gov/23359208" }, { "database": "PubMed", "id": "23425510", "url": "https://pubmed.ncbi.nlm.nih.gov/23425510" }, { "database": "PubMed", "id": "23434831", "url": "https://pubmed.ncbi.nlm.nih.gov/23434831" }, { "database": "PubMed", "id": "23451179", "url": "https://pubmed.ncbi.nlm.nih.gov/23451179" }, { "database": "PubMed", "id": "23483203", "url": "https://pubmed.ncbi.nlm.nih.gov/23483203" }, { "database": "PubMed", "id": "23495037", "url": "https://pubmed.ncbi.nlm.nih.gov/23495037" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23555949", "url": "https://pubmed.ncbi.nlm.nih.gov/23555949" }, { "database": "PubMed", "id": "23557329", "url": "https://pubmed.ncbi.nlm.nih.gov/23557329" }, { "database": "PubMed", "id": "23566959", "url": "https://pubmed.ncbi.nlm.nih.gov/23566959" }, { "database": "PubMed", "id": "23589839", "url": "https://pubmed.ncbi.nlm.nih.gov/23589839" }, { "database": "PubMed", "id": "23599430", "url": "https://pubmed.ncbi.nlm.nih.gov/23599430" }, { "database": "PubMed", "id": "23610071", "url": "https://pubmed.ncbi.nlm.nih.gov/23610071" }, { "database": "PubMed", "id": "23612976", "url": "https://pubmed.ncbi.nlm.nih.gov/23612976" }, { "database": "PubMed", "id": "23618908", "url": "https://pubmed.ncbi.nlm.nih.gov/23618908" }, { "database": "PubMed", "id": "23640457", "url": "https://pubmed.ncbi.nlm.nih.gov/23640457" }, { "database": "PubMed", "id": "23646139", "url": "https://pubmed.ncbi.nlm.nih.gov/23646139" }, { "database": "PubMed", "id": "23652278", "url": "https://pubmed.ncbi.nlm.nih.gov/23652278" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23666755", "url": "https://pubmed.ncbi.nlm.nih.gov/23666755" }, { "database": "PubMed", "id": "23676219", "url": "https://pubmed.ncbi.nlm.nih.gov/23676219" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23737838", "url": "https://pubmed.ncbi.nlm.nih.gov/23737838" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23759592", "url": "https://pubmed.ncbi.nlm.nih.gov/23759592" }, { "database": "PubMed", "id": "23785417", "url": "https://pubmed.ncbi.nlm.nih.gov/23785417" }, { "database": "PubMed", "id": "23800953", "url": "https://pubmed.ncbi.nlm.nih.gov/23800953" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23852422", "url": "https://pubmed.ncbi.nlm.nih.gov/23852422" }, { "database": "PubMed", "id": "23874235", "url": "https://pubmed.ncbi.nlm.nih.gov/23874235" }, { "database": "PubMed", "id": "23883471", "url": "https://pubmed.ncbi.nlm.nih.gov/23883471" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "23915323", "url": "https://pubmed.ncbi.nlm.nih.gov/23915323" }, { "database": "PubMed", "id": "23949216", "url": "https://pubmed.ncbi.nlm.nih.gov/23949216" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24024154", "url": "https://pubmed.ncbi.nlm.nih.gov/24024154" }, { "database": "PubMed", "id": "24037342", "url": "https://pubmed.ncbi.nlm.nih.gov/24037342" }, { "database": "PubMed", "id": "24040083", "url": "https://pubmed.ncbi.nlm.nih.gov/24040083" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24086708", "url": "https://pubmed.ncbi.nlm.nih.gov/24086708" }, { "database": "PubMed", "id": "24089038", "url": "https://pubmed.ncbi.nlm.nih.gov/24089038" }, { "database": "PubMed", "id": "24096875", "url": "https://pubmed.ncbi.nlm.nih.gov/24096875" }, { "database": "PubMed", "id": "24129246", "url": "https://pubmed.ncbi.nlm.nih.gov/24129246" }, { "database": "PubMed", "id": "24156017", "url": "https://pubmed.ncbi.nlm.nih.gov/24156017" }, { "database": "PubMed", "id": "24157877", "url": "https://pubmed.ncbi.nlm.nih.gov/24157877" }, { "database": "PubMed", "id": "24194914", "url": "https://pubmed.ncbi.nlm.nih.gov/24194914" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24205157", "url": "https://pubmed.ncbi.nlm.nih.gov/24205157" }, { "database": "PubMed", "id": "24223226", "url": "https://pubmed.ncbi.nlm.nih.gov/24223226" }, { "database": "PubMed", "id": "24244715", "url": "https://pubmed.ncbi.nlm.nih.gov/24244715" }, { "database": "PubMed", "id": "24248600", "url": "https://pubmed.ncbi.nlm.nih.gov/24248600" }, { "database": "PubMed", "id": "24264057", "url": "https://pubmed.ncbi.nlm.nih.gov/24264057" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24313628", "url": "https://pubmed.ncbi.nlm.nih.gov/24313628" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24379680", "url": "https://pubmed.ncbi.nlm.nih.gov/24379680" }, { "database": "PubMed", "id": "24380814", "url": "https://pubmed.ncbi.nlm.nih.gov/24380814" }, { "database": "PubMed", "id": "24391984", "url": "https://pubmed.ncbi.nlm.nih.gov/24391984" }, { "database": "PubMed", "id": "24403123", "url": "https://pubmed.ncbi.nlm.nih.gov/24403123" }, { "database": "PubMed", "id": "24413150", "url": "https://pubmed.ncbi.nlm.nih.gov/24413150" }, { "database": "PubMed", "id": "24445528", "url": "https://pubmed.ncbi.nlm.nih.gov/24445528" }, { "database": "PubMed", "id": "24447148", "url": "https://pubmed.ncbi.nlm.nih.gov/24447148" }, { "database": "PubMed", "id": "24456610", "url": "https://pubmed.ncbi.nlm.nih.gov/24456610" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24480460", "url": "https://pubmed.ncbi.nlm.nih.gov/24480460" }, { "database": "PubMed", "id": "24553354", "url": "https://pubmed.ncbi.nlm.nih.gov/24553354" }, { "database": "PubMed", "id": "24555657", "url": "https://pubmed.ncbi.nlm.nih.gov/24555657" }, { "database": "PubMed", "id": "24556689", "url": "https://pubmed.ncbi.nlm.nih.gov/24556689" }, { "database": "PubMed", "id": "24587255", "url": "https://pubmed.ncbi.nlm.nih.gov/24587255" }, { "database": "PubMed", "id": "24603648", "url": "https://pubmed.ncbi.nlm.nih.gov/24603648" }, { "database": "PubMed", "id": "24608431", "url": "https://pubmed.ncbi.nlm.nih.gov/24608431" }, { "database": "PubMed", "id": "24613410", "url": "https://pubmed.ncbi.nlm.nih.gov/24613410" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24657168", "url": "https://pubmed.ncbi.nlm.nih.gov/24657168" }, { "database": "PubMed", "id": "24682933", "url": "https://pubmed.ncbi.nlm.nih.gov/24682933" }, { "database": "PubMed", "id": "24691657", "url": "https://pubmed.ncbi.nlm.nih.gov/24691657" }, { "database": "PubMed", "id": "24717393", "url": "https://pubmed.ncbi.nlm.nih.gov/24717393" }, { "database": "PubMed", "id": "24722580", "url": "https://pubmed.ncbi.nlm.nih.gov/24722580" }, { "database": "PubMed", "id": "24759730", "url": "https://pubmed.ncbi.nlm.nih.gov/24759730" }, { "database": "PubMed", "id": "24796485", "url": "https://pubmed.ncbi.nlm.nih.gov/24796485" }, { "database": "PubMed", "id": "24797517", "url": "https://pubmed.ncbi.nlm.nih.gov/24797517" }, { "database": "PubMed", "id": "24801380", "url": "https://pubmed.ncbi.nlm.nih.gov/24801380" }, { "database": "PubMed", "id": "24810057", "url": "https://pubmed.ncbi.nlm.nih.gov/24810057" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24867336", "url": "https://pubmed.ncbi.nlm.nih.gov/24867336" }, { "database": "PubMed", "id": "24885082", "url": "https://pubmed.ncbi.nlm.nih.gov/24885082" }, { "database": "PubMed", "id": "24886358", "url": "https://pubmed.ncbi.nlm.nih.gov/24886358" }, { "database": "PubMed", "id": "24905183", "url": "https://pubmed.ncbi.nlm.nih.gov/24905183" }, { "database": "PubMed", "id": "24926985", "url": "https://pubmed.ncbi.nlm.nih.gov/24926985" }, { "database": "PubMed", "id": "24928858", "url": "https://pubmed.ncbi.nlm.nih.gov/24928858" }, { "database": "PubMed", "id": "24932684", "url": "https://pubmed.ncbi.nlm.nih.gov/24932684" }, { "database": "PubMed", "id": "24934860", "url": "https://pubmed.ncbi.nlm.nih.gov/24934860" }, { "database": "PubMed", "id": "24956278", "url": "https://pubmed.ncbi.nlm.nih.gov/24956278" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "24971451", "url": "https://pubmed.ncbi.nlm.nih.gov/24971451" }, { "database": "PubMed", "id": "25051404", "url": "https://pubmed.ncbi.nlm.nih.gov/25051404" }, { "database": "PubMed", "id": "25078064", "url": "https://pubmed.ncbi.nlm.nih.gov/25078064" }, { "database": "PubMed", "id": "25112877", "url": "https://pubmed.ncbi.nlm.nih.gov/25112877" }, { "database": "PubMed", "id": "25143403", "url": "https://pubmed.ncbi.nlm.nih.gov/25143403" }, { "database": "PubMed", "id": "25198662", "url": "https://pubmed.ncbi.nlm.nih.gov/25198662" }, { "database": "PubMed", "id": "25221641", "url": "https://pubmed.ncbi.nlm.nih.gov/25221641" }, { "database": "PubMed", "id": "25227113", "url": "https://pubmed.ncbi.nlm.nih.gov/25227113" }, { "database": "PubMed", "id": "25275589", "url": "https://pubmed.ncbi.nlm.nih.gov/25275589" }, { "database": "PubMed", "id": "25277183", "url": "https://pubmed.ncbi.nlm.nih.gov/25277183" }, { "database": "PubMed", "id": "25277184", "url": "https://pubmed.ncbi.nlm.nih.gov/25277184" }, { "database": "PubMed", "id": "25294809", "url": "https://pubmed.ncbi.nlm.nih.gov/25294809" }, { "database": "PubMed", "id": "25311384", "url": "https://pubmed.ncbi.nlm.nih.gov/25311384" }, { "database": "PubMed", "id": "25319447", "url": "https://pubmed.ncbi.nlm.nih.gov/25319447" }, { "database": "PubMed", "id": "25331851", "url": "https://pubmed.ncbi.nlm.nih.gov/25331851" }, { "database": "PubMed", "id": "25341038", "url": "https://pubmed.ncbi.nlm.nih.gov/25341038" }, { "database": "PubMed", "id": "25372714", "url": "https://pubmed.ncbi.nlm.nih.gov/25372714" }, { "database": "PubMed", "id": "25412311", "url": "https://pubmed.ncbi.nlm.nih.gov/25412311" }, { "database": "PubMed", "id": "25486198", "url": "https://pubmed.ncbi.nlm.nih.gov/25486198" }, { "database": "PubMed", "id": "25489053", "url": "https://pubmed.ncbi.nlm.nih.gov/25489053" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25524025", "url": "https://pubmed.ncbi.nlm.nih.gov/25524025" }, { "database": "PubMed", "id": "25603347", "url": "https://pubmed.ncbi.nlm.nih.gov/25603347" }, { "database": "PubMed", "id": "25605022", "url": "https://pubmed.ncbi.nlm.nih.gov/25605022" }, { "database": "PubMed", "id": "25617667", "url": "https://pubmed.ncbi.nlm.nih.gov/25617667" }, { "database": "PubMed", "id": "25637534", "url": "https://pubmed.ncbi.nlm.nih.gov/25637534" }, { "database": "PubMed", "id": "25639717", "url": "https://pubmed.ncbi.nlm.nih.gov/25639717" }, { "database": "PubMed", "id": "25650067", "url": "https://pubmed.ncbi.nlm.nih.gov/25650067" }, { "database": "PubMed", "id": "25658463", "url": "https://pubmed.ncbi.nlm.nih.gov/25658463" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25674209", "url": "https://pubmed.ncbi.nlm.nih.gov/25674209" }, { "database": "PubMed", "id": "25742468", "url": "https://pubmed.ncbi.nlm.nih.gov/25742468" }, { "database": "PubMed", "id": "25761368", "url": "https://pubmed.ncbi.nlm.nih.gov/25761368" }, { "database": "PubMed", "id": "25769181", "url": "https://pubmed.ncbi.nlm.nih.gov/25769181" }, { "database": "PubMed", "id": "25807079", "url": "https://pubmed.ncbi.nlm.nih.gov/25807079" }, { "database": "PubMed", "id": "25840449", "url": "https://pubmed.ncbi.nlm.nih.gov/25840449" }, { "database": "PubMed", "id": "25852310", "url": "https://pubmed.ncbi.nlm.nih.gov/25852310" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "25867071", "url": "https://pubmed.ncbi.nlm.nih.gov/25867071" }, { "database": "PubMed", "id": "25883152", "url": "https://pubmed.ncbi.nlm.nih.gov/25883152" }, { "database": "PubMed", "id": "25888625", "url": "https://pubmed.ncbi.nlm.nih.gov/25888625" }, { "database": "PubMed", "id": "25916852", "url": "https://pubmed.ncbi.nlm.nih.gov/25916852" }, { "database": "PubMed", "id": "25929783", "url": "https://pubmed.ncbi.nlm.nih.gov/25929783" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "25980443", "url": "https://pubmed.ncbi.nlm.nih.gov/25980443" }, { "database": "PubMed", "id": "25993660", "url": "https://pubmed.ncbi.nlm.nih.gov/25993660" }, { "database": "PubMed", "id": "26006237", "url": "https://pubmed.ncbi.nlm.nih.gov/26006237" }, { "database": "PubMed", "id": "26024660", "url": "https://pubmed.ncbi.nlm.nih.gov/26024660" }, { "database": "PubMed", "id": "26041883", "url": "https://pubmed.ncbi.nlm.nih.gov/26041883" }, { "database": "PubMed", "id": "26042776", "url": "https://pubmed.ncbi.nlm.nih.gov/26042776" }, { "database": "PubMed", "id": "26059686", "url": "https://pubmed.ncbi.nlm.nih.gov/26059686" }, { "database": "PubMed", "id": "26062651", "url": "https://pubmed.ncbi.nlm.nih.gov/26062651" }, { "database": "PubMed", "id": "26070322", "url": "https://pubmed.ncbi.nlm.nih.gov/26070322" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26095524", "url": "https://pubmed.ncbi.nlm.nih.gov/26095524" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26113041", "url": "https://pubmed.ncbi.nlm.nih.gov/26113041" }, { "database": "PubMed", "id": "26138448", "url": "https://pubmed.ncbi.nlm.nih.gov/26138448" }, { "database": "PubMed", "id": "26144554", "url": "https://pubmed.ncbi.nlm.nih.gov/26144554" }, { "database": "PubMed", "id": "26181367", "url": "https://pubmed.ncbi.nlm.nih.gov/26181367" }, { "database": "PubMed", "id": "26193055", "url": "https://pubmed.ncbi.nlm.nih.gov/26193055" }, { "database": "PubMed", "id": "26230405", "url": "https://pubmed.ncbi.nlm.nih.gov/26230405" }, { "database": "PubMed", "id": "26231043", "url": "https://pubmed.ncbi.nlm.nih.gov/26231043" }, { "database": "PubMed", "id": "26244501", "url": "https://pubmed.ncbi.nlm.nih.gov/26244501" }, { "database": "PubMed", "id": "26261212", "url": "https://pubmed.ncbi.nlm.nih.gov/26261212" }, { "database": "PubMed", "id": "26297485", "url": "https://pubmed.ncbi.nlm.nih.gov/26297485" }, { "database": "PubMed", "id": "26327815", "url": "https://pubmed.ncbi.nlm.nih.gov/26327815" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26387611", "url": "https://pubmed.ncbi.nlm.nih.gov/26387611" }, { "database": "PubMed", "id": "26391003", "url": "https://pubmed.ncbi.nlm.nih.gov/26391003" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26408200", "url": "https://pubmed.ncbi.nlm.nih.gov/26408200" }, { "database": "PubMed", "id": "26415230", "url": "https://pubmed.ncbi.nlm.nih.gov/26415230" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26456774", "url": "https://pubmed.ncbi.nlm.nih.gov/26456774" }, { "database": "PubMed", "id": "26459859", "url": "https://pubmed.ncbi.nlm.nih.gov/26459859" }, { "database": "PubMed", "id": "26471002", "url": "https://pubmed.ncbi.nlm.nih.gov/26471002" }, { "database": "PubMed", "id": "26485768", "url": "https://pubmed.ncbi.nlm.nih.gov/26485768" }, { "database": "PubMed", "id": "26510776", "url": "https://pubmed.ncbi.nlm.nih.gov/26510776" }, { "database": "PubMed", "id": "26522181", "url": "https://pubmed.ncbi.nlm.nih.gov/26522181" }, { "database": "PubMed", "id": "26540344", "url": "https://pubmed.ncbi.nlm.nih.gov/26540344" }, { "database": "PubMed", "id": "26571493", "url": "https://pubmed.ncbi.nlm.nih.gov/26571493" }, { "database": "PubMed", "id": "26598601", "url": "https://pubmed.ncbi.nlm.nih.gov/26598601" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26687066", "url": "https://pubmed.ncbi.nlm.nih.gov/26687066" }, { "database": "PubMed", "id": "26699757", "url": "https://pubmed.ncbi.nlm.nih.gov/26699757" }, { "database": "PubMed", "id": "26714930", "url": "https://pubmed.ncbi.nlm.nih.gov/26714930" }, { "database": "PubMed", "id": "26716417", "url": "https://pubmed.ncbi.nlm.nih.gov/26716417" }, { "database": "PubMed", "id": "26734838", "url": "https://pubmed.ncbi.nlm.nih.gov/26734838" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26832796", "url": "https://pubmed.ncbi.nlm.nih.gov/26832796" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "26876197", "url": "https://pubmed.ncbi.nlm.nih.gov/26876197" }, { "database": "PubMed", "id": "26883108", "url": "https://pubmed.ncbi.nlm.nih.gov/26883108" }, { "database": "PubMed", "id": "26909609", "url": "https://pubmed.ncbi.nlm.nih.gov/26909609" }, { "database": "PubMed", "id": "26928575", "url": "https://pubmed.ncbi.nlm.nih.gov/26928575" }, { "database": "PubMed", "id": "26967060", "url": "https://pubmed.ncbi.nlm.nih.gov/26967060" }, { "database": "PubMed", "id": "26974310", "url": "https://pubmed.ncbi.nlm.nih.gov/26974310" }, { "database": "PubMed", "id": "26982737", "url": "https://pubmed.ncbi.nlm.nih.gov/26982737" }, { "database": "PubMed", "id": "26984736", "url": "https://pubmed.ncbi.nlm.nih.gov/26984736" }, { "database": "PubMed", "id": "26988910", "url": "https://pubmed.ncbi.nlm.nih.gov/26988910" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "27031960", "url": "https://pubmed.ncbi.nlm.nih.gov/27031960" }, { "database": "PubMed", "id": "27054339", "url": "https://pubmed.ncbi.nlm.nih.gov/27054339" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27119009", "url": "https://pubmed.ncbi.nlm.nih.gov/27119009" }, { "database": "PubMed", "id": "27127932", "url": "https://pubmed.ncbi.nlm.nih.gov/27127932" }, { "database": "PubMed", "id": "27176768", "url": "https://pubmed.ncbi.nlm.nih.gov/27176768" }, { "database": "PubMed", "id": "27183917", "url": "https://pubmed.ncbi.nlm.nih.gov/27183917" }, { "database": "PubMed", "id": "27195669", "url": "https://pubmed.ncbi.nlm.nih.gov/27195669" }, { "database": "PubMed", "id": "27221050", "url": "https://pubmed.ncbi.nlm.nih.gov/27221050" }, { "database": "PubMed", "id": "27223263", "url": "https://pubmed.ncbi.nlm.nih.gov/27223263" }, { "database": "PubMed", "id": "27270209", "url": "https://pubmed.ncbi.nlm.nih.gov/27270209" }, { "database": "PubMed", "id": "27270636", "url": "https://pubmed.ncbi.nlm.nih.gov/27270636" }, { "database": "PubMed", "id": "27283986", "url": "https://pubmed.ncbi.nlm.nih.gov/27283986" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27314341", "url": "https://pubmed.ncbi.nlm.nih.gov/27314341" }, { "database": "PubMed", "id": "27323823", "url": "https://pubmed.ncbi.nlm.nih.gov/27323823" }, { "database": "PubMed", "id": "27344169", "url": "https://pubmed.ncbi.nlm.nih.gov/27344169" }, { "database": "PubMed", "id": "27346849", "url": "https://pubmed.ncbi.nlm.nih.gov/27346849" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27399772", "url": "https://pubmed.ncbi.nlm.nih.gov/27399772" }, { "database": "PubMed", "id": "27402273", "url": "https://pubmed.ncbi.nlm.nih.gov/27402273" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27511909", "url": "https://pubmed.ncbi.nlm.nih.gov/27511909" }, { "database": "PubMed", "id": "27517620", "url": "https://pubmed.ncbi.nlm.nih.gov/27517620" }, { "database": "PubMed", "id": "27542238", "url": "https://pubmed.ncbi.nlm.nih.gov/27542238" }, { "database": "PubMed", "id": "27545311", "url": "https://pubmed.ncbi.nlm.nih.gov/27545311" }, { "database": "PubMed", "id": "27551445", "url": "https://pubmed.ncbi.nlm.nih.gov/27551445" }, { "database": "PubMed", "id": "27556362", "url": "https://pubmed.ncbi.nlm.nih.gov/27556362" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27611229", "url": "https://pubmed.ncbi.nlm.nih.gov/27611229" }, { "database": "PubMed", "id": "27626308", "url": "https://pubmed.ncbi.nlm.nih.gov/27626308" }, { "database": "PubMed", "id": "27644130", "url": "https://pubmed.ncbi.nlm.nih.gov/27644130" }, { "database": "PubMed", "id": "27656146", "url": "https://pubmed.ncbi.nlm.nih.gov/27656146" }, { "database": "PubMed", "id": "27659536", "url": "https://pubmed.ncbi.nlm.nih.gov/27659536" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "27721412", "url": "https://pubmed.ncbi.nlm.nih.gov/27721412" }, { "database": "PubMed", "id": "27742673", "url": "https://pubmed.ncbi.nlm.nih.gov/27742673" }, { "database": "PubMed", "id": "27763560", "url": "https://pubmed.ncbi.nlm.nih.gov/27763560" }, { "database": "PubMed", "id": "27769050", "url": "https://pubmed.ncbi.nlm.nih.gov/27769050" }, { "database": "PubMed", "id": "27810895", "url": "https://pubmed.ncbi.nlm.nih.gov/27810895" }, { "database": "PubMed", "id": "27863490", "url": "https://pubmed.ncbi.nlm.nih.gov/27863490" }, { "database": "PubMed", "id": "27902328", "url": "https://pubmed.ncbi.nlm.nih.gov/27902328" }, { "database": "PubMed", "id": "27906186", "url": "https://pubmed.ncbi.nlm.nih.gov/27906186" }, { "database": "PubMed", "id": "27991505", "url": "https://pubmed.ncbi.nlm.nih.gov/27991505" }, { "database": "PubMed", "id": "28031409", "url": "https://pubmed.ncbi.nlm.nih.gov/28031409" }, { "database": "PubMed", "id": "28038466", "url": "https://pubmed.ncbi.nlm.nih.gov/28038466" }, { "database": "PubMed", "id": "28102346", "url": "https://pubmed.ncbi.nlm.nih.gov/28102346" }, { "database": "PubMed", "id": "28118604", "url": "https://pubmed.ncbi.nlm.nih.gov/28118604" }, { "database": "PubMed", "id": "28131798", "url": "https://pubmed.ncbi.nlm.nih.gov/28131798" }, { "database": "PubMed", "id": "28177473", "url": "https://pubmed.ncbi.nlm.nih.gov/28177473" }, { "database": "PubMed", "id": "28182004", "url": "https://pubmed.ncbi.nlm.nih.gov/28182004" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28187444", "url": "https://pubmed.ncbi.nlm.nih.gov/28187444" }, { "database": "PubMed", "id": "28208611", "url": "https://pubmed.ncbi.nlm.nih.gov/28208611" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28259974", "url": "https://pubmed.ncbi.nlm.nih.gov/28259974" }, { "database": "PubMed", "id": "28284059", "url": "https://pubmed.ncbi.nlm.nih.gov/28284059" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28369097", "url": "https://pubmed.ncbi.nlm.nih.gov/28369097" }, { "database": "PubMed", "id": "28381880", "url": "https://pubmed.ncbi.nlm.nih.gov/28381880" }, { "database": "PubMed", "id": "28455491", "url": "https://pubmed.ncbi.nlm.nih.gov/28455491" }, { "database": "PubMed", "id": "28466226", "url": "https://pubmed.ncbi.nlm.nih.gov/28466226" }, { "database": "PubMed", "id": "28468838", "url": "https://pubmed.ncbi.nlm.nih.gov/28468838" }, { "database": "PubMed", "id": "28475405", "url": "https://pubmed.ncbi.nlm.nih.gov/28475405" }, { "database": "PubMed", "id": "28535155", "url": "https://pubmed.ncbi.nlm.nih.gov/28535155" }, { "database": "PubMed", "id": "28605833", "url": "https://pubmed.ncbi.nlm.nih.gov/28605833" }, { "database": "PubMed", "id": "28656213", "url": "https://pubmed.ncbi.nlm.nih.gov/28656213" }, { "database": "PubMed", "id": "28667090", "url": "https://pubmed.ncbi.nlm.nih.gov/28667090" }, { "database": "PubMed", "id": "28714848", "url": "https://pubmed.ncbi.nlm.nih.gov/28714848" }, { "database": "PubMed", "id": "28715492", "url": "https://pubmed.ncbi.nlm.nih.gov/28715492" }, { "database": "PubMed", "id": "28726723", "url": "https://pubmed.ncbi.nlm.nih.gov/28726723" }, { "database": "PubMed", "id": "28759712", "url": "https://pubmed.ncbi.nlm.nih.gov/28759712" }, { "database": "PubMed", "id": "28790359", "url": "https://pubmed.ncbi.nlm.nih.gov/28790359" }, { "database": "PubMed", "id": "28794470", "url": "https://pubmed.ncbi.nlm.nih.gov/28794470" }, { "database": "PubMed", "id": "28797070", "url": "https://pubmed.ncbi.nlm.nih.gov/28797070" }, { "database": "PubMed", "id": "28801242", "url": "https://pubmed.ncbi.nlm.nih.gov/28801242" }, { "database": "PubMed", "id": "28837154", "url": "https://pubmed.ncbi.nlm.nih.gov/28837154" }, { "database": "PubMed", "id": "28842590", "url": "https://pubmed.ncbi.nlm.nih.gov/28842590" }, { "database": "PubMed", "id": "28843398", "url": "https://pubmed.ncbi.nlm.nih.gov/28843398" }, { "database": "PubMed", "id": "28888100", "url": "https://pubmed.ncbi.nlm.nih.gov/28888100" }, { "database": "PubMed", "id": "28904350", "url": "https://pubmed.ncbi.nlm.nih.gov/28904350" }, { "database": "PubMed", "id": "28915553", "url": "https://pubmed.ncbi.nlm.nih.gov/28915553" }, { "database": "PubMed", "id": "28915564", "url": "https://pubmed.ncbi.nlm.nih.gov/28915564" }, { "database": "PubMed", "id": "28926586", "url": "https://pubmed.ncbi.nlm.nih.gov/28926586" }, { "database": "PubMed", "id": "28930974", "url": "https://pubmed.ncbi.nlm.nih.gov/28930974" }, { "database": "PubMed", "id": "28968425", "url": "https://pubmed.ncbi.nlm.nih.gov/28968425" }, { "database": "PubMed", "id": "28971953", "url": "https://pubmed.ncbi.nlm.nih.gov/28971953" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "28973015", "url": "https://pubmed.ncbi.nlm.nih.gov/28973015" }, { "database": "PubMed", "id": "28979163", "url": "https://pubmed.ncbi.nlm.nih.gov/28979163" }, { "database": "PubMed", "id": "28981110", "url": "https://pubmed.ncbi.nlm.nih.gov/28981110" }, { "database": "PubMed", "id": "28985345", "url": "https://pubmed.ncbi.nlm.nih.gov/28985345" }, { "database": "PubMed", "id": "28993697", "url": "https://pubmed.ncbi.nlm.nih.gov/28993697" }, { "database": "PubMed", "id": "29030986", "url": "https://pubmed.ncbi.nlm.nih.gov/29030986" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29069457", "url": "https://pubmed.ncbi.nlm.nih.gov/29069457" }, { "database": "PubMed", "id": "29081404", "url": "https://pubmed.ncbi.nlm.nih.gov/29081404" }, { "database": "PubMed", "id": "29096294", "url": "https://pubmed.ncbi.nlm.nih.gov/29096294" }, { "database": "PubMed", "id": "29127423", "url": "https://pubmed.ncbi.nlm.nih.gov/29127423" }, { "database": "PubMed", "id": "29133857", "url": "https://pubmed.ncbi.nlm.nih.gov/29133857" }, { "database": "PubMed", "id": "29156743", "url": "https://pubmed.ncbi.nlm.nih.gov/29156743" }, { "database": "PubMed", "id": "29170254", "url": "https://pubmed.ncbi.nlm.nih.gov/29170254" }, { "database": "PubMed", "id": "29170437", "url": "https://pubmed.ncbi.nlm.nih.gov/29170437" }, { "database": "PubMed", "id": "29212215", "url": "https://pubmed.ncbi.nlm.nih.gov/29212215" }, { "database": "PubMed", "id": "29213352", "url": "https://pubmed.ncbi.nlm.nih.gov/29213352" }, { "database": "PubMed", "id": "29221109", "url": "https://pubmed.ncbi.nlm.nih.gov/29221109" }, { "database": "PubMed", "id": "29233996", "url": "https://pubmed.ncbi.nlm.nih.gov/29233996" }, { "database": "PubMed", "id": "29235570", "url": "https://pubmed.ncbi.nlm.nih.gov/29235570" }, { "database": "PubMed", "id": "29242151", "url": "https://pubmed.ncbi.nlm.nih.gov/29242151" }, { "database": "PubMed", "id": "29262653", "url": "https://pubmed.ncbi.nlm.nih.gov/29262653" }, { "database": "PubMed", "id": "29282022", "url": "https://pubmed.ncbi.nlm.nih.gov/29282022" }, { "database": "PubMed", "id": "29298131", "url": "https://pubmed.ncbi.nlm.nih.gov/29298131" }, { "database": "PubMed", "id": "29311824", "url": "https://pubmed.ncbi.nlm.nih.gov/29311824" }, { "database": "PubMed", "id": "29317830", "url": "https://pubmed.ncbi.nlm.nih.gov/29317830" }, { "database": "PubMed", "id": "29368980", "url": "https://pubmed.ncbi.nlm.nih.gov/29368980" }, { "database": "PubMed", "id": "29383186", "url": "https://pubmed.ncbi.nlm.nih.gov/29383186" }, { "database": "PubMed", "id": "29391428", "url": "https://pubmed.ncbi.nlm.nih.gov/29391428" }, { "database": "PubMed", "id": "29444163", "url": "https://pubmed.ncbi.nlm.nih.gov/29444163" }, { "database": "PubMed", "id": "29445107", "url": "https://pubmed.ncbi.nlm.nih.gov/29445107" }, { "database": "PubMed", "id": "29467390", "url": "https://pubmed.ncbi.nlm.nih.gov/29467390" }, { "database": "PubMed", "id": "29555944", "url": "https://pubmed.ncbi.nlm.nih.gov/29555944" }, { "database": "PubMed", "id": "29568955", "url": "https://pubmed.ncbi.nlm.nih.gov/29568955" }, { "database": "PubMed", "id": "29622681", "url": "https://pubmed.ncbi.nlm.nih.gov/29622681" }, { "database": "PubMed", "id": "29675670", "url": "https://pubmed.ncbi.nlm.nih.gov/29675670" }, { "database": "PubMed", "id": "29705090", "url": "https://pubmed.ncbi.nlm.nih.gov/29705090" }, { "database": "PubMed", "id": "29774100", "url": "https://pubmed.ncbi.nlm.nih.gov/29774100" }, { "database": "PubMed", "id": "29849909", "url": "https://pubmed.ncbi.nlm.nih.gov/29849909" }, { "database": "PubMed", "id": "29879550", "url": "https://pubmed.ncbi.nlm.nih.gov/29879550" }, { "database": "PubMed", "id": "29890668", "url": "https://pubmed.ncbi.nlm.nih.gov/29890668" }, { "database": "PubMed", "id": "29899847", "url": "https://pubmed.ncbi.nlm.nih.gov/29899847" }, { "database": "PubMed", "id": "29937996", "url": "https://pubmed.ncbi.nlm.nih.gov/29937996" }, { "database": "PubMed", "id": "29963241", "url": "https://pubmed.ncbi.nlm.nih.gov/29963241" }, { "database": "PubMed", "id": "30003648", "url": "https://pubmed.ncbi.nlm.nih.gov/30003648" }, { "database": "PubMed", "id": "30018737", "url": "https://pubmed.ncbi.nlm.nih.gov/30018737" }, { "database": "PubMed", "id": "30045945", "url": "https://pubmed.ncbi.nlm.nih.gov/30045945" }, { "database": "PubMed", "id": "30049386", "url": "https://pubmed.ncbi.nlm.nih.gov/30049386" }, { "database": "PubMed", "id": "30057418", "url": "https://pubmed.ncbi.nlm.nih.gov/30057418" }, { "database": "PubMed", "id": "30067985", "url": "https://pubmed.ncbi.nlm.nih.gov/30067985" }, { "database": "PubMed", "id": "30093397", "url": "https://pubmed.ncbi.nlm.nih.gov/30093397" }, { "database": "PubMed", "id": "30108207", "url": "https://pubmed.ncbi.nlm.nih.gov/30108207" }, { "database": "PubMed", "id": "30142917", "url": "https://pubmed.ncbi.nlm.nih.gov/30142917" }, { "database": "PubMed", "id": "30166519", "url": "https://pubmed.ncbi.nlm.nih.gov/30166519" }, { "database": "PubMed", "id": "30177839", "url": "https://pubmed.ncbi.nlm.nih.gov/30177839" }, { "database": "PubMed", "id": "30193098", "url": "https://pubmed.ncbi.nlm.nih.gov/30193098" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30252118", "url": "https://pubmed.ncbi.nlm.nih.gov/30252118" }, { "database": "PubMed", "id": "30254375", "url": "https://pubmed.ncbi.nlm.nih.gov/30254375" }, { "database": "PubMed", "id": "30261716", "url": "https://pubmed.ncbi.nlm.nih.gov/30261716" }, { "database": "PubMed", "id": "30272263", "url": "https://pubmed.ncbi.nlm.nih.gov/30272263" }, { "database": "PubMed", "id": "30337688", "url": "https://pubmed.ncbi.nlm.nih.gov/30337688" }, { "database": "PubMed", "id": "30375398", "url": "https://pubmed.ncbi.nlm.nih.gov/30375398" }, { "database": "PubMed", "id": "30380295", "url": "https://pubmed.ncbi.nlm.nih.gov/30380295" }, { "database": "PubMed", "id": "30388705", "url": "https://pubmed.ncbi.nlm.nih.gov/30388705" }, { "database": "PubMed", "id": "30400903", "url": "https://pubmed.ncbi.nlm.nih.gov/30400903" }, { "database": "PubMed", "id": "30424508", "url": "https://pubmed.ncbi.nlm.nih.gov/30424508" }, { "database": "PubMed", "id": "30476192", "url": "https://pubmed.ncbi.nlm.nih.gov/30476192" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30513611", "url": "https://pubmed.ncbi.nlm.nih.gov/30513611" }, { "database": "PubMed", "id": "30520728", "url": "https://pubmed.ncbi.nlm.nih.gov/30520728" }, { "database": "PubMed", "id": "30532707", "url": "https://pubmed.ncbi.nlm.nih.gov/30532707" }, { "database": "PubMed", "id": "30538965", "url": "https://pubmed.ncbi.nlm.nih.gov/30538965" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30585287", "url": "https://pubmed.ncbi.nlm.nih.gov/30585287" }, { "database": "PubMed", "id": "30587121", "url": "https://pubmed.ncbi.nlm.nih.gov/30587121" }, { "database": "PubMed", "id": "30665195", "url": "https://pubmed.ncbi.nlm.nih.gov/30665195" }, { "database": "PubMed", "id": "30666155", "url": "https://pubmed.ncbi.nlm.nih.gov/30666155" }, { "database": "PubMed", "id": "30717309", "url": "https://pubmed.ncbi.nlm.nih.gov/30717309" }, { "database": "PubMed", "id": "30728460", "url": "https://pubmed.ncbi.nlm.nih.gov/30728460" }, { "database": "PubMed", "id": "30733851", "url": "https://pubmed.ncbi.nlm.nih.gov/30733851" }, { "database": "PubMed", "id": "30808373", "url": "https://pubmed.ncbi.nlm.nih.gov/30808373" }, { "database": "PubMed", "id": "30813936", "url": "https://pubmed.ncbi.nlm.nih.gov/30813936" }, { "database": "PubMed", "id": "30854784", "url": "https://pubmed.ncbi.nlm.nih.gov/30854784" }, { "database": "PubMed", "id": "30868056", "url": "https://pubmed.ncbi.nlm.nih.gov/30868056" }, { "database": "PubMed", "id": "30881947", "url": "https://pubmed.ncbi.nlm.nih.gov/30881947" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "30932278", "url": "https://pubmed.ncbi.nlm.nih.gov/30932278" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30966857", "url": "https://pubmed.ncbi.nlm.nih.gov/30966857" }, { "database": "PubMed", "id": "30975543", "url": "https://pubmed.ncbi.nlm.nih.gov/30975543" }, { "database": "PubMed", "id": "30982228", "url": "https://pubmed.ncbi.nlm.nih.gov/30982228" }, { "database": "PubMed", "id": "31039479", "url": "https://pubmed.ncbi.nlm.nih.gov/31039479" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31111215", "url": "https://pubmed.ncbi.nlm.nih.gov/31111215" }, { "database": "PubMed", "id": "31120902", "url": "https://pubmed.ncbi.nlm.nih.gov/31120902" }, { "database": "PubMed", "id": "31138113", "url": "https://pubmed.ncbi.nlm.nih.gov/31138113" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31217894", "url": "https://pubmed.ncbi.nlm.nih.gov/31217894" }, { "database": "PubMed", "id": "31231694", "url": "https://pubmed.ncbi.nlm.nih.gov/31231694" }, { "database": "PubMed", "id": "31336690", "url": "https://pubmed.ncbi.nlm.nih.gov/31336690" }, { "database": "PubMed", "id": "31360122", "url": "https://pubmed.ncbi.nlm.nih.gov/31360122" }, { "database": "PubMed", "id": "31366902", "url": "https://pubmed.ncbi.nlm.nih.gov/31366902" }, { "database": "PubMed", "id": "31379409", "url": "https://pubmed.ncbi.nlm.nih.gov/31379409" }, { "database": "PubMed", "id": "31388677", "url": "https://pubmed.ncbi.nlm.nih.gov/31388677" }, { "database": "PubMed", "id": "31421458", "url": "https://pubmed.ncbi.nlm.nih.gov/31421458" }, { "database": "PubMed", "id": "31462218", "url": "https://pubmed.ncbi.nlm.nih.gov/31462218" }, { "database": "PubMed", "id": "31551768", "url": "https://pubmed.ncbi.nlm.nih.gov/31551768" }, { "database": "PubMed", "id": "31594538", "url": "https://pubmed.ncbi.nlm.nih.gov/31594538" }, { "database": "PubMed", "id": "31596196", "url": "https://pubmed.ncbi.nlm.nih.gov/31596196" }, { "database": "PubMed", "id": "31615975", "url": "https://pubmed.ncbi.nlm.nih.gov/31615975" }, { "database": "PubMed", "id": "31699974", "url": "https://pubmed.ncbi.nlm.nih.gov/31699974" }, { "database": "PubMed", "id": "31804459", "url": "https://pubmed.ncbi.nlm.nih.gov/31804459" }, { "database": "PubMed", "id": "31821701", "url": "https://pubmed.ncbi.nlm.nih.gov/31821701" }, { "database": "PubMed", "id": "31844686", "url": "https://pubmed.ncbi.nlm.nih.gov/31844686" }, { "database": "PubMed", "id": "31847237", "url": "https://pubmed.ncbi.nlm.nih.gov/31847237" }, { "database": "PubMed", "id": "31861721", "url": "https://pubmed.ncbi.nlm.nih.gov/31861721" }, { "database": "PubMed", "id": "31979361", "url": "https://pubmed.ncbi.nlm.nih.gov/31979361" }, { "database": "PubMed", "id": "32001678", "url": "https://pubmed.ncbi.nlm.nih.gov/32001678" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32054925", "url": "https://pubmed.ncbi.nlm.nih.gov/32054925" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32168910", "url": "https://pubmed.ncbi.nlm.nih.gov/32168910" }, { "database": "PubMed", "id": "32213959", "url": "https://pubmed.ncbi.nlm.nih.gov/32213959" }, { "database": "PubMed", "id": "32260204", "url": "https://pubmed.ncbi.nlm.nih.gov/32260204" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32427887", "url": "https://pubmed.ncbi.nlm.nih.gov/32427887" }, { "database": "PubMed", "id": "32432260", "url": "https://pubmed.ncbi.nlm.nih.gov/32432260" }, { "database": "PubMed", "id": "32492656", "url": "https://pubmed.ncbi.nlm.nih.gov/32492656" }, { "database": "PubMed", "id": "32560563", "url": "https://pubmed.ncbi.nlm.nih.gov/32560563" }, { "database": "PubMed", "id": "32605139", "url": "https://pubmed.ncbi.nlm.nih.gov/32605139" }, { "database": "PubMed", "id": "32617134", "url": "https://pubmed.ncbi.nlm.nih.gov/32617134" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32724100", "url": "https://pubmed.ncbi.nlm.nih.gov/32724100" }, { "database": "PubMed", "id": "32733438", "url": "https://pubmed.ncbi.nlm.nih.gov/32733438" }, { "database": "PubMed", "id": "32735894", "url": "https://pubmed.ncbi.nlm.nih.gov/32735894" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863918", "url": "https://pubmed.ncbi.nlm.nih.gov/32863918" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "32929340", "url": "https://pubmed.ncbi.nlm.nih.gov/32929340" }, { "database": "PubMed", "id": "32945487", "url": "https://pubmed.ncbi.nlm.nih.gov/32945487" }, { "database": "PubMed", "id": "32978372", "url": "https://pubmed.ncbi.nlm.nih.gov/32978372" }, { "database": "PubMed", "id": "33014050", "url": "https://pubmed.ncbi.nlm.nih.gov/33014050" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33061640", "url": "https://pubmed.ncbi.nlm.nih.gov/33061640" }, { "database": "PubMed", "id": "33074128", "url": "https://pubmed.ncbi.nlm.nih.gov/33074128" }, { "database": "PubMed", "id": "33085644", "url": "https://pubmed.ncbi.nlm.nih.gov/33085644" }, { "database": "PubMed", "id": "33097607", "url": "https://pubmed.ncbi.nlm.nih.gov/33097607" }, { "database": "PubMed", "id": "33110364", "url": "https://pubmed.ncbi.nlm.nih.gov/33110364" }, { "database": "PubMed", "id": "33146634", "url": "https://pubmed.ncbi.nlm.nih.gov/33146634" }, { "database": "PubMed", "id": "33166398", "url": "https://pubmed.ncbi.nlm.nih.gov/33166398" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33245719", "url": "https://pubmed.ncbi.nlm.nih.gov/33245719" }, { "database": "PubMed", "id": "33251333", "url": "https://pubmed.ncbi.nlm.nih.gov/33251333" }, { "database": "PubMed", "id": "33297931", "url": "https://pubmed.ncbi.nlm.nih.gov/33297931" }, { "database": "PubMed", "id": "33303632", "url": "https://pubmed.ncbi.nlm.nih.gov/33303632" }, { "database": "PubMed", "id": "33391525", "url": "https://pubmed.ncbi.nlm.nih.gov/33391525" }, { "database": "PubMed", "id": "33396303", "url": "https://pubmed.ncbi.nlm.nih.gov/33396303" }, { "database": "PubMed", "id": "33411764", "url": "https://pubmed.ncbi.nlm.nih.gov/33411764" }, { "database": "PubMed", "id": "33431809", "url": "https://pubmed.ncbi.nlm.nih.gov/33431809" }, { "database": "PubMed", "id": "33503543", "url": "https://pubmed.ncbi.nlm.nih.gov/33503543" }, { "database": "PubMed", "id": "33536467", "url": "https://pubmed.ncbi.nlm.nih.gov/33536467" }, { "database": "PubMed", "id": "33585229", "url": "https://pubmed.ncbi.nlm.nih.gov/33585229" }, { "database": "PubMed", "id": "33669867", "url": "https://pubmed.ncbi.nlm.nih.gov/33669867" }, { "database": "PubMed", "id": "33745968", "url": "https://pubmed.ncbi.nlm.nih.gov/33745968" }, { "database": "PubMed", "id": "33761896", "url": "https://pubmed.ncbi.nlm.nih.gov/33761896" }, { "database": "PubMed", "id": "33804124", "url": "https://pubmed.ncbi.nlm.nih.gov/33804124" }, { "database": "PubMed", "id": "33808426", "url": "https://pubmed.ncbi.nlm.nih.gov/33808426" }, { "database": "PubMed", "id": "33850227", "url": "https://pubmed.ncbi.nlm.nih.gov/33850227" }, { "database": "PubMed", "id": "33898425", "url": "https://pubmed.ncbi.nlm.nih.gov/33898425" }, { "database": "PubMed", "id": "33899121", "url": "https://pubmed.ncbi.nlm.nih.gov/33899121" }, { "database": "PubMed", "id": "33982778", "url": "https://pubmed.ncbi.nlm.nih.gov/33982778" }, { "database": "PubMed", "id": "33982878", "url": "https://pubmed.ncbi.nlm.nih.gov/33982878" }, { "database": "PubMed", "id": "34103468", "url": "https://pubmed.ncbi.nlm.nih.gov/34103468" }, { "database": "PubMed", "id": "34930892", "url": "https://pubmed.ncbi.nlm.nih.gov/34930892" }, { "database": "PubMed", "id": "35143532", "url": "https://pubmed.ncbi.nlm.nih.gov/35143532" }, { "database": "PubMed", "id": "35312310", "url": "https://pubmed.ncbi.nlm.nih.gov/35312310" }, { "database": "PubMed", "id": "35752942", "url": "https://pubmed.ncbi.nlm.nih.gov/35752942" }, { "database": "PubMed", "id": "35792512", "url": "https://pubmed.ncbi.nlm.nih.gov/35792512" }, { "database": "PubMed", "id": "35829882", "url": "https://pubmed.ncbi.nlm.nih.gov/35829882" }, { "database": "PubMed", "id": "35834822", "url": "https://pubmed.ncbi.nlm.nih.gov/35834822" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "36094323", "url": "https://pubmed.ncbi.nlm.nih.gov/36094323" }, { "database": "PubMed", "id": "36293376", "url": "https://pubmed.ncbi.nlm.nih.gov/36293376" }, { "database": "PubMed", "id": "36300938", "url": "https://pubmed.ncbi.nlm.nih.gov/36300938" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8502477", "url": "https://pubmed.ncbi.nlm.nih.gov/8502477" }, { "database": "PubMed", "id": "9407038", "url": "https://pubmed.ncbi.nlm.nih.gov/9407038" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9733514", "url": "https://pubmed.ncbi.nlm.nih.gov/9733514" }, { "database": "PubMed", "id": "9733515", "url": "https://pubmed.ncbi.nlm.nih.gov/9733515" }, { "database": "PubMed", "id": "9830059", "url": "https://pubmed.ncbi.nlm.nih.gov/9830059" }, { "database": "PubMed", "id": "9843217", "url": "https://pubmed.ncbi.nlm.nih.gov/9843217" }, { "database": "PubMed", "id": "11554766", "url": "https://pubmed.ncbi.nlm.nih.gov/11554766" } ], "site_lbl": "Ser15", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 392, "end_pos": 392, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK2, CDK2 and NUAK1", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "11239457", "url": "https://pubmed.ncbi.nlm.nih.gov/11239457" }, { "database": "PubMed", "id": "12393879", "url": "https://pubmed.ncbi.nlm.nih.gov/12393879" }, { "database": "PubMed", "id": "16552184", "url": "https://pubmed.ncbi.nlm.nih.gov/16552184" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10559267", "url": "https://pubmed.ncbi.nlm.nih.gov/10559267" }, { "database": "PubMed", "id": "10597229", "url": "https://pubmed.ncbi.nlm.nih.gov/10597229" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10747897", "url": "https://pubmed.ncbi.nlm.nih.gov/10747897" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10884347", "url": "https://pubmed.ncbi.nlm.nih.gov/10884347" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11508859", "url": "https://pubmed.ncbi.nlm.nih.gov/11508859" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11741290", "url": "https://pubmed.ncbi.nlm.nih.gov/11741290" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "12081208", "url": "https://pubmed.ncbi.nlm.nih.gov/12081208" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12776195", "url": "https://pubmed.ncbi.nlm.nih.gov/12776195" }, { "database": "PubMed", "id": "12792782", "url": "https://pubmed.ncbi.nlm.nih.gov/12792782" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12898523", "url": "https://pubmed.ncbi.nlm.nih.gov/12898523" }, { "database": "PubMed", "id": "12937839", "url": "https://pubmed.ncbi.nlm.nih.gov/12937839" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14640983", "url": "https://pubmed.ncbi.nlm.nih.gov/14640983" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "15038834", "url": "https://pubmed.ncbi.nlm.nih.gov/15038834" }, { "database": "PubMed", "id": "15064747", "url": "https://pubmed.ncbi.nlm.nih.gov/15064747" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15709766", "url": "https://pubmed.ncbi.nlm.nih.gov/15709766" }, { "database": "PubMed", "id": "15837201", "url": "https://pubmed.ncbi.nlm.nih.gov/15837201" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "16082409", "url": "https://pubmed.ncbi.nlm.nih.gov/16082409" }, { "database": "PubMed", "id": "16299809", "url": "https://pubmed.ncbi.nlm.nih.gov/16299809" }, { "database": "PubMed", "id": "16319070", "url": "https://pubmed.ncbi.nlm.nih.gov/16319070" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16741955", "url": "https://pubmed.ncbi.nlm.nih.gov/16741955" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "17051326", "url": "https://pubmed.ncbi.nlm.nih.gov/17051326" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17180249", "url": "https://pubmed.ncbi.nlm.nih.gov/17180249" }, { "database": "PubMed", "id": "17237827", "url": "https://pubmed.ncbi.nlm.nih.gov/17237827" }, { "database": "PubMed", "id": "17341630", "url": "https://pubmed.ncbi.nlm.nih.gov/17341630" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17523842", "url": "https://pubmed.ncbi.nlm.nih.gov/17523842" }, { "database": "PubMed", "id": "17565390", "url": "https://pubmed.ncbi.nlm.nih.gov/17565390" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17966099", "url": "https://pubmed.ncbi.nlm.nih.gov/17966099" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18443131", "url": "https://pubmed.ncbi.nlm.nih.gov/18443131" }, { "database": "PubMed", "id": "18472237", "url": "https://pubmed.ncbi.nlm.nih.gov/18472237" }, { "database": "PubMed", "id": "18495777", "url": "https://pubmed.ncbi.nlm.nih.gov/18495777" }, { "database": "PubMed", "id": "18523266", "url": "https://pubmed.ncbi.nlm.nih.gov/18523266" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18718914", "url": "https://pubmed.ncbi.nlm.nih.gov/18718914" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19253369", "url": "https://pubmed.ncbi.nlm.nih.gov/19253369" }, { "database": "PubMed", "id": "19428812", "url": "https://pubmed.ncbi.nlm.nih.gov/19428812" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19834494", "url": "https://pubmed.ncbi.nlm.nih.gov/19834494" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19932175", "url": "https://pubmed.ncbi.nlm.nih.gov/19932175" }, { "database": "PubMed", "id": "20009884", "url": "https://pubmed.ncbi.nlm.nih.gov/20009884" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20234175", "url": "https://pubmed.ncbi.nlm.nih.gov/20234175" }, { "database": "PubMed", "id": "20346999", "url": "https://pubmed.ncbi.nlm.nih.gov/20346999" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20810912", "url": "https://pubmed.ncbi.nlm.nih.gov/20810912" }, { "database": "PubMed", "id": "21084272", "url": "https://pubmed.ncbi.nlm.nih.gov/21084272" }, { "database": "PubMed", "id": "21210663", "url": "https://pubmed.ncbi.nlm.nih.gov/21210663" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21339981", "url": "https://pubmed.ncbi.nlm.nih.gov/21339981" }, { "database": "PubMed", "id": "21455220", "url": "https://pubmed.ncbi.nlm.nih.gov/21455220" }, { "database": "PubMed", "id": "21457773", "url": "https://pubmed.ncbi.nlm.nih.gov/21457773" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21769452", "url": "https://pubmed.ncbi.nlm.nih.gov/21769452" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21832239", "url": "https://pubmed.ncbi.nlm.nih.gov/21832239" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22914926", "url": "https://pubmed.ncbi.nlm.nih.gov/22914926" }, { "database": "PubMed", "id": "23414419", "url": "https://pubmed.ncbi.nlm.nih.gov/23414419" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23565200", "url": "https://pubmed.ncbi.nlm.nih.gov/23565200" }, { "database": "PubMed", "id": "23603988", "url": "https://pubmed.ncbi.nlm.nih.gov/23603988" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24286312", "url": "https://pubmed.ncbi.nlm.nih.gov/24286312" }, { "database": "PubMed", "id": "24362252", "url": "https://pubmed.ncbi.nlm.nih.gov/24362252" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24473091", "url": "https://pubmed.ncbi.nlm.nih.gov/24473091" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "25139266", "url": "https://pubmed.ncbi.nlm.nih.gov/25139266" }, { "database": "PubMed", "id": "25311616", "url": "https://pubmed.ncbi.nlm.nih.gov/25311616" }, { "database": "PubMed", "id": "25429619", "url": "https://pubmed.ncbi.nlm.nih.gov/25429619" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25633290", "url": "https://pubmed.ncbi.nlm.nih.gov/25633290" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26936915", "url": "https://pubmed.ncbi.nlm.nih.gov/26936915" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28498467", "url": "https://pubmed.ncbi.nlm.nih.gov/28498467" }, { "database": "PubMed", "id": "28878400", "url": "https://pubmed.ncbi.nlm.nih.gov/28878400" }, { "database": "PubMed", "id": "28937686", "url": "https://pubmed.ncbi.nlm.nih.gov/28937686" }, { "database": "PubMed", "id": "29033320", "url": "https://pubmed.ncbi.nlm.nih.gov/29033320" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "30096294", "url": "https://pubmed.ncbi.nlm.nih.gov/30096294" }, { "database": "PubMed", "id": "30416048", "url": "https://pubmed.ncbi.nlm.nih.gov/30416048" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30725256", "url": "https://pubmed.ncbi.nlm.nih.gov/30725256" }, { "database": "PubMed", "id": "30942456", "url": "https://pubmed.ncbi.nlm.nih.gov/30942456" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31496797", "url": "https://pubmed.ncbi.nlm.nih.gov/31496797" }, { "database": "PubMed", "id": "31617338", "url": "https://pubmed.ncbi.nlm.nih.gov/31617338" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32181328", "url": "https://pubmed.ncbi.nlm.nih.gov/32181328" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32681102", "url": "https://pubmed.ncbi.nlm.nih.gov/32681102" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863216", "url": "https://pubmed.ncbi.nlm.nih.gov/32863216" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33209651", "url": "https://pubmed.ncbi.nlm.nih.gov/33209651" }, { "database": "PubMed", "id": "33266043", "url": "https://pubmed.ncbi.nlm.nih.gov/33266043" }, { "database": "PubMed", "id": "33303565", "url": "https://pubmed.ncbi.nlm.nih.gov/33303565" }, { "database": "PubMed", "id": "34209868", "url": "https://pubmed.ncbi.nlm.nih.gov/34209868" }, { "database": "PubMed", "id": "34216619", "url": "https://pubmed.ncbi.nlm.nih.gov/34216619" }, { "database": "PubMed", "id": "35618207", "url": "https://pubmed.ncbi.nlm.nih.gov/35618207" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "35902040", "url": "https://pubmed.ncbi.nlm.nih.gov/35902040" }, { "database": "PubMed", "id": "36058261", "url": "https://pubmed.ncbi.nlm.nih.gov/36058261" }, { "database": "PubMed", "id": "36399430", "url": "https://pubmed.ncbi.nlm.nih.gov/36399430" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8956076", "url": "https://pubmed.ncbi.nlm.nih.gov/8956076" }, { "database": "PubMed", "id": "9246643", "url": "https://pubmed.ncbi.nlm.nih.gov/9246643" }, { "database": "PubMed", "id": "9254608", "url": "https://pubmed.ncbi.nlm.nih.gov/9254608" }, { "database": "PubMed", "id": "9467949", "url": "https://pubmed.ncbi.nlm.nih.gov/9467949" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9747884", "url": "https://pubmed.ncbi.nlm.nih.gov/9747884" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "22214662", "url": "https://pubmed.ncbi.nlm.nih.gov/22214662" } ], "site_lbl": "Ser392", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5, DYRK2, HIPK2 and PKC/PRKCG", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "17591690", "url": "https://pubmed.ncbi.nlm.nih.gov/17591690" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "15642743", "url": "https://pubmed.ncbi.nlm.nih.gov/15642743" }, { "database": "PubMed", "id": "10581258", "url": "https://pubmed.ncbi.nlm.nih.gov/10581258" }, { "database": "PubMed", "id": "11030628", "url": "https://pubmed.ncbi.nlm.nih.gov/11030628" }, { "database": "PubMed", "id": "11511362", "url": "https://pubmed.ncbi.nlm.nih.gov/11511362" }, { "database": "PubMed", "id": "11740489", "url": "https://pubmed.ncbi.nlm.nih.gov/11740489" }, { "database": "PubMed", "id": "11780126", "url": "https://pubmed.ncbi.nlm.nih.gov/11780126" }, { "database": "PubMed", "id": "11875057", "url": "https://pubmed.ncbi.nlm.nih.gov/11875057" }, { "database": "PubMed", "id": "12021785", "url": "https://pubmed.ncbi.nlm.nih.gov/12021785" }, { "database": "PubMed", "id": "12093737", "url": "https://pubmed.ncbi.nlm.nih.gov/12093737" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12782576", "url": "https://pubmed.ncbi.nlm.nih.gov/12782576" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12907596", "url": "https://pubmed.ncbi.nlm.nih.gov/12907596" }, { "database": "PubMed", "id": "12927814", "url": "https://pubmed.ncbi.nlm.nih.gov/12927814" }, { "database": "PubMed", "id": "14729469", "url": "https://pubmed.ncbi.nlm.nih.gov/14729469" }, { "database": "PubMed", "id": "14749479", "url": "https://pubmed.ncbi.nlm.nih.gov/14749479" }, { "database": "PubMed", "id": "14993250", "url": "https://pubmed.ncbi.nlm.nih.gov/14993250" }, { "database": "PubMed", "id": "15026814", "url": "https://pubmed.ncbi.nlm.nih.gov/15026814" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15274301", "url": "https://pubmed.ncbi.nlm.nih.gov/15274301" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15526030", "url": "https://pubmed.ncbi.nlm.nih.gov/15526030" }, { "database": "PubMed", "id": "15608685", "url": "https://pubmed.ncbi.nlm.nih.gov/15608685" }, { "database": "PubMed", "id": "15657359", "url": "https://pubmed.ncbi.nlm.nih.gov/15657359" }, { "database": "PubMed", "id": "15657900", "url": "https://pubmed.ncbi.nlm.nih.gov/15657900" }, { "database": "PubMed", "id": "15766567", "url": "https://pubmed.ncbi.nlm.nih.gov/15766567" }, { "database": "PubMed", "id": "15843377", "url": "https://pubmed.ncbi.nlm.nih.gov/15843377" }, { "database": "PubMed", "id": "15897882", "url": "https://pubmed.ncbi.nlm.nih.gov/15897882" }, { "database": "PubMed", "id": "16219768", "url": "https://pubmed.ncbi.nlm.nih.gov/16219768" }, { "database": "PubMed", "id": "16247456", "url": "https://pubmed.ncbi.nlm.nih.gov/16247456" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16377624", "url": "https://pubmed.ncbi.nlm.nih.gov/16377624" }, { "database": "PubMed", "id": "16601678", "url": "https://pubmed.ncbi.nlm.nih.gov/16601678" }, { "database": "PubMed", "id": "16738336", "url": "https://pubmed.ncbi.nlm.nih.gov/16738336" }, { "database": "PubMed", "id": "16793543", "url": "https://pubmed.ncbi.nlm.nih.gov/16793543" }, { "database": "PubMed", "id": "17031575", "url": "https://pubmed.ncbi.nlm.nih.gov/17031575" }, { "database": "PubMed", "id": "17051326", "url": "https://pubmed.ncbi.nlm.nih.gov/17051326" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17117479", "url": "https://pubmed.ncbi.nlm.nih.gov/17117479" }, { "database": "PubMed", "id": "17332358", "url": "https://pubmed.ncbi.nlm.nih.gov/17332358" }, { "database": "PubMed", "id": "17349958", "url": "https://pubmed.ncbi.nlm.nih.gov/17349958" }, { "database": "PubMed", "id": "17349959", "url": "https://pubmed.ncbi.nlm.nih.gov/17349959" }, { "database": "PubMed", "id": "17404016", "url": "https://pubmed.ncbi.nlm.nih.gov/17404016" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17567906", "url": "https://pubmed.ncbi.nlm.nih.gov/17567906" }, { "database": "PubMed", "id": "17584297", "url": "https://pubmed.ncbi.nlm.nih.gov/17584297" }, { "database": "PubMed", "id": "17932951", "url": "https://pubmed.ncbi.nlm.nih.gov/17932951" }, { "database": "PubMed", "id": "17971768", "url": "https://pubmed.ncbi.nlm.nih.gov/17971768" }, { "database": "PubMed", "id": "18056705", "url": "https://pubmed.ncbi.nlm.nih.gov/18056705" }, { "database": "PubMed", "id": "18216278", "url": "https://pubmed.ncbi.nlm.nih.gov/18216278" }, { "database": "PubMed", "id": "18311036", "url": "https://pubmed.ncbi.nlm.nih.gov/18311036" }, { "database": "PubMed", "id": "18363705", "url": "https://pubmed.ncbi.nlm.nih.gov/18363705" }, { "database": "PubMed", "id": "18395248", "url": "https://pubmed.ncbi.nlm.nih.gov/18395248" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18599021", "url": "https://pubmed.ncbi.nlm.nih.gov/18599021" }, { "database": "PubMed", "id": "18642443", "url": "https://pubmed.ncbi.nlm.nih.gov/18642443" }, { "database": "PubMed", "id": "18760266", "url": "https://pubmed.ncbi.nlm.nih.gov/18760266" }, { "database": "PubMed", "id": "18761330", "url": "https://pubmed.ncbi.nlm.nih.gov/18761330" }, { "database": "PubMed", "id": "18846503", "url": "https://pubmed.ncbi.nlm.nih.gov/18846503" }, { "database": "PubMed", "id": "19139122", "url": "https://pubmed.ncbi.nlm.nih.gov/19139122" }, { "database": "PubMed", "id": "19197384", "url": "https://pubmed.ncbi.nlm.nih.gov/19197384" }, { "database": "PubMed", "id": "19287975", "url": "https://pubmed.ncbi.nlm.nih.gov/19287975" }, { "database": "PubMed", "id": "19325714", "url": "https://pubmed.ncbi.nlm.nih.gov/19325714" }, { "database": "PubMed", "id": "19328784", "url": "https://pubmed.ncbi.nlm.nih.gov/19328784" }, { "database": "PubMed", "id": "19363523", "url": "https://pubmed.ncbi.nlm.nih.gov/19363523" }, { "database": "PubMed", "id": "19521340", "url": "https://pubmed.ncbi.nlm.nih.gov/19521340" }, { "database": "PubMed", "id": "19525231", "url": "https://pubmed.ncbi.nlm.nih.gov/19525231" }, { "database": "PubMed", "id": "19668373", "url": "https://pubmed.ncbi.nlm.nih.gov/19668373" }, { "database": "PubMed", "id": "19724778", "url": "https://pubmed.ncbi.nlm.nih.gov/19724778" }, { "database": "PubMed", "id": "19857493", "url": "https://pubmed.ncbi.nlm.nih.gov/19857493" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19887911", "url": "https://pubmed.ncbi.nlm.nih.gov/19887911" }, { "database": "PubMed", "id": "19903847", "url": "https://pubmed.ncbi.nlm.nih.gov/19903847" }, { "database": "PubMed", "id": "19965871", "url": "https://pubmed.ncbi.nlm.nih.gov/19965871" }, { "database": "PubMed", "id": "20018442", "url": "https://pubmed.ncbi.nlm.nih.gov/20018442" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20123963", "url": "https://pubmed.ncbi.nlm.nih.gov/20123963" }, { "database": "PubMed", "id": "20171273", "url": "https://pubmed.ncbi.nlm.nih.gov/20171273" }, { "database": "PubMed", "id": "20234185", "url": "https://pubmed.ncbi.nlm.nih.gov/20234185" }, { "database": "PubMed", "id": "20673369", "url": "https://pubmed.ncbi.nlm.nih.gov/20673369" }, { "database": "PubMed", "id": "21057547", "url": "https://pubmed.ncbi.nlm.nih.gov/21057547" }, { "database": "PubMed", "id": "21080333", "url": "https://pubmed.ncbi.nlm.nih.gov/21080333" }, { "database": "PubMed", "id": "21173028", "url": "https://pubmed.ncbi.nlm.nih.gov/21173028" }, { "database": "PubMed", "id": "21192925", "url": "https://pubmed.ncbi.nlm.nih.gov/21192925" }, { "database": "PubMed", "id": "21308739", "url": "https://pubmed.ncbi.nlm.nih.gov/21308739" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21394211", "url": "https://pubmed.ncbi.nlm.nih.gov/21394211" }, { "database": "PubMed", "id": "21451571", "url": "https://pubmed.ncbi.nlm.nih.gov/21451571" }, { "database": "PubMed", "id": "21539808", "url": "https://pubmed.ncbi.nlm.nih.gov/21539808" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21576488", "url": "https://pubmed.ncbi.nlm.nih.gov/21576488" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21602882", "url": "https://pubmed.ncbi.nlm.nih.gov/21602882" }, { "database": "PubMed", "id": "21698151", "url": "https://pubmed.ncbi.nlm.nih.gov/21698151" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21903158", "url": "https://pubmed.ncbi.nlm.nih.gov/21903158" }, { "database": "PubMed", "id": "22011578", "url": "https://pubmed.ncbi.nlm.nih.gov/22011578" }, { "database": "PubMed", "id": "22110707", "url": "https://pubmed.ncbi.nlm.nih.gov/22110707" }, { "database": "PubMed", "id": "22166212", "url": "https://pubmed.ncbi.nlm.nih.gov/22166212" }, { "database": "PubMed", "id": "22244155", "url": "https://pubmed.ncbi.nlm.nih.gov/22244155" }, { "database": "PubMed", "id": "22331558", "url": "https://pubmed.ncbi.nlm.nih.gov/22331558" }, { "database": "PubMed", "id": "22397410", "url": "https://pubmed.ncbi.nlm.nih.gov/22397410" }, { "database": "PubMed", "id": "22435726", "url": "https://pubmed.ncbi.nlm.nih.gov/22435726" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22662219", "url": "https://pubmed.ncbi.nlm.nih.gov/22662219" }, { "database": "PubMed", "id": "22797063", "url": "https://pubmed.ncbi.nlm.nih.gov/22797063" }, { "database": "PubMed", "id": "22878263", "url": "https://pubmed.ncbi.nlm.nih.gov/22878263" }, { "database": "PubMed", "id": "22935610", "url": "https://pubmed.ncbi.nlm.nih.gov/22935610" }, { "database": "PubMed", "id": "23030661", "url": "https://pubmed.ncbi.nlm.nih.gov/23030661" }, { "database": "PubMed", "id": "23536002", "url": "https://pubmed.ncbi.nlm.nih.gov/23536002" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23666755", "url": "https://pubmed.ncbi.nlm.nih.gov/23666755" }, { "database": "PubMed", "id": "23703384", "url": "https://pubmed.ncbi.nlm.nih.gov/23703384" }, { "database": "PubMed", "id": "23717325", "url": "https://pubmed.ncbi.nlm.nih.gov/23717325" }, { "database": "PubMed", "id": "23800173", "url": "https://pubmed.ncbi.nlm.nih.gov/23800173" }, { "database": "PubMed", "id": "23826318", "url": "https://pubmed.ncbi.nlm.nih.gov/23826318" }, { "database": "PubMed", "id": "23883471", "url": "https://pubmed.ncbi.nlm.nih.gov/23883471" }, { "database": "PubMed", "id": "24196445", "url": "https://pubmed.ncbi.nlm.nih.gov/24196445" }, { "database": "PubMed", "id": "24379358", "url": "https://pubmed.ncbi.nlm.nih.gov/24379358" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24726920", "url": "https://pubmed.ncbi.nlm.nih.gov/24726920" }, { "database": "PubMed", "id": "24810057", "url": "https://pubmed.ncbi.nlm.nih.gov/24810057" }, { "database": "PubMed", "id": "24829283", "url": "https://pubmed.ncbi.nlm.nih.gov/24829283" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24905183", "url": "https://pubmed.ncbi.nlm.nih.gov/24905183" }, { "database": "PubMed", "id": "24915467", "url": "https://pubmed.ncbi.nlm.nih.gov/24915467" }, { "database": "PubMed", "id": "24922063", "url": "https://pubmed.ncbi.nlm.nih.gov/24922063" }, { "database": "PubMed", "id": "24952595", "url": "https://pubmed.ncbi.nlm.nih.gov/24952595" }, { "database": "PubMed", "id": "25260780", "url": "https://pubmed.ncbi.nlm.nih.gov/25260780" }, { "database": "PubMed", "id": "25294809", "url": "https://pubmed.ncbi.nlm.nih.gov/25294809" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25778922", "url": "https://pubmed.ncbi.nlm.nih.gov/25778922" }, { "database": "PubMed", "id": "25852310", "url": "https://pubmed.ncbi.nlm.nih.gov/25852310" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "25944899", "url": "https://pubmed.ncbi.nlm.nih.gov/25944899" }, { "database": "PubMed", "id": "25989210", "url": "https://pubmed.ncbi.nlm.nih.gov/25989210" }, { "database": "PubMed", "id": "26006237", "url": "https://pubmed.ncbi.nlm.nih.gov/26006237" }, { "database": "PubMed", "id": "26029824", "url": "https://pubmed.ncbi.nlm.nih.gov/26029824" }, { "database": "PubMed", "id": "26042776", "url": "https://pubmed.ncbi.nlm.nih.gov/26042776" }, { "database": "PubMed", "id": "26112218", "url": "https://pubmed.ncbi.nlm.nih.gov/26112218" }, { "database": "PubMed", "id": "26113041", "url": "https://pubmed.ncbi.nlm.nih.gov/26113041" }, { "database": "PubMed", "id": "26138448", "url": "https://pubmed.ncbi.nlm.nih.gov/26138448" }, { "database": "PubMed", "id": "26230405", "url": "https://pubmed.ncbi.nlm.nih.gov/26230405" }, { "database": "PubMed", "id": "26231043", "url": "https://pubmed.ncbi.nlm.nih.gov/26231043" }, { "database": "PubMed", "id": "26297485", "url": "https://pubmed.ncbi.nlm.nih.gov/26297485" }, { "database": "PubMed", "id": "26386653", "url": "https://pubmed.ncbi.nlm.nih.gov/26386653" }, { "database": "PubMed", "id": "26716417", "url": "https://pubmed.ncbi.nlm.nih.gov/26716417" }, { "database": "PubMed", "id": "26967060", "url": "https://pubmed.ncbi.nlm.nih.gov/26967060" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "27238720", "url": "https://pubmed.ncbi.nlm.nih.gov/27238720" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27659536", "url": "https://pubmed.ncbi.nlm.nih.gov/27659536" }, { "database": "PubMed", "id": "27766434", "url": "https://pubmed.ncbi.nlm.nih.gov/27766434" }, { "database": "PubMed", "id": "27787517", "url": "https://pubmed.ncbi.nlm.nih.gov/27787517" }, { "database": "PubMed", "id": "28035068", "url": "https://pubmed.ncbi.nlm.nih.gov/28035068" }, { "database": "PubMed", "id": "28060750", "url": "https://pubmed.ncbi.nlm.nih.gov/28060750" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28477117", "url": "https://pubmed.ncbi.nlm.nih.gov/28477117" }, { "database": "PubMed", "id": "29156763", "url": "https://pubmed.ncbi.nlm.nih.gov/29156763" }, { "database": "PubMed", "id": "29899847", "url": "https://pubmed.ncbi.nlm.nih.gov/29899847" }, { "database": "PubMed", "id": "30096294", "url": "https://pubmed.ncbi.nlm.nih.gov/30096294" }, { "database": "PubMed", "id": "30142917", "url": "https://pubmed.ncbi.nlm.nih.gov/30142917" }, { "database": "PubMed", "id": "30254375", "url": "https://pubmed.ncbi.nlm.nih.gov/30254375" }, { "database": "PubMed", "id": "30338379", "url": "https://pubmed.ncbi.nlm.nih.gov/30338379" }, { "database": "PubMed", "id": "30520728", "url": "https://pubmed.ncbi.nlm.nih.gov/30520728" }, { "database": "PubMed", "id": "30585287", "url": "https://pubmed.ncbi.nlm.nih.gov/30585287" }, { "database": "PubMed", "id": "30587121", "url": "https://pubmed.ncbi.nlm.nih.gov/30587121" }, { "database": "PubMed", "id": "30718466", "url": "https://pubmed.ncbi.nlm.nih.gov/30718466" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31462218", "url": "https://pubmed.ncbi.nlm.nih.gov/31462218" }, { "database": "PubMed", "id": "31466709", "url": "https://pubmed.ncbi.nlm.nih.gov/31466709" }, { "database": "PubMed", "id": "31804459", "url": "https://pubmed.ncbi.nlm.nih.gov/31804459" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32213959", "url": "https://pubmed.ncbi.nlm.nih.gov/32213959" }, { "database": "PubMed", "id": "32260204", "url": "https://pubmed.ncbi.nlm.nih.gov/32260204" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32681102", "url": "https://pubmed.ncbi.nlm.nih.gov/32681102" }, { "database": "PubMed", "id": "32873775", "url": "https://pubmed.ncbi.nlm.nih.gov/32873775" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "33063904", "url": "https://pubmed.ncbi.nlm.nih.gov/33063904" }, { "database": "PubMed", "id": "33110364", "url": "https://pubmed.ncbi.nlm.nih.gov/33110364" }, { "database": "PubMed", "id": "33245719", "url": "https://pubmed.ncbi.nlm.nih.gov/33245719" }, { "database": "PubMed", "id": "33443163", "url": "https://pubmed.ncbi.nlm.nih.gov/33443163" }, { "database": "PubMed", "id": "33591310", "url": "https://pubmed.ncbi.nlm.nih.gov/33591310" }, { "database": "PubMed", "id": "34947995", "url": "https://pubmed.ncbi.nlm.nih.gov/34947995" }, { "database": "PubMed", "id": "35065218", "url": "https://pubmed.ncbi.nlm.nih.gov/35065218" }, { "database": "PubMed", "id": "35227287", "url": "https://pubmed.ncbi.nlm.nih.gov/35227287" }, { "database": "PubMed", "id": "36164647", "url": "https://pubmed.ncbi.nlm.nih.gov/36164647" } ], "site_lbl": "Ser46", "uniprot_canonical_ac": "P04637-1" } ], "record_id": "pubmed.31150435", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Increased Expression of LYNX1 in Ovarian Serous Cystadenocarcinoma Predicts Poor Prognosis.", "journal": "BioMed research international", "date": "2020", "authors": "Liu Hui, Wang Ao, Ma Yushan", "reference": { "type": "PubMed", "id": "33299855", "url": "https://pubmed.ncbi.nlm.nih.gov/33299855" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DP58-1", "protein_name": "Ly-6/neurotoxin-like protein 1", "gene_name": "LYNX1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP58", "url": "https://www.uniprot.org/uniprotkb/P0DP58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33299855", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spatial Structure and Activity of Synthetic Fragments of Lynx1 and of Nicotinic Receptor Loop C Models.", "journal": "Biomolecules", "date": "2020-12-22", "authors": "Mineev Konstantin S, Kryukova Elena V, Kasheverov Igor E, Egorova Natalia S, Zhmak Maxim N, Ivanov Igor A, Senko Dmitry A, Feofanov Alexey V, Ignatova Anastasia A, Arseniev Alexander S, Utkin Yuri N, Tsetlin Victor I", "reference": { "type": "PubMed", "id": "33374963", "url": "https://pubmed.ncbi.nlm.nih.gov/33374963" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DP58-1", "protein_name": "Ly-6/neurotoxin-like protein 1", "gene_name": "LYNX1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP58", "url": "https://www.uniprot.org/uniprotkb/P0DP58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33374963", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lynx1 and the family of endogenous mammalian neurotoxin-like proteins and their roles in modulating nAChR function.", "journal": "Pharmacological research", "date": "2023-08", "authors": "Palumbo Talulla B, Miwa Julie M", "reference": { "type": "PubMed", "id": "37437646", "url": "https://pubmed.ncbi.nlm.nih.gov/37437646" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DP58-1", "protein_name": "Ly-6/neurotoxin-like protein 1", "gene_name": "LYNX1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP58", "url": "https://www.uniprot.org/uniprotkb/P0DP58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37437646", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RERG is a novel ras-related, estrogen-regulated and growth-inhibitory gene in breast cancer.", "journal": "The Journal of biological chemistry", "date": "2001-11-09", "authors": "Finlin B S, Gau C L, Murphy G A, Shao H, Kimel T, Seitz R S, Chiu Y F, Botstein D, Brown P O, Der C J, Tamanoi F, Andres D A, Perou C M", "reference": { "type": "PubMed", "id": "11533059", "url": "https://pubmed.ncbi.nlm.nih.gov/11533059" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96A58-1", "protein_name": "Ras-related and estrogen-regulated growth inhibitor", "gene_name": "RERG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96A58", "url": "https://www.uniprot.org/uniprotkb/Q96A58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11533059", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RERG (Ras-like, oestrogen-regulated, growth-inhibitor) expression in breast cancer: a marker of ER-positive luminal-like subtype.", "journal": "Breast cancer research and treatment", "date": "2011", "authors": "Habashy HO, Powe DG, Glaab E, Ball G, Spiteri I, Krasnogor N, Garibaldi JM, Rakha EA, Green AR, Caldas C, Ellis IO", "reference": { "type": "PubMed", "id": "20697807", "url": "https://pubmed.ncbi.nlm.nih.gov/20697807" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96A58-1", "protein_name": "Ras-related and estrogen-regulated growth inhibitor", "gene_name": "RERG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96A58", "url": "https://www.uniprot.org/uniprotkb/Q96A58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20697807", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of CRABP1, GRP, and RERG mRNA in clinically non-functioning and functioning pituitary adenomas.", "journal": "Journal of endocrinological investigation", "date": "2011", "authors": "Chile T, Correa-Giannella ML, Fortes MA, Bronstein MD, Cunha-Neto MB, Giannella-Neto D, Giorgi RR", "reference": { "type": "PubMed", "id": "21270509", "url": "https://pubmed.ncbi.nlm.nih.gov/21270509" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96A58-1", "protein_name": "Ras-related and estrogen-regulated growth inhibitor", "gene_name": "RERG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96A58", "url": "https://www.uniprot.org/uniprotkb/Q96A58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21270509", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ERbeta- and prostaglandin E2-regulated pathways integrate cell proliferation via Ras-like and estrogen-regulated growth inhibitor in endometriosis.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2014", "authors": "Monsivais D, Dyson MT, Yin P, Coon JS, Navarro A, Feng G, Malpani SS, Ono M, Ercan CM, Wei JJ, Pavone ME, Su E, Bulun SE", "reference": { "type": "PubMed", "id": "24992181", "url": "https://pubmed.ncbi.nlm.nih.gov/24992181" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96A58-1", "protein_name": "Ras-related and estrogen-regulated growth inhibitor", "gene_name": "RERG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96A58", "url": "https://www.uniprot.org/uniprotkb/Q96A58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24992181", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MicroRNA-382-5p aggravates breast cancer progression by regulating the RERG/Ras/ERK signaling axis.", "journal": "Oncotarget", "date": "2017", "authors": "Ho JY, Hsu RJ, Liu JM, Chen SC, Liao GS, Gao HW, Yu CP", "reference": { "type": "PubMed", "id": "27705918", "url": "https://pubmed.ncbi.nlm.nih.gov/27705918" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96A58-1", "protein_name": "Ras-related and estrogen-regulated growth inhibitor", "gene_name": "RERG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96A58", "url": "https://www.uniprot.org/uniprotkb/Q96A58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27705918", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Quantitation of DNA methylation in Epstein-Barr virus-associated nasopharyngeal carcinoma by bisulfite amplicon sequencing.", "journal": "BMC cancer", "date": "2017", "authors": "Zhao W, Mo Y, Wang S, Midorikawa K, Ma N, Hiraku Y, Oikawa S, Huang G, Zhang Z, Murata M, Takeuchi K", "reference": { "type": "PubMed", "id": "28716111", "url": "https://pubmed.ncbi.nlm.nih.gov/28716111" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96A58-1", "protein_name": "Ras-related and estrogen-regulated growth inhibitor", "gene_name": "RERG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAW3-1", "protein_name": "Zinc finger protein 671", "gene_name": "ZNF671", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96A58", "url": "https://www.uniprot.org/uniprotkb/Q96A58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28716111", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ERK5regulated RERG expression promotes cancer progression in prostatic carcinoma.", "journal": "Oncology reports", "date": "2019", "authors": "Xiong Y, Huang H, Chen S, Dai H, Zhang L", "reference": { "type": "PubMed", "id": "30431143", "url": "https://pubmed.ncbi.nlm.nih.gov/30431143" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96A58-1", "protein_name": "Ras-related and estrogen-regulated growth inhibitor", "gene_name": "RERG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96A58", "url": "https://www.uniprot.org/uniprotkb/Q96A58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30431143", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NF-kappaB-mediated miR-650 plays oncogenic roles and activates AKT/ERK/NF-kappaB pathways by targeting RERG in glioma cells.", "journal": "Cellular oncology (Dordrecht)", "date": "2020", "authors": "Jin S, Li X, Dai Y, Li C, Wang D", "reference": { "type": "PubMed", "id": "32986146", "url": "https://pubmed.ncbi.nlm.nih.gov/32986146" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96A58-1", "protein_name": "Ras-related and estrogen-regulated growth inhibitor", "gene_name": "RERG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96A58", "url": "https://www.uniprot.org/uniprotkb/Q96A58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32986146", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ropporin, a sperm-specific binding protein of rhophilin, that is localized in the fibrous sheath of sperm flagella.", "journal": "Journal of cell science", "date": "2000", "authors": "Fujita A, Nakamura K, Kato T, Watanabe N, Ishizaki T, Kimura K, Mizoguchi A, Narumiya S", "reference": { "type": "PubMed", "id": "10591629", "url": "https://pubmed.ncbi.nlm.nih.gov/10591629" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HAP6-1", "protein_name": "Protein lin-7 homolog B", "gene_name": "LIN7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61586-1", "protein_name": "Transforming protein RhoA", "gene_name": "RHOA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCX5-1", "protein_name": "Rhophilin-1", "gene_name": "RHPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BST9-1", "protein_name": "Rhotekin", "gene_name": "RTKN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08134-1", "protein_name": "Rho-related GTP-binding protein RhoC", "gene_name": "RHOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC4-1", "protein_name": "Rhophilin-2", "gene_name": "RHPN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14907-1", "protein_name": "Tax1-binding protein 3", "gene_name": "TAX1BP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAT0-1", "protein_name": "Ropporin-1A", "gene_name": "ROPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q61085-1", "protein_name": "Rhophilin-1", "gene_name": "Rhpn1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9ESG2-1", "protein_name": "Ropporin-1", "gene_name": "Ropn1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P62745-1", "protein_name": "Rho-related GTP-binding protein RhoB", "gene_name": "RHOB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HAP6", "url": "https://www.uniprot.org/uniprotkb/Q9HAP6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10591629", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning, expression characterization, and mapping of a novel putative inhibitor of rho GTPase activity, RTKN, to D2S145-D2S286.", "journal": "Genomics", "date": "2000", "authors": "Fu Q, Yu L, Liu Q, Zhang J, Zhang H, Zhao S", "reference": { "type": "PubMed", "id": "10873388", "url": "https://pubmed.ncbi.nlm.nih.gov/10873388" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HAP6-1", "protein_name": "Protein lin-7 homolog B", "gene_name": "LIN7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14827-1", "protein_name": "Ras-specific guanine nucleotide-releasing factor 2", "gene_name": "RASGRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0I2-1", "protein_name": "ER membrane protein complex subunit 3", "gene_name": "EMC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03135-1", "protein_name": "Caveolin-1", "gene_name": "CAV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQW6-1", "protein_name": "Anillin", "gene_name": "ANLN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15173-1", "protein_name": "Membrane-associated progesterone receptor component 2", "gene_name": "PGRMC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16512-1", "protein_name": "Serine/threonine-protein kinase N1", "gene_name": "PKN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ64-1", "protein_name": "Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2", "gene_name": "ARAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07021-1", "protein_name": "Complement component 1 Q subcomponent-binding protein, mitochondrial", "gene_name": "C1QBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TER5-1", "protein_name": "Rho guanine nucleotide exchange factor 40", "gene_name": "ARHGEF40", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15013-1", "protein_name": "Rho guanine nucleotide exchange factor 10", "gene_name": "ARHGEF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z6B7-1", "protein_name": "SLIT-ROBO Rho GTPase-activating protein 1", "gene_name": "SRGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VW2-1", "protein_name": "Rho guanine nucleotide exchange factor 25", "gene_name": "ARHGEF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15085-1", "protein_name": "Rho guanine nucleotide exchange factor 11", "gene_name": "ARHGEF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61586-1", "protein_name": "Transforming protein RhoA", "gene_name": "RHOA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1W1-1", "protein_name": "Rho guanine nucleotide exchange factor 28", "gene_name": "ARHGEF28", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR80-1", "protein_name": "Rho guanine nucleotide exchange factor 4", "gene_name": "ARHGEF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WWN8-1", "protein_name": "Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3", "gene_name": "ARAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12774-1", "protein_name": "Rho guanine nucleotide exchange factor 5", "gene_name": "ARHGEF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE2-1", "protein_name": "Rho guanine nucleotide exchange factor 17", "gene_name": "ARHGEF17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZSZ5-4", "protein_name": "Rho guanine nucleotide exchange factor 18", "gene_name": "ARHGEF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P48-6", "protein_name": "Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1", "gene_name": "ARAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE6-1", "protein_name": "Rho guanine nucleotide exchange factor 10-like protein", "gene_name": "ARHGEF10L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZN5-1", "protein_name": "Rho guanine nucleotide exchange factor 12", "gene_name": "ARHGEF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94989-1", "protein_name": "Rho guanine nucleotide exchange factor 15", "gene_name": "ARHGEF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR81-1", "protein_name": "Rho guanine nucleotide exchange factor 3", "gene_name": "ARHGEF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60890-1", "protein_name": "Oligophrenin-1", "gene_name": "OPHN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWB9-1", "protein_name": "Testis-expressed protein 2", "gene_name": "TEX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13009-1", "protein_name": "Rho guanine nucleotide exchange factor TIAM1", "gene_name": "TIAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4D1-1", "protein_name": "Disheveled-associated activator of morphogenesis 1", "gene_name": "DAAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95210-1", "protein_name": "Starch-binding domain-containing protein 1", "gene_name": "STBD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUY9-1", "protein_name": "DEP domain-containing protein 1B", "gene_name": "DEPDC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49257-1", "protein_name": "Protein ERGIC-53", "gene_name": "LMAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P107-1", "protein_name": "GEM-interacting protein", "gene_name": "GMIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92619-1", "protein_name": "Rho GTPase-activating protein 45", "gene_name": "ARHGAP45", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13393-1", "protein_name": "Phospholipase D1", "gene_name": "PLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCX5-1", "protein_name": "Rhophilin-1", "gene_name": "RHPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VST9-1", "protein_name": "Obscurin", "gene_name": "OBSCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5V2-1", "protein_name": "Ephexin-1", "gene_name": "NGEF", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60245-1", "protein_name": "Protocadherin-7", "gene_name": "PCDH7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98171-1", "protein_name": "Rho GTPase-activating protein 4", "gene_name": "ARHGAP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NI28-1", "protein_name": "Rho GTPase-activating protein 42", "gene_name": "ARHGAP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43182-1", "protein_name": "Rho GTPase-activating protein 6", "gene_name": "ARHGAP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CB8-1", "protein_name": "Rho GTPase-activating protein 19", "gene_name": "ARHGAP19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96QB1-2", "protein_name": "Rho GTPase-activating protein 7", "gene_name": "DLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2F6-1", "protein_name": "Rho GTPase-activating protein 20", "gene_name": "ARHGAP20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BST9-1", "protein_name": "Rhotekin", "gene_name": "RTKN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P4F7-1", "protein_name": "Rho GTPase-activating protein 11A", "gene_name": "ARHGAP11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N392-1", "protein_name": "Rho GTPase-activating protein 18", "gene_name": "ARHGAP18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRY4-1", "protein_name": "Rho GTPase-activating protein 35", "gene_name": "ARHGAP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2N2-1", "protein_name": "Rho GTPase-activating protein 28", "gene_name": "ARHGAP28", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75116-1", "protein_name": "Rho-associated protein kinase 2", "gene_name": "ROCK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TG30-1", "protein_name": "Rho GTPase-activating protein 40", "gene_name": "ARHGAP40", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53LP3-1", "protein_name": "Ankyrin repeat domain-containing protein SOWAHC", "gene_name": "SOWAHC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08134-1", "protein_name": "Rho-related GTP-binding protein RhoC", "gene_name": "RHOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P227-1", "protein_name": "Rho GTPase-activating protein 23", "gene_name": "ARHGAP23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P85298-1", "protein_name": "Rho GTPase-activating protein 8", "gene_name": "ARHGAP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q17R89-1", "protein_name": "Rho GTPase-activating protein 44", "gene_name": "ARHGAP44", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13017-1", "protein_name": "Rho GTPase-activating protein 5", "gene_name": "ARHGAP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3KRB8-1", "protein_name": "Inactive Rho GTPase-activating protein 11B", "gene_name": "ARHGAP11B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LW3-1", "protein_name": "Rho GTPase-activating protein 29", "gene_name": "ARHGAP29", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC4-1", "protein_name": "Rhophilin-2", "gene_name": "RHPN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H5-1", "protein_name": "Rho GTPase-activating protein 39", "gene_name": "ARHGAP39", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2M1Z3-1", "protein_name": "Rho GTPase-activating protein 31", "gene_name": "ARHGAP31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14907-1", "protein_name": "Tax1-binding protein 3", "gene_name": "TAX1BP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00161-1", "protein_name": "Synaptosomal-associated protein 23", "gene_name": "SNAP23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2G2-1", "protein_name": "STE20-like serine/threonine-protein kinase", "gene_name": "SLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAA9-1", "protein_name": "Vang-like protein 1", "gene_name": "VANGL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HY6-1", "protein_name": "DDRGK domain-containing protein 1", "gene_name": "DDRGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z628-1", "protein_name": "Neuroepithelial cell-transforming gene 1 protein", "gene_name": "NET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IW93-1", "protein_name": "Rho guanine nucleotide exchange factor 19", "gene_name": "ARHGEF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q58EX7-1", "protein_name": "Puratrophin-1", "gene_name": "PLEKHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15836-1", "protein_name": "Vesicle-associated membrane protein 3", "gene_name": "VAMP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P5Z2-1", "protein_name": "Serine/threonine-protein kinase N3", "gene_name": "PKN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96NT0-1", "protein_name": "Vacuolar ATPase assembly protein VMA22", "gene_name": "VMA22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VI3-1", "protein_name": "Ras GTPase-activating-like protein IQGAP3", "gene_name": "IQGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UDY2-1", "protein_name": "Tight junction protein 2", "gene_name": "TJP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15068-1", "protein_name": "Guanine nucleotide exchange factor DBS", "gene_name": "MCF2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10911-1", "protein_name": "Proto-oncogene DBL", "gene_name": "MCF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60229-1", "protein_name": "Kalirin", "gene_name": "KALRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3M8-1", "protein_name": "StAR-related lipid transfer protein 13", "gene_name": "STARD13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14578-1", "protein_name": "Citron Rho-interacting kinase", "gene_name": "CIT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4F1-1", "protein_name": "FERM, ARHGEF and pleckstrin domain-containing protein 1", "gene_name": "FARP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVF7-1", "protein_name": "Formin-like protein 3", "gene_name": "FMNL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42166-1", "protein_name": "Lamina-associated polypeptide 2, isoform alpha", "gene_name": "TMPO", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94988-4", "protein_name": "Protein FAM13A", "gene_name": "FAM13A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T8D3-1", "protein_name": "Acyl-CoA-binding domain-containing protein 5", "gene_name": "ACBD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12979-1", "protein_name": "Active breakpoint cluster region-related protein", "gene_name": "ABR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68032-1", "protein_name": "Actin, alpha cardiac muscle 1", "gene_name": "ACTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92974-1", "protein_name": "Rho guanine nucleotide exchange factor 2", "gene_name": "ARHGEF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAT0-1", "protein_name": "Ropporin-1A", "gene_name": "ROPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14155-4", "protein_name": "Rho guanine nucleotide exchange factor 7", "gene_name": "ARHGEF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4E7-1", "protein_name": "Differentially expressed in FDCP 6 homolog", "gene_name": "DEF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14923-1", "protein_name": "Junction plakoglobin", "gene_name": "JUP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12802-1", "protein_name": "A-kinase anchor protein 13", "gene_name": "AKAP13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02786-1", "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVM8-1", "protein_name": "Sec1 family domain-containing protein 1", "gene_name": "SCFD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N264-1", "protein_name": "Rho GTPase-activating protein 24", "gene_name": "ARHGAP24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKW4-1", "protein_name": "Guanine nucleotide exchange factor VAV3", "gene_name": "VAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRR9-1", "protein_name": "Rho GTPase-activating protein 9", "gene_name": "ARHGAP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CS3-1", "protein_name": "FAS-associated factor 2", "gene_name": "FAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52565-1", "protein_name": "Rho GDP-dissociation inhibitor 1", "gene_name": "ARHGDIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51572-1", "protein_name": "B-cell receptor-associated protein 31", "gene_name": "BCAP31", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62745-1", "protein_name": "Rho-related GTP-binding protein RhoB", "gene_name": "RHOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UP2-1", "protein_name": "Kinectin", "gene_name": "KTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92608-1", "protein_name": "Dedicator of cytokinesis protein 2", "gene_name": "DOCK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H8V3-1", "protein_name": "Protein ECT2", "gene_name": "ECT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60610-1", "protein_name": "Protein diaphanous homolog 1", "gene_name": "DIAPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSV4-3", "protein_name": "Protein diaphanous homolog 3", "gene_name": "DIAPH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RTY4-1", "protein_name": "Unconventional myosin-IXa", "gene_name": "MYO9A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13459-1", "protein_name": "Unconventional myosin-IXb", "gene_name": "MYO9B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43121-1", "protein_name": "Cell surface glycoprotein MUC18", "gene_name": "MCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1L390-1", "protein_name": "Pleckstrin homology domain-containing family G member 3", "gene_name": "PLEKHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94827-5", "protein_name": "Pleckstrin homology domain-containing family G member 5", "gene_name": "PLEKHG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A4S6-1", "protein_name": "Rho GTPase-activating protein 10", "gene_name": "ARHGAP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q70Z35-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein", "gene_name": "PREX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z6I6-1", "protein_name": "Rho GTPase-activating protein 30", "gene_name": "ARHGAP30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30519-1", "protein_name": "Heme oxygenase 2", "gene_name": "HMOX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16513-1", "protein_name": "Serine/threonine-protein kinase N2", "gene_name": "PKN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94804-1", "protein_name": "Serine/threonine-protein kinase 10", "gene_name": "STK10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N103-1", "protein_name": "T-cell activation Rho GTPase-activating protein", "gene_name": "TAGAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92502-1", "protein_name": "StAR-related lipid transfer protein 8", "gene_name": "STARD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15904-1", "protein_name": "V-type proton ATPase subunit S1", "gene_name": "ATP6AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14254-1", "protein_name": "Flotillin-2", "gene_name": "FLOT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNA1-1", "protein_name": "Rho GTPase-activating protein 26", "gene_name": "ARHGAP26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14739-1", "protein_name": "Delta(14)-sterol reductase LBR", "gene_name": "LBR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NZI2-1", "protein_name": "Caveolae-associated protein 1", "gene_name": "CAVIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z5H3-1", "protein_name": "Rho GTPase-activating protein 22", "gene_name": "ARHGAP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCU6-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein", "gene_name": "PREX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07960-1", "protein_name": "Rho GTPase-activating protein 1", "gene_name": "ARHGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3KR16-1", "protein_name": "Pleckstrin homology domain-containing family G member 6", "gene_name": "PLEKHG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T5U3-1", "protein_name": "Rho GTPase-activating protein 21", "gene_name": "ARHGAP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52566-1", "protein_name": "Rho GDP-dissociation inhibitor 2", "gene_name": "ARHGDIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5G2-1", "protein_name": "Macoilin", "gene_name": "MACO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RT1-1", "protein_name": "Erbin", "gene_name": "ERBIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NBN3-1", "protein_name": "Golgi-pH regulating cation channel", "gene_name": "TMEM87A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75955-1", "protein_name": "Flotillin-1", "gene_name": "FLOT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28288-1", "protein_name": "ATP-binding cassette sub-family D member 3", "gene_name": "ABCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A7KAX9-1", "protein_name": "Rho GTPase-activating protein 32", "gene_name": "ARHGAP32", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HAP6", "url": "https://www.uniprot.org/uniprotkb/Q9HAP6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10873388", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 154 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The PDZ protein TIP-1 interacts with the Rho effector rhotekin and is involved in Rho signaling to the serum response element.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Reynaud C, Fabre S, Jalinot P", "reference": { "type": "PubMed", "id": "10940294", "url": "https://pubmed.ncbi.nlm.nih.gov/10940294" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HAP6-1", "protein_name": "Protein lin-7 homolog B", "gene_name": "LIN7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61586-1", "protein_name": "Transforming protein RhoA", "gene_name": "RHOA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCX5-1", "protein_name": "Rhophilin-1", "gene_name": "RHPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BST9-1", "protein_name": "Rhotekin", "gene_name": "RTKN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08134-1", "protein_name": "Rho-related GTP-binding protein RhoC", "gene_name": "RHOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC4-1", "protein_name": "Rhophilin-2", "gene_name": "RHPN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14907-1", "protein_name": "Tax1-binding protein 3", "gene_name": "TAX1BP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAT0-1", "protein_name": "Ropporin-1A", "gene_name": "ROPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62745-1", "protein_name": "Rho-related GTP-binding protein RhoB", "gene_name": "RHOB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HAP6", "url": "https://www.uniprot.org/uniprotkb/Q9HAP6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 561, "end_pos": 563, "sequence_org": "SPV", "sequence_mut": "APA", "comment": "Impairs interaction with TAX1BP3.", "evidence": [ { "database": "UniProtKB", "id": "Q9BST9", "url": "https://www.uniprot.org/uniprotkb/Q9BST9" }, { "database": "PubMed", "id": "10940294", "url": "https://pubmed.ncbi.nlm.nih.gov/10940294" } ], "uniprot_canonical_ac": "Q9BST9-1" } ], "record_id": "pubmed.10940294", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CASK and protein 4.1 support F-actin nucleation on neurexins.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Biederer T, Sudhof TC", "reference": { "type": "PubMed", "id": "11604393", "url": "https://pubmed.ncbi.nlm.nih.gov/11604393" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HAP6-1", "protein_name": "Protein lin-7 homolog B", "gene_name": "LIN7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUP9-1", "protein_name": "Protein lin-7 homolog C", "gene_name": "LIN7C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6XYQ8-1", "protein_name": "Synaptotagmin-10", "gene_name": "SYT10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N9I0-1", "protein_name": "Synaptotagmin-2", "gene_name": "SYT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SS6-1", "protein_name": "Synaptotagmin-9", "gene_name": "SYT9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99767-1", "protein_name": "Amyloid-beta A4 precursor protein-binding family A member 2", "gene_name": "APBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96018-1", "protein_name": "Amyloid-beta A4 precursor protein-binding family A member 3", "gene_name": "APBA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULB1-1", "protein_name": "Neurexin-1", "gene_name": "NRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2S2-1", "protein_name": "Neurexin-2", "gene_name": "NRXN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFZ3-1", "protein_name": "Neuroligin-4, Y-linked", "gene_name": "NLGN4Y", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N0W4-1", "protein_name": "Neuroligin-4, X-linked", "gene_name": "NLGN4X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15399-1", "protein_name": "Glutamate receptor ionotropic, NMDA 2D", "gene_name": "GRIN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61764-1", "protein_name": "Syntaxin-binding protein 1", "gene_name": "STXBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ94-1", "protein_name": "Neuroligin-3", "gene_name": "NLGN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFZ4-1", "protein_name": "Neuroligin-2", "gene_name": "NLGN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43166-1", "protein_name": "Signal-induced proliferation-associated 1-like protein 1", "gene_name": "SIPA1L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43581-1", "protein_name": "Synaptotagmin-7", "gene_name": "SYT7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2J2-1", "protein_name": "Band 4.1-like protein 3", "gene_name": "EPB41L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14490-1", "protein_name": "Disks large-associated protein 1", "gene_name": "DLGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14957-1", "protein_name": "Glutamate receptor ionotropic, NMDA 2C", "gene_name": "GRIN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4G0-1", "protein_name": "Band 4.1-like protein 1", "gene_name": "EPB41L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15700-1", "protein_name": "Disks large homolog 2", "gene_name": "DLG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13224-1", "protein_name": "Glutamate receptor ionotropic, NMDA 2B", "gene_name": "GRIN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12879-1", "protein_name": "Glutamate receptor ionotropic, NMDA 2A", "gene_name": "GRIN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P1A6-1", "protein_name": "Disks large-associated protein 2", "gene_name": "DLGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4C0-1", "protein_name": "Neurexin-3", "gene_name": "NRXN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2Q7-3", "protein_name": "Neuroligin-1", "gene_name": "NLGN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y566-1", "protein_name": "SH3 and multiple ankyrin repeat domains protein 1", "gene_name": "SHANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78352-1", "protein_name": "Disks large homolog 4", "gene_name": "DLG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPX8-3", "protein_name": "SH3 and multiple ankyrin repeat domains protein 2", "gene_name": "SHANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13255-1", "protein_name": "Metabotropic glutamate receptor 1", "gene_name": "GRM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UE6-1", "protein_name": "Leucine-rich repeat transmembrane neuronal protein 1", "gene_name": "LRRTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43300-1", "protein_name": "Leucine-rich repeat transmembrane neuronal protein 2", "gene_name": "LRRTM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH4-1", "protein_name": "Leucine-rich repeat transmembrane neuronal protein 4", "gene_name": "LRRTM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH5-1", "protein_name": "Leucine-rich repeat transmembrane neuronal protein 3", "gene_name": "LRRTM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95886-1", "protein_name": "Disks large-associated protein 3", "gene_name": "DLGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92796-1", "protein_name": "Disks large homolog 3", "gene_name": "DLG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11171-1", "protein_name": "Protein 4.1", "gene_name": "EPB41", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YM7-1", "protein_name": "Homer protein homolog 1", "gene_name": "HOMER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14910-1", "protein_name": "Protein lin-7 homolog A", "gene_name": "LIN7A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYB0-1", "protein_name": "SH3 and multiple ankyrin repeat domains protein 3", "gene_name": "SHANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2H0-2", "protein_name": "Disks large-associated protein 4", "gene_name": "DLGAP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21579-1", "protein_name": "Synaptotagmin-1", "gene_name": "SYT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43491-1", "protein_name": "Band 4.1-like protein 2", "gene_name": "EPB41L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCM4-1", "protein_name": "Band 4.1-like protein 5", "gene_name": "EPB41L5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IV01-1", "protein_name": "Synaptotagmin-12", "gene_name": "SYT12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05586-1", "protein_name": "Glutamate receptor ionotropic, NMDA 1", "gene_name": "GRIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUH8-1", "protein_name": "Brain-enriched guanylate kinase-associated protein", "gene_name": "BEGAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16623-1", "protein_name": "Syntaxin-1A", "gene_name": "STX1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HC4-1", "protein_name": "PDZ and LIM domain protein 5", "gene_name": "PDLIM5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41594-1", "protein_name": "Metabotropic glutamate receptor 5", "gene_name": "GRM5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSB8-1", "protein_name": "Homer protein homolog 2", "gene_name": "HOMER2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02410-1", "protein_name": "Amyloid-beta A4 precursor protein-binding family A member 1", "gene_name": "APBA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSC5-1", "protein_name": "Homer protein homolog 3", "gene_name": "HOMER3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU6-1", "protein_name": "Drebrin-like protein", "gene_name": "DBNL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HAP6", "url": "https://www.uniprot.org/uniprotkb/Q9HAP6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11604393", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Basolateral membrane expression of the Kir 2.3 channel is coordinated by PDZ interaction with Lin-7/CASK complex.", "journal": "American journal of physiology. Cell physiology", "date": "2002-01", "authors": "Olsen Olav, Liu Hui, Wade James B, Merot Jean, Welling Paul A", "reference": { "type": "PubMed", "id": "11742811", "url": "https://pubmed.ncbi.nlm.nih.gov/11742811" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HAP6-1", "protein_name": "Protein lin-7 homolog B", "gene_name": "LIN7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O88951-1", "protein_name": "Protein lin-7 homolog B", "gene_name": "Lin7b", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HAP6", "url": "https://www.uniprot.org/uniprotkb/Q9HAP6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11742811", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The RhoA-binding protein, rhophilin-2, regulates actin cytoskeleton organization.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Peck JW, Oberst M, Bouker KB, Bowden E, Burbelo PD", "reference": { "type": "PubMed", "id": "12221077", "url": "https://pubmed.ncbi.nlm.nih.gov/12221077" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HAP6-1", "protein_name": "Protein lin-7 homolog B", "gene_name": "LIN7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14827-1", "protein_name": "Ras-specific guanine nucleotide-releasing factor 2", "gene_name": "RASGRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0I2-1", "protein_name": "ER membrane protein complex subunit 3", "gene_name": "EMC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03135-1", "protein_name": "Caveolin-1", "gene_name": "CAV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQW6-1", "protein_name": "Anillin", "gene_name": "ANLN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15173-1", "protein_name": "Membrane-associated progesterone receptor component 2", "gene_name": "PGRMC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16512-1", "protein_name": "Serine/threonine-protein kinase N1", "gene_name": "PKN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ64-1", "protein_name": "Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2", "gene_name": "ARAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07021-1", "protein_name": "Complement component 1 Q subcomponent-binding protein, mitochondrial", "gene_name": "C1QBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TER5-1", "protein_name": "Rho guanine nucleotide exchange factor 40", "gene_name": "ARHGEF40", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15013-1", "protein_name": "Rho guanine nucleotide exchange factor 10", "gene_name": "ARHGEF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z6B7-1", "protein_name": "SLIT-ROBO Rho GTPase-activating protein 1", "gene_name": "SRGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VW2-1", "protein_name": "Rho guanine nucleotide exchange factor 25", "gene_name": "ARHGEF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15085-1", "protein_name": "Rho guanine nucleotide exchange factor 11", "gene_name": "ARHGEF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61586-1", "protein_name": "Transforming protein RhoA", "gene_name": "RHOA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1W1-1", "protein_name": "Rho guanine nucleotide exchange factor 28", "gene_name": "ARHGEF28", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR80-1", "protein_name": "Rho guanine nucleotide exchange factor 4", "gene_name": "ARHGEF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WWN8-1", "protein_name": "Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3", "gene_name": "ARAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12774-1", "protein_name": "Rho guanine nucleotide exchange factor 5", "gene_name": "ARHGEF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PE2-1", "protein_name": "Rho guanine nucleotide exchange factor 17", "gene_name": "ARHGEF17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZSZ5-4", "protein_name": "Rho guanine nucleotide exchange factor 18", "gene_name": "ARHGEF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P48-6", "protein_name": "Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1", "gene_name": "ARAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE6-1", "protein_name": "Rho guanine nucleotide exchange factor 10-like protein", "gene_name": "ARHGEF10L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZN5-1", "protein_name": "Rho guanine nucleotide exchange factor 12", "gene_name": "ARHGEF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94989-1", "protein_name": "Rho guanine nucleotide exchange factor 15", "gene_name": "ARHGEF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR81-1", "protein_name": "Rho guanine nucleotide exchange factor 3", "gene_name": "ARHGEF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60890-1", "protein_name": "Oligophrenin-1", "gene_name": "OPHN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWB9-1", "protein_name": "Testis-expressed protein 2", "gene_name": "TEX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13009-1", "protein_name": "Rho guanine nucleotide exchange factor TIAM1", "gene_name": "TIAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4D1-1", "protein_name": "Disheveled-associated activator of morphogenesis 1", "gene_name": "DAAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95210-1", "protein_name": "Starch-binding domain-containing protein 1", "gene_name": "STBD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUY9-1", "protein_name": "DEP domain-containing protein 1B", "gene_name": "DEPDC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49257-1", "protein_name": "Protein ERGIC-53", "gene_name": "LMAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P107-1", "protein_name": "GEM-interacting protein", "gene_name": "GMIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92619-1", "protein_name": "Rho GTPase-activating protein 45", "gene_name": "ARHGAP45", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13393-1", "protein_name": "Phospholipase D1", "gene_name": "PLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCX5-1", "protein_name": "Rhophilin-1", "gene_name": "RHPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VST9-1", "protein_name": "Obscurin", "gene_name": "OBSCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5V2-1", "protein_name": "Ephexin-1", "gene_name": "NGEF", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60245-1", "protein_name": "Protocadherin-7", "gene_name": "PCDH7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98171-1", "protein_name": "Rho GTPase-activating protein 4", "gene_name": "ARHGAP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NI28-1", "protein_name": "Rho GTPase-activating protein 42", "gene_name": "ARHGAP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43182-1", "protein_name": "Rho GTPase-activating protein 6", "gene_name": "ARHGAP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14CB8-1", "protein_name": "Rho GTPase-activating protein 19", "gene_name": "ARHGAP19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96QB1-2", "protein_name": "Rho GTPase-activating protein 7", "gene_name": "DLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2F6-1", "protein_name": "Rho GTPase-activating protein 20", "gene_name": "ARHGAP20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BST9-1", "protein_name": "Rhotekin", "gene_name": "RTKN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P4F7-1", "protein_name": "Rho GTPase-activating protein 11A", "gene_name": "ARHGAP11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N392-1", "protein_name": "Rho GTPase-activating protein 18", "gene_name": "ARHGAP18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRY4-1", "protein_name": "Rho GTPase-activating protein 35", "gene_name": "ARHGAP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2N2-1", "protein_name": "Rho GTPase-activating protein 28", "gene_name": "ARHGAP28", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75116-1", "protein_name": "Rho-associated protein kinase 2", "gene_name": "ROCK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TG30-1", "protein_name": "Rho GTPase-activating protein 40", "gene_name": "ARHGAP40", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53LP3-1", "protein_name": "Ankyrin repeat domain-containing protein SOWAHC", "gene_name": "SOWAHC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08134-1", "protein_name": "Rho-related GTP-binding protein RhoC", "gene_name": "RHOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P227-1", "protein_name": "Rho GTPase-activating protein 23", "gene_name": "ARHGAP23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P85298-1", "protein_name": "Rho GTPase-activating protein 8", "gene_name": "ARHGAP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q17R89-1", "protein_name": "Rho GTPase-activating protein 44", "gene_name": "ARHGAP44", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13017-1", "protein_name": "Rho GTPase-activating protein 5", "gene_name": "ARHGAP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3KRB8-1", "protein_name": "Inactive Rho GTPase-activating protein 11B", "gene_name": "ARHGAP11B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LW3-1", "protein_name": "Rho GTPase-activating protein 29", "gene_name": "ARHGAP29", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC4-1", "protein_name": "Rhophilin-2", "gene_name": "RHPN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H5-1", "protein_name": "Rho GTPase-activating protein 39", "gene_name": "ARHGAP39", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2M1Z3-1", "protein_name": "Rho GTPase-activating protein 31", "gene_name": "ARHGAP31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14907-1", "protein_name": "Tax1-binding protein 3", "gene_name": "TAX1BP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00161-1", "protein_name": "Synaptosomal-associated protein 23", "gene_name": "SNAP23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2G2-1", "protein_name": "STE20-like serine/threonine-protein kinase", "gene_name": "SLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAA9-1", "protein_name": "Vang-like protein 1", "gene_name": "VANGL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HY6-1", "protein_name": "DDRGK domain-containing protein 1", "gene_name": "DDRGK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z628-1", "protein_name": "Neuroepithelial cell-transforming gene 1 protein", "gene_name": "NET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IW93-1", "protein_name": "Rho guanine nucleotide exchange factor 19", "gene_name": "ARHGEF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q58EX7-1", "protein_name": "Puratrophin-1", "gene_name": "PLEKHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15836-1", "protein_name": "Vesicle-associated membrane protein 3", "gene_name": "VAMP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P5Z2-1", "protein_name": "Serine/threonine-protein kinase N3", "gene_name": "PKN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96NT0-1", "protein_name": "Vacuolar ATPase assembly protein VMA22", "gene_name": "VMA22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VI3-1", "protein_name": "Ras GTPase-activating-like protein IQGAP3", "gene_name": "IQGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UDY2-1", "protein_name": "Tight junction protein 2", "gene_name": "TJP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15068-1", "protein_name": "Guanine nucleotide exchange factor DBS", "gene_name": "MCF2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10911-1", "protein_name": "Proto-oncogene DBL", "gene_name": "MCF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60229-1", "protein_name": "Kalirin", "gene_name": "KALRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3M8-1", "protein_name": "StAR-related lipid transfer protein 13", "gene_name": "STARD13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14578-1", "protein_name": "Citron Rho-interacting kinase", "gene_name": "CIT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4F1-1", "protein_name": "FERM, ARHGEF and pleckstrin domain-containing protein 1", "gene_name": "FARP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVF7-1", "protein_name": "Formin-like protein 3", "gene_name": "FMNL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42166-1", "protein_name": "Lamina-associated polypeptide 2, isoform alpha", "gene_name": "TMPO", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94988-4", "protein_name": "Protein FAM13A", "gene_name": "FAM13A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T8D3-1", "protein_name": "Acyl-CoA-binding domain-containing protein 5", "gene_name": "ACBD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12979-1", "protein_name": "Active breakpoint cluster region-related protein", "gene_name": "ABR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68032-1", "protein_name": "Actin, alpha cardiac muscle 1", "gene_name": "ACTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92974-1", "protein_name": "Rho guanine nucleotide exchange factor 2", "gene_name": "ARHGEF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAT0-1", "protein_name": "Ropporin-1A", "gene_name": "ROPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14155-4", "protein_name": "Rho guanine nucleotide exchange factor 7", "gene_name": "ARHGEF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4E7-1", "protein_name": "Differentially expressed in FDCP 6 homolog", "gene_name": "DEF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14923-1", "protein_name": "Junction plakoglobin", "gene_name": "JUP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12802-1", "protein_name": "A-kinase anchor protein 13", "gene_name": "AKAP13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02786-1", "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVM8-1", "protein_name": "Sec1 family domain-containing protein 1", "gene_name": "SCFD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N264-1", "protein_name": "Rho GTPase-activating protein 24", "gene_name": "ARHGAP24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKW4-1", "protein_name": "Guanine nucleotide exchange factor VAV3", "gene_name": "VAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRR9-1", "protein_name": "Rho GTPase-activating protein 9", "gene_name": "ARHGAP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CS3-1", "protein_name": "FAS-associated factor 2", "gene_name": "FAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52565-1", "protein_name": "Rho GDP-dissociation inhibitor 1", "gene_name": "ARHGDIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51572-1", "protein_name": "B-cell receptor-associated protein 31", "gene_name": "BCAP31", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62745-1", "protein_name": "Rho-related GTP-binding protein RhoB", "gene_name": "RHOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UP2-1", "protein_name": "Kinectin", "gene_name": "KTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92608-1", "protein_name": "Dedicator of cytokinesis protein 2", "gene_name": "DOCK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H8V3-1", "protein_name": "Protein ECT2", "gene_name": "ECT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60610-1", "protein_name": "Protein diaphanous homolog 1", "gene_name": "DIAPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSV4-3", "protein_name": "Protein diaphanous homolog 3", "gene_name": "DIAPH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RTY4-1", "protein_name": "Unconventional myosin-IXa", "gene_name": "MYO9A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13459-1", "protein_name": "Unconventional myosin-IXb", "gene_name": "MYO9B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43121-1", "protein_name": "Cell surface glycoprotein MUC18", "gene_name": "MCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1L390-1", "protein_name": "Pleckstrin homology domain-containing family G member 3", "gene_name": "PLEKHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94827-5", "protein_name": "Pleckstrin homology domain-containing family G member 5", "gene_name": "PLEKHG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A4S6-1", "protein_name": "Rho GTPase-activating protein 10", "gene_name": "ARHGAP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q70Z35-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein", "gene_name": "PREX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z6I6-1", "protein_name": "Rho GTPase-activating protein 30", "gene_name": "ARHGAP30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30519-1", "protein_name": "Heme oxygenase 2", "gene_name": "HMOX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16513-1", "protein_name": "Serine/threonine-protein kinase N2", "gene_name": "PKN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94804-1", "protein_name": "Serine/threonine-protein kinase 10", "gene_name": "STK10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N103-1", "protein_name": "T-cell activation Rho GTPase-activating protein", "gene_name": "TAGAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92502-1", "protein_name": "StAR-related lipid transfer protein 8", "gene_name": "STARD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15904-1", "protein_name": "V-type proton ATPase subunit S1", "gene_name": "ATP6AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14254-1", "protein_name": "Flotillin-2", "gene_name": "FLOT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNA1-1", "protein_name": "Rho GTPase-activating protein 26", "gene_name": "ARHGAP26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14739-1", "protein_name": "Delta(14)-sterol reductase LBR", "gene_name": "LBR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NZI2-1", "protein_name": "Caveolae-associated protein 1", "gene_name": "CAVIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z5H3-1", "protein_name": "Rho GTPase-activating protein 22", "gene_name": "ARHGAP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCU6-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein", "gene_name": "PREX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07960-1", "protein_name": "Rho GTPase-activating protein 1", "gene_name": "ARHGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3KR16-1", "protein_name": "Pleckstrin homology domain-containing family G member 6", "gene_name": "PLEKHG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T5U3-1", "protein_name": "Rho GTPase-activating protein 21", "gene_name": "ARHGAP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52566-1", "protein_name": "Rho GDP-dissociation inhibitor 2", "gene_name": "ARHGDIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5G2-1", "protein_name": "Macoilin", "gene_name": "MACO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RT1-1", "protein_name": "Erbin", "gene_name": "ERBIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NBN3-1", "protein_name": "Golgi-pH regulating cation channel", "gene_name": "TMEM87A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75955-1", "protein_name": "Flotillin-1", "gene_name": "FLOT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28288-1", "protein_name": "ATP-binding cassette sub-family D member 3", "gene_name": "ABCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A7KAX9-1", "protein_name": "Rho GTPase-activating protein 32", "gene_name": "ARHGAP32", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HAP6", "url": "https://www.uniprot.org/uniprotkb/Q9HAP6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 518, "end_pos": 518, "sequence_org": "R", "sequence_mut": "A", "comment": "Does not induce actin disassembly but still interacts with RhoA; when associated with A-526 and A-527.", "evidence": [ { "database": "UniProtKB", "id": "Q8IUC4", "url": "https://www.uniprot.org/uniprotkb/Q8IUC4" }, { "database": "PubMed", "id": "12221077", "url": "https://pubmed.ncbi.nlm.nih.gov/12221077" } ], "uniprot_canonical_ac": "Q8IUC4-1" }, { "start_pos": 526, "end_pos": 527, "sequence_org": "LG", "sequence_mut": "AA", "comment": "Does not induce actin disassembly but still interacts with RhoA; when associated with A-518.", "evidence": [ { "database": "UniProtKB", "id": "Q8IUC4", "url": "https://www.uniprot.org/uniprotkb/Q8IUC4" }, { "database": "PubMed", "id": "12221077", "url": "https://pubmed.ncbi.nlm.nih.gov/12221077" } ], "uniprot_canonical_ac": "Q8IUC4-1" }, { "start_pos": 58, "end_pos": 59, "sequence_org": "EN", "sequence_mut": "AA", "comment": "Abolishes interaction with RhoA.", "evidence": [ { "database": "UniProtKB", "id": "Q8IUC4", "url": "https://www.uniprot.org/uniprotkb/Q8IUC4" }, { "database": "PubMed", "id": "12221077", "url": "https://pubmed.ncbi.nlm.nih.gov/12221077" } ], "uniprot_canonical_ac": "Q8IUC4-1" } ], "record_id": "pubmed.12221077", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 154 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]