[ { "title": "Interferon-inducible factor 16 is a novel modulator of glucocorticoid action.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Berry A, Matthews L, Jangani M, Plumb J, Farrow S, Buchan N, Wilson PA, Singh D, Ray DW, Donn RP", "reference": { "type": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.20086048", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of glucocorticoid receptor phosphorylation in Mcl-1 and NOXA gene expression.", "journal": "Molecular cancer", "date": "2010", "authors": "Lynch JT, Rajendran R, Xenaki G, Berrou I, Demonacos C, Krstic-Demonacos M", "reference": { "type": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.20156337", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of phosphorylated sites in the mouse glucocorticoid receptor.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Bodwell JE, Orti E, Coull JM, Pappin DJ, Smith LI, Swift F", "reference": { "type": "PubMed", "id": "2019585", "url": "https://pubmed.ncbi.nlm.nih.gov/2019585" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06537-1", "protein_name": "Glucocorticoid receptor", "gene_name": "Nr3c1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 113, "end_pos": 113, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "2019585", "url": "https://pubmed.ncbi.nlm.nih.gov/2019585" }, { "database": "PubMed", "id": "7873448", "url": "https://pubmed.ncbi.nlm.nih.gov/7873448" } ], "site_lbl": "Ser113", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "2019585", "url": "https://pubmed.ncbi.nlm.nih.gov/2019585" }, { "database": "PubMed", "id": "7873448", "url": "https://pubmed.ncbi.nlm.nih.gov/7873448" } ], "site_lbl": "Ser141", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 131, "end_pos": 131, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06537", "url": "https://www.uniprot.org/uniprotkb/P06537" }, { "database": "PubMed", "id": "2019585", "url": "https://pubmed.ncbi.nlm.nih.gov/2019585" }, { "database": "iPTMnet", "id": "P06537", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06537" } ], "site_lbl": "Ser131", "uniprot_canonical_ac": "P06537-1" }, { "start_pos": 159, "end_pos": 159, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06537", "url": "https://www.uniprot.org/uniprotkb/P06537" }, { "database": "PubMed", "id": "2019585", "url": "https://pubmed.ncbi.nlm.nih.gov/2019585" }, { "database": "iPTMnet", "id": "P06537", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06537" } ], "site_lbl": "Ser159", "uniprot_canonical_ac": "P06537-1" }, { "start_pos": 168, "end_pos": 168, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P06537", "url": "https://www.uniprot.org/uniprotkb/P06537" }, { "database": "PubMed", "id": "2019585", "url": "https://pubmed.ncbi.nlm.nih.gov/2019585" }, { "database": "iPTMnet", "id": "P06537", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06537" } ], "site_lbl": "Thr168", "uniprot_canonical_ac": "P06537-1" }, { "start_pos": 221, "end_pos": 221, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06537", "url": "https://www.uniprot.org/uniprotkb/P06537" }, { "database": "PubMed", "id": "21994940", "url": "https://pubmed.ncbi.nlm.nih.gov/21994940" }, { "database": "PubMed", "id": "2019585", "url": "https://pubmed.ncbi.nlm.nih.gov/2019585" }, { "database": "iPTMnet", "id": "P06537", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06537" } ], "site_lbl": "Ser221", "uniprot_canonical_ac": "P06537-1" }, { "start_pos": 229, "end_pos": 229, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06537", "url": "https://www.uniprot.org/uniprotkb/P06537" }, { "database": "PubMed", "id": "2019585", "url": "https://pubmed.ncbi.nlm.nih.gov/2019585" }, { "database": "PubMed", "id": "21994940", "url": "https://pubmed.ncbi.nlm.nih.gov/21994940" }, { "database": "iPTMnet", "id": "P06537", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06537" } ], "site_lbl": "Ser229", "uniprot_canonical_ac": "P06537-1" }, { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06537", "url": "https://www.uniprot.org/uniprotkb/P06537" }, { "database": "PubMed", "id": "2019585", "url": "https://pubmed.ncbi.nlm.nih.gov/2019585" }, { "database": "PubMed", "id": "21994940", "url": "https://pubmed.ncbi.nlm.nih.gov/21994940" }, { "database": "iPTMnet", "id": "P06537", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06537" } ], "site_lbl": "Ser243", "uniprot_canonical_ac": "P06537-1" }, { "start_pos": 324, "end_pos": 324, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06537", "url": "https://www.uniprot.org/uniprotkb/P06537" }, { "database": "PubMed", "id": "2019585", "url": "https://pubmed.ncbi.nlm.nih.gov/2019585" }, { "database": "iPTMnet", "id": "P06537", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06537" } ], "site_lbl": "Ser324", "uniprot_canonical_ac": "P06537-1" } ], "record_id": "pubmed.2019585", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification of a human glucocorticoid receptor gene promoter-binding protein. Production of polyclonal antibodies against the purified factor.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Leclerc S, Xie B X, Roy R, Govindan M V", "reference": { "type": "PubMed", "id": "2026589", "url": "https://pubmed.ncbi.nlm.nih.gov/2026589" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2026589", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel point mutation in helix 10 of the human glucocorticoid receptor causes generalized glucocorticoid resistance by disrupting the structure of the ligand-binding domain.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2010", "authors": "Nader N, Bachrach BE, Hurt DE, Gajula S, Pittman A, Lescher R, Kino T", "reference": { "type": "PubMed", "id": "20335448", "url": "https://pubmed.ncbi.nlm.nih.gov/20335448" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20335448", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoid receptor-beta and receptor-gamma exert dominant negative effect on gene repression but not on gene induction.", "journal": "Endocrinology", "date": "2010-07", "authors": "Taniguchi Yoshinori, Iwasaki Yasumasa, Tsugita Makoto, Nishiyama Mitsuru, Taguchi Takafumi, Okazaki Mizuho, Nakayama Shuichi, Kambayashi Machiko, Hashimoto Kozo, Terada Yoshio", "reference": { "type": "PubMed", "id": "20484466", "url": "https://pubmed.ncbi.nlm.nih.gov/20484466" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20484466", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of ligand-dependent GR phosphorylation and half-life in determination of ligand-specific transcriptional activity.", "journal": "Molecular and cellular endocrinology", "date": "2010", "authors": "Avenant C, Ronacher K, Stubsrud E, Louw A, Hapgood JP", "reference": { "type": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.20561560", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AMPK regulates metabolic actions of glucocorticoids by phosphorylating the glucocorticoid receptor through p38 MAPK.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2010", "authors": "Nader N, Ng SS, Lambrou GI, Pervanidou P, Wang Y, Chrousos GP, Kino T", "reference": { "type": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.20660302", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ultradian cortisol pulsatility encodes a distinct, biologically important signal.", "journal": "PloS one", "date": "2011", "authors": "McMaster A, Jangani M, Sommer P, Han N, Brass A, Beesley S, Lu W, Berry A, Loudon A, Donn R, Ray DW", "reference": { "type": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.21267416", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Generalized glucocorticoid resistance accompanied with an adrenocortical adenoma and caused by a novel point mutation of human glucocorticoid receptor gene.", "journal": "Chinese medical journal", "date": "2011", "authors": "Zhu HJ, Dai YF, Wang O, Li M, Lu L, Zhao WG, Xing XP, Pan H, Li NS, Gong FY", "reference": { "type": "PubMed", "id": "21362280", "url": "https://pubmed.ncbi.nlm.nih.gov/21362280" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21362280", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoid-independent repression of tumor necrosis factor (TNF) alpha-stimulated interleukin (IL)-6 expression by the glucocorticoid receptor: a potential mechanism for protection against an excessive inflammatory response.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Verhoog NJ, Du Toit A, Avenant C, Hapgood JP", "reference": { "type": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.21474440", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Antidepressants increase human hippocampal neurogenesis by activating the glucocorticoid receptor.", "journal": "Molecular psychiatry", "date": "2011", "authors": "Anacker C, Zunszain PA, Cattaneo A, Carvalho LA, Garabedian MJ, Thuret S, Price J, Pariante CM", "reference": { "type": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.21483429", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FOXO4-dependent upregulation of superoxide dismutase-2 in response to oxidative stress is impaired in spinocerebellar ataxia type 3.", "journal": "Human molecular genetics", "date": "2011", "authors": "Araujo J, Breuer P, Dieringer S, Krauss S, Dorn S, Zimmermann K, Pfeifer A, Klockgether T, Wuellner U, Evert BO", "reference": { "type": "PubMed", "id": "21536589", "url": "https://pubmed.ncbi.nlm.nih.gov/21536589" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12778-1", "protein_name": "Forkhead box protein O1", "gene_name": "FOXO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01303-1", "protein_name": "Pro-neuropeptide Y", "gene_name": "NPY", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35558-1", "protein_name": "Phosphoenolpyruvate carboxykinase, cytosolic [GTP]", "gene_name": "PCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HD89-1", "protein_name": "Resistin", "gene_name": "RETN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04179-1", "protein_name": "Superoxide dismutase [Mn], mitochondrial", "gene_name": "SOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54252-2", "protein_name": "Ataxin-3", "gene_name": "ATXN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTG7-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-3, mitochondrial", "gene_name": "SIRT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01189-1", "protein_name": "Pro-opiomelanocortin", "gene_name": "POMC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04040-1", "protein_name": "Catalase", "gene_name": "CAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969Q1-1", "protein_name": "E3 ubiquitin-protein ligase TRIM63", "gene_name": "TRIM63", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36956-1", "protein_name": "Sterol regulatory element-binding protein 1", "gene_name": "SREBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96ST3-1", "protein_name": "Paired amphipathic helix protein Sin3a", "gene_name": "SIN3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35575-1", "protein_name": "Glucose-6-phosphatase catalytic subunit 1", "gene_name": "G6PC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00253-1", "protein_name": "Agouti-related protein", "gene_name": "AGRP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N139-1", "protein_name": "ATP-binding cassette sub-family A member 6", "gene_name": "ABCA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98177-1", "protein_name": "Forkhead box protein O4", "gene_name": "FOXO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969P5-1", "protein_name": "F-box only protein 32", "gene_name": "FBXO32", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MYZ6-1", "protein_name": "Forkhead box protein O6", "gene_name": "FOXO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCM2-1", "protein_name": "Plexin-A4", "gene_name": "PLXNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35557-1", "protein_name": "Hexokinase-4", "gene_name": "GCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08833-1", "protein_name": "Insulin-like growth factor-binding protein 1", "gene_name": "IGFBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21536589", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoids induce mitochondrial gene transcription in HepG2 cells: role of the mitochondrial glucocorticoid receptor.", "journal": "Biochimica et biophysica acta", "date": "2011-10", "authors": "Psarra Anna-Maria G, Sekeris Constantine E", "reference": { "type": "PubMed", "id": "21664385", "url": "https://pubmed.ncbi.nlm.nih.gov/21664385" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21664385", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel hyperactive glucocorticoid receptor isoform identified within a human population.", "journal": "Shock (Augusta, Ga.)", "date": "2011", "authors": "Tung K, Baker AC, Amini A, Green TL, Chew VW, Lim D, Nguyen ST, Yee KS, Cho K, Greenhalgh DG", "reference": { "type": "PubMed", "id": "21701417", "url": "https://pubmed.ncbi.nlm.nih.gov/21701417" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21701417", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The 90-kDa heat-shock protein (Hsp90)-binding immunophilin FKBP51 is a mitochondrial protein that translocates to the nucleus to protect cells against oxidative stress.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Gallo Luciana I, Lagadari Mariana, Piwien-Pilipuk Graciela, Galigniana Mario D", "reference": { "type": "PubMed", "id": "21730050", "url": "https://pubmed.ncbi.nlm.nih.gov/21730050" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06536-1", "protein_name": "Glucocorticoid receptor", "gene_name": "Nr3c1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21730050", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell cycle phase regulates glucocorticoid receptor function.", "journal": "PloS one", "date": "2011", "authors": "Matthews L, Johnson J, Berry A, Trebble P, Cookson A, Spiller D, Rivers C, Norman M, White M, Ray D", "reference": { "type": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.21829454", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ligand-independent phosphorylation of the glucocorticoid receptor integrates cellular stress pathways with nuclear receptor signaling.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Galliher-Beckley AJ, Williams JG, Cidlowski JA", "reference": { "type": "PubMed", "id": "21930780", "url": "https://pubmed.ncbi.nlm.nih.gov/21930780" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 134, "end_pos": 134, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "21930780", "url": "https://pubmed.ncbi.nlm.nih.gov/21930780" }, { "database": "PubMed", "id": "24291004", "url": "https://pubmed.ncbi.nlm.nih.gov/24291004" }, { "database": "PubMed", "id": "26825173", "url": "https://pubmed.ncbi.nlm.nih.gov/26825173" }, { "database": "PubMed", "id": "27717743", "url": "https://pubmed.ncbi.nlm.nih.gov/27717743" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "32357907", "url": "https://pubmed.ncbi.nlm.nih.gov/32357907" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser134", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.21930780", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peripheral CLOCK regulates target-tissue glucocorticoid receptor transcriptional activity in a circadian fashion in man.", "journal": "PloS one", "date": "2011", "authors": "Charmandari E, Chrousos GP, Lambrou GI, Pavlaki A, Koide H, Ng SS, Kino T", "reference": { "type": "PubMed", "id": "21980503", "url": "https://pubmed.ncbi.nlm.nih.gov/21980503" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15516-1", "protein_name": "Circadian locomoter output cycles protein kaput", "gene_name": "CLOCK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21980503", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cryptochromes mediate rhythmic repression of the glucocorticoid receptor.", "journal": "Nature", "date": "2011", "authors": "Lamia Katja A, Papp Stephanie J, Yu Ruth T, Barish Grant D, Uhlenhaut N Henriette, Jonker Johan W, Downes Michael, Evans Ronald M", "reference": { "type": "PubMed", "id": "22170608", "url": "https://pubmed.ncbi.nlm.nih.gov/22170608" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97784-1", "protein_name": "Cryptochrome-1", "gene_name": "Cry1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P19091-1", "protein_name": "Androgen receptor", "gene_name": "Ar", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q16526-1", "protein_name": "Cryptochrome-1", "gene_name": "CRY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06537-1", "protein_name": "Glucocorticoid receptor", "gene_name": "Nr3c1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P20393-1", "protein_name": "Nuclear receptor subfamily 1 group D member 1", "gene_name": "NR1D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9R194-1", "protein_name": "Cryptochrome-2", "gene_name": "Cry2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P51450-1", "protein_name": "Nuclear receptor ROR-gamma", "gene_name": "Rorc", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P51448-1", "protein_name": "Nuclear receptor ROR-alpha", "gene_name": "Rora", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P35398-2", "protein_name": "Nuclear receptor ROR-alpha", "gene_name": "RORA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51449-1", "protein_name": "Nuclear receptor ROR-gamma", "gene_name": "RORC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3UV55-1", "protein_name": "Nuclear receptor subfamily 1 group D member 1", "gene_name": "Nr1d1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22170608", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Defects of protein phosphatase 2A causes corticosteroid insensitivity in severe asthma.", "journal": "PloS one", "date": "2011", "authors": "Kobayashi Y, Mercado N, Barnes PJ, Ito K", "reference": { "type": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.22205926", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoids reduce inflammation in cystic fibrosis bronchial epithelial cells.", "journal": "Cellular signalling", "date": "2012", "authors": "Rebeyrol C, Saint-Criq V, Guillot L, Riffault L, Corvol H, Chadelat K, Ray DW, Clement A, Tabary O, Le Rouzic P", "reference": { "type": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.22285804", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of nuclear protein targets for six leukemogenic tyrosine kinases governed by post-translational regulation.", "journal": "PloS one", "date": "2012", "authors": "Pierce A, Williamson A, Jaworska E, Griffiths JR, Taylor S, Walker M, Aspinall-O'Dea M, Spooncer E, Unwin RD, Poolman T, Ray D, Whetton AD", "reference": { "type": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.22745689", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Restoration of corticosteroid sensitivity by p38 mitogen activated protein kinase inhibition in peripheral blood mononuclear cells from severe asthma.", "journal": "PloS one", "date": "2012", "authors": "Mercado N, Hakim A, Kobayashi Y, Meah S, Usmani OS, Chung KF, Barnes PJ, Ito K", "reference": { "type": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.22911818", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of leukocyte glucocorticoid receptor in patients with current episode of major depressive disorder.", "journal": "Progress in neuro-psychopharmacology & biological psychiatry", "date": "2013", "authors": "Simic I, Maric NP, Mitic M, Soldatovic I, Pavlovic Z, Mihaljevic M, Andric S, Radojcic MB, Adzic M", "reference": { "type": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.23123359", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The plant-derived glucocorticoid receptor agonist Endiandrin A acts as co-stimulator of colonic epithelial sodium channels (ENaC) via SGK-1 and MAPKs.", "journal": "PloS one", "date": "2012", "authors": "Kuntzsch D, Bergann T, Dames P, Fromm A, Fromm M, Davis RA, Melzig MF, Schulzke JD", "reference": { "type": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.23152905", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoid receptor signaling contributes to constitutive activation of the noncanonical NF-kappaB pathway in term human placenta.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2013", "authors": "Wang B, Palomares K, Parobchak N, Cece J, Rosen M, Nguyen A, Rosen T", "reference": { "type": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.23239753", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Selective glucocorticoid receptor translational isoforms reveal glucocorticoid-induced apoptotic transcriptomes.", "journal": "Cell death & disease", "date": "2013-01-10", "authors": "Wu I, Shin S C, Cao Y, Bender I K, Jafari N, Feng G, Lin S, Cidlowski J A, Schleimer R P, Lu N Z", "reference": { "type": "PubMed", "id": "23303127", "url": "https://pubmed.ncbi.nlm.nih.gov/23303127" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23303127", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The glucocorticoid receptor gene polymorphism N363S predisposes to more severe toxic side effects during pediatric acute lymphoblastic leukemia (ALL) therapy.", "journal": "International journal of hematology", "date": "2013", "authors": "Eipel OT, Nemeth K, Torok D, Csordas K, Hegyi M, Ponyi A, Ferenczy A, Erdelyi DJ, Csoka M, Kovacs GT", "reference": { "type": "PubMed", "id": "23355259", "url": "https://pubmed.ncbi.nlm.nih.gov/23355259" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23355259", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel point mutation in the DNA-binding domain (DBD) of the human glucocorticoid receptor causes primary generalized glucocorticoid resistance by disrupting the hydrophobic structure of its DBD.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2013", "authors": "Roberts ML, Kino T, Nicolaides NC, Hurt DE, Katsantoni E, Sertedaki A, Komianou F, Kassiou K, Chrousos GP, Charmandari E", "reference": { "type": "PubMed", "id": "23426617", "url": "https://pubmed.ncbi.nlm.nih.gov/23426617" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23426617", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pro-asthmatic cytokines regulate unliganded and ligand-dependent glucocorticoid receptor signaling in airway smooth muscle.", "journal": "PloS one", "date": "2013", "authors": "Hu A, Josephson MB, Diener BL, Nino G, Xu S, Paranjape C, Orange JS, Grunstein MM", "reference": { "type": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.23593222", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role for the kinase SGK1 in stress, depression, and glucocorticoid effects on hippocampal neurogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Anacker C, Cattaneo A, Musaelyan K, Zunszain PA, Horowitz M, Molteni R, Luoni A, Calabrese F, Tansey K, Gennarelli M, Thuret S, Price J, Uher R, Riva MA, Pariante CM", "reference": { "type": "PubMed", "id": "23650397", "url": "https://pubmed.ncbi.nlm.nih.gov/23650397" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "O00141-1", "kinase_gene_name": "SGK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "23650397", "url": "https://pubmed.ncbi.nlm.nih.gov/23650397" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "O00141-1", "kinase_gene_name": "SGK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "23650397", "url": "https://pubmed.ncbi.nlm.nih.gov/23650397" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.23650397", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evaluation of glucocorticoid receptor function in COPD lung macrophages using beclomethasone-17-monopropionate.", "journal": "PloS one", "date": "2013", "authors": "Plumb J, Robinson L, Lea S, Banyard A, Blaikley J, Ray D, Bizzi A, Volpi G, Facchinetti F, Singh D", "reference": { "type": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.23704983", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Determinants of the heightened activity of glucocorticoid receptor translational isoforms.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2013", "authors": "Bender IK, Cao Y, Lu NZ", "reference": { "type": "PubMed", "id": "23820903", "url": "https://pubmed.ncbi.nlm.nih.gov/23820903" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 101, "end_pos": 101, "sequence_org": "D", "sequence_mut": "A", "comment": "Reduces transcription activation activity of isoform Alpha-C3 by half.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "23820903", "url": "https://pubmed.ncbi.nlm.nih.gov/23820903" } ], "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 101, "end_pos": 101, "sequence_org": "D", "sequence_mut": "K", "comment": "Reduces transcription activation activity of isoform Alpha-C3 by half. Suppresses apoptosis-inducing activity of isoform Alpha-C3. Impairs recruitment of selected coregulators onto DNA binding sites.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "23820903", "url": "https://pubmed.ncbi.nlm.nih.gov/23820903" } ], "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 106, "end_pos": 107, "sequence_org": "QQ", "sequence_mut": "LL", "comment": "Reduces activity of isoform Alpha-C3 by half.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "23820903", "url": "https://pubmed.ncbi.nlm.nih.gov/23820903" } ], "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 113, "end_pos": 114, "sequence_org": "SS", "sequence_mut": "AA", "comment": "Does not affect the activity of isoform Alpha-C3.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "23820903", "url": "https://pubmed.ncbi.nlm.nih.gov/23820903" } ], "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.23820903", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FoxO regulates expression of ABCA6, an intracellular ATP-binding-cassette transporter responsive to cholesterol.", "journal": "The international journal of biochemistry & cell biology", "date": "2013", "authors": "Gai J, Ji M, Shi C, Li W, Chen S, Wang Y, Li H", "reference": { "type": "PubMed", "id": "24028821", "url": "https://pubmed.ncbi.nlm.nih.gov/24028821" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12778-1", "protein_name": "Forkhead box protein O1", "gene_name": "FOXO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01303-1", "protein_name": "Pro-neuropeptide Y", "gene_name": "NPY", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35558-1", "protein_name": "Phosphoenolpyruvate carboxykinase, cytosolic [GTP]", "gene_name": "PCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HD89-1", "protein_name": "Resistin", "gene_name": "RETN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04179-1", "protein_name": "Superoxide dismutase [Mn], mitochondrial", "gene_name": "SOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54252-2", "protein_name": "Ataxin-3", "gene_name": "ATXN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTG7-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-3, mitochondrial", "gene_name": "SIRT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01189-1", "protein_name": "Pro-opiomelanocortin", "gene_name": "POMC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04040-1", "protein_name": "Catalase", "gene_name": "CAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969Q1-1", "protein_name": "E3 ubiquitin-protein ligase TRIM63", "gene_name": "TRIM63", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36956-1", "protein_name": "Sterol regulatory element-binding protein 1", "gene_name": "SREBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96ST3-1", "protein_name": "Paired amphipathic helix protein Sin3a", "gene_name": "SIN3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35575-1", "protein_name": "Glucose-6-phosphatase catalytic subunit 1", "gene_name": "G6PC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00253-1", "protein_name": "Agouti-related protein", "gene_name": "AGRP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N139-1", "protein_name": "ATP-binding cassette sub-family A member 6", "gene_name": "ABCA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98177-1", "protein_name": "Forkhead box protein O4", "gene_name": "FOXO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969P5-1", "protein_name": "F-box only protein 32", "gene_name": "FBXO32", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MYZ6-1", "protein_name": "Forkhead box protein O6", "gene_name": "FOXO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCM2-1", "protein_name": "Plexin-A4", "gene_name": "PLXNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35557-1", "protein_name": "Hexokinase-4", "gene_name": "GCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08833-1", "protein_name": "Insulin-like growth factor-binding protein 1", "gene_name": "IGFBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24028821", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MicroRNA-100/99a, deregulated in acute lymphoblastic leukaemia, suppress proliferation and promote apoptosis by regulating the FKBP51 and IGF1R/mTOR signalling pathways.", "journal": "British journal of cancer", "date": "2013", "authors": "Li XJ, Luo XQ, Han BW, Duan FT, Wei PP, Chen YQ", "reference": { "type": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.24030073", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of FOXOs and p53 by SIRT1 modulators under oxidative stress.", "journal": "PloS one", "date": "2013", "authors": "Hori YS, Kuno A, Hosoda R, Horio Y", "reference": { "type": "PubMed", "id": "24040102", "url": "https://pubmed.ncbi.nlm.nih.gov/24040102" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12778-1", "protein_name": "Forkhead box protein O1", "gene_name": "FOXO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01303-1", "protein_name": "Pro-neuropeptide Y", "gene_name": "NPY", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35558-1", "protein_name": "Phosphoenolpyruvate carboxykinase, cytosolic [GTP]", "gene_name": "PCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HD89-1", "protein_name": "Resistin", "gene_name": "RETN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04179-1", "protein_name": "Superoxide dismutase [Mn], mitochondrial", "gene_name": "SOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54252-2", "protein_name": "Ataxin-3", "gene_name": "ATXN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTG7-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-3, mitochondrial", "gene_name": "SIRT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01189-1", "protein_name": "Pro-opiomelanocortin", "gene_name": "POMC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04040-1", "protein_name": "Catalase", "gene_name": "CAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969Q1-1", "protein_name": "E3 ubiquitin-protein ligase TRIM63", "gene_name": "TRIM63", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36956-1", "protein_name": "Sterol regulatory element-binding protein 1", "gene_name": "SREBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96ST3-1", "protein_name": "Paired amphipathic helix protein Sin3a", "gene_name": "SIN3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35575-1", "protein_name": "Glucose-6-phosphatase catalytic subunit 1", "gene_name": "G6PC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00253-1", "protein_name": "Agouti-related protein", "gene_name": "AGRP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N139-1", "protein_name": "ATP-binding cassette sub-family A member 6", "gene_name": "ABCA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98177-1", "protein_name": "Forkhead box protein O4", "gene_name": "FOXO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969P5-1", "protein_name": "F-box only protein 32", "gene_name": "FBXO32", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MYZ6-1", "protein_name": "Forkhead box protein O6", "gene_name": "FOXO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCM2-1", "protein_name": "Plexin-A4", "gene_name": "PLXNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35557-1", "protein_name": "Hexokinase-4", "gene_name": "GCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08833-1", "protein_name": "Insulin-like growth factor-binding protein 1", "gene_name": "IGFBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24040102", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Loss of glucocorticoid receptor activation is a hallmark of BRCA1-mutated breast tissue.", "journal": "Breast cancer research and treatment", "date": "2013", "authors": "Vilasco M, Communal L, Hugon-Rodin J, Penault-Llorca F, Mourra N, Wu Z, Forgez P, Gompel A", "reference": { "type": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.24166279", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct reversal of glucocorticoid resistance by AKT inhibition in acute lymphoblastic leukemia.", "journal": "Cancer cell", "date": "2013", "authors": "Piovan E, Yu J, Tosello V, Herranz D, Ambesi-Impiombato A, Da Silva AC, Sanchez-Martin M, Perez-Garcia A, Rigo I, Castillo M, Indraccolo S, Cross JR, de Stanchina E, Paietta E, Racevskis J, Rowe JM, Tallman MS, Basso G, Meijerink JP, Cordon-Cardo C, Califano A, Ferrando AA", "reference": { "type": "PubMed", "id": "24291004", "url": "https://pubmed.ncbi.nlm.nih.gov/24291004" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 134, "end_pos": 134, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "24291004", "url": "https://pubmed.ncbi.nlm.nih.gov/24291004" } ], "site_lbl": "Ser134", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 134, "end_pos": 134, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "21930780", "url": "https://pubmed.ncbi.nlm.nih.gov/21930780" }, { "database": "PubMed", "id": "24291004", "url": "https://pubmed.ncbi.nlm.nih.gov/24291004" }, { "database": "PubMed", "id": "26825173", "url": "https://pubmed.ncbi.nlm.nih.gov/26825173" }, { "database": "PubMed", "id": "27717743", "url": "https://pubmed.ncbi.nlm.nih.gov/27717743" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "32357907", "url": "https://pubmed.ncbi.nlm.nih.gov/32357907" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser134", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.24291004", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel point mutation of the human glucocorticoid receptor gene causes primary generalized glucocorticoid resistance through impaired interaction with the LXXLL motif of the p160 coactivators: dissociation of the transactivating and transreppressive activities.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2014", "authors": "Nicolaides NC, Roberts ML, Kino T, Braatvedt G, Hurt DE, Katsantoni E, Sertedaki A, Chrousos GP, Charmandari E", "reference": { "type": "PubMed", "id": "24483153", "url": "https://pubmed.ncbi.nlm.nih.gov/24483153" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24483153", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hypothalamic-pituitary-adrenal axis activity, personality traits, and BCL1 and N363S polymorphisms of the glucocorticoid receptor gene in metabolically obese normal-weight women.", "journal": "Endocrine", "date": "2014", "authors": "Porzezinska-Furtak J, Krzyzanowska-Swiniarska B, Miazgowski T, Safranow K, Kaminski R", "reference": { "type": "PubMed", "id": "24535466", "url": "https://pubmed.ncbi.nlm.nih.gov/24535466" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24535466", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epigenetic alteration by DNA-demethylating treatment restores apoptotic response to glucocorticoids in dexamethasone-resistant human malignant lymphoid cells.", "journal": "Cancer cell international", "date": "2014", "authors": "Miller AL, Geng C, Golovko G, Sharma M, Schwartz JR, Yan J, Sowers L, Widger WR, Fofanov Y, Vedeckis WV, Thompson EB", "reference": { "type": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.24795534", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Accumulation of cytoplasmic glucocorticoid receptor is related to elevation of FKBP5 in lymphocytes of depressed patients.", "journal": "Journal of molecular neuroscience : MN", "date": "2015", "authors": "Lukic I, Mitic M, Soldatovic I, Jovicic M, Maric N, Radulovic J, Adzic M", "reference": { "type": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.25355489", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of glucocorticoid receptor tau1c transactivation domain enhances binding to CREB binding protein (CBP) TAZ2.", "journal": "Biochemical and biophysical research communications", "date": "2015", "authors": "Carruthers CW, Suh JH, Gustafsson JA, Webb P", "reference": { "type": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.25511704", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reversal of corticosteroid insensitivity by p38 MAPK inhibition in peripheral blood mononuclear cells from COPD.", "journal": "International journal of chronic obstructive pulmonary disease", "date": "2015", "authors": "Khorasani N, Baker J, Johnson M, Chung KF, Bhavsar PK", "reference": { "type": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.25678784", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoid receptor interacts with PNRC2 in a ligand-dependent manner to recruit UPF1 for rapid mRNA degradation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015", "authors": "Cho H, Park OH, Park J, Ryu I, Kim J, Ko J, Kim YK", "reference": { "type": "PubMed", "id": "25775514", "url": "https://pubmed.ncbi.nlm.nih.gov/25775514" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPJ4-1", "protein_name": "Proline-rich nuclear receptor coactivator 2", "gene_name": "PNRC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 101, "end_pos": 101, "sequence_org": "P", "sequence_mut": "A", "comment": "Abolishes the interaction with the nuclear receptors but not decapping enzyme; when associated with A-104.", "evidence": [ { "database": "UniProtKB", "id": "Q9NPJ4", "url": "https://www.uniprot.org/uniprotkb/Q9NPJ4" }, { "database": "PubMed", "id": "25775514", "url": "https://pubmed.ncbi.nlm.nih.gov/25775514" }, { "database": "PubMed", "id": "11574675", "url": "https://pubmed.ncbi.nlm.nih.gov/11574675" } ], "uniprot_canonical_ac": "Q9NPJ4-1" }, { "start_pos": 104, "end_pos": 104, "sequence_org": "P", "sequence_mut": "A", "comment": "Abolishes the interaction with the nuclear receptors but not decapping enzyme; when associated with A-101.", "evidence": [ { "database": "UniProtKB", "id": "Q9NPJ4", "url": "https://www.uniprot.org/uniprotkb/Q9NPJ4" }, { "database": "PubMed", "id": "11574675", "url": "https://pubmed.ncbi.nlm.nih.gov/11574675" }, { "database": "PubMed", "id": "25775514", "url": "https://pubmed.ncbi.nlm.nih.gov/25775514" } ], "uniprot_canonical_ac": "Q9NPJ4-1" }, { "start_pos": 108, "end_pos": 108, "sequence_org": "P", "sequence_mut": "A", "comment": "Abolishes the interaction with DCP1A.", "evidence": [ { "database": "UniProtKB", "id": "Q9NPJ4", "url": "https://www.uniprot.org/uniprotkb/Q9NPJ4" }, { "database": "PubMed", "id": "25775514", "url": "https://pubmed.ncbi.nlm.nih.gov/25775514" } ], "uniprot_canonical_ac": "Q9NPJ4-1" }, { "start_pos": 114, "end_pos": 114, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes the interaction with DCP1A.", "evidence": [ { "database": "UniProtKB", "id": "Q9NPJ4", "url": "https://www.uniprot.org/uniprotkb/Q9NPJ4" }, { "database": "PubMed", "id": "25775514", "url": "https://pubmed.ncbi.nlm.nih.gov/25775514" } ], "uniprot_canonical_ac": "Q9NPJ4-1" } ], "record_id": "pubmed.25775514", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoid receptor regulates accurate chromosome segregation and is associated with malignancy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015", "authors": "Matthews LC, Berry AA, Morgan DJ, Poolman TM, Bauer K, Kramer F, Spiller DG, Richardson RV, Chapman KE, Farrow SN, Norman MR, Williamson AJ, Whetton AD, Taylor SS, Tuckermann JP, White MR, Ray DW", "reference": { "type": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06537-1", "protein_name": "Glucocorticoid receptor", "gene_name": "Nr3c1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.25847991", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel mutation of the hGR gene causing Chrousos syndrome.", "journal": "European journal of clinical investigation", "date": "2015", "authors": "Nicolaides NC, Geer EB, Vlachakis D, Roberts ML, Psarra AM, Moutsatsou P, Sertedaki A, Kossida S, Charmandari E", "reference": { "type": "PubMed", "id": "26031419", "url": "https://pubmed.ncbi.nlm.nih.gov/26031419" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26031419", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Modulation of c-Jun N-terminal kinase signaling and specific glucocorticoid receptor phosphorylation in the treatment of major depression.", "journal": "Medical hypotheses", "date": "2015", "authors": "Jovicic MJ, Lukic I, Radojcic M, Adzic M, Maric NP", "reference": { "type": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.26052031", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional characterization of the hGRalphaT556I causing Chrousos syndrome.", "journal": "European journal of clinical investigation", "date": "2016", "authors": "Nicolaides NC, Skyrla E, Vlachakis D, Psarra AM, Moutsatsou P, Sertedaki A, Kossida S, Charmandari E", "reference": { "type": "PubMed", "id": "26541474", "url": "https://pubmed.ncbi.nlm.nih.gov/26541474" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26541474", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human Glucocorticoid Receptor \u03b2 Regulates Gluconeogenesis and Inflammation in Mouse Liver.", "journal": "Molecular and cellular biology", "date": "2015-12-28", "authors": "He Bo, Cruz-Topete Diana, Oakley Robert H, Xiao Xiao, Cidlowski John A", "reference": { "type": "PubMed", "id": "26711253", "url": "https://pubmed.ncbi.nlm.nih.gov/26711253" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26711253", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAY 11-7085 induces glucocorticoid receptor activation and autophagy that collaborate with apoptosis to induce human synovial fibroblast cell death.", "journal": "Oncotarget", "date": "2016", "authors": "Relic B, Charlier E, Deroyer C, Malaise O, Neuville S, Desoroux A, Gillet P, de Seny D, Malaise MG", "reference": { "type": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.26993765", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three Novel Heterozygous Point Mutations of NR3C1 Causing Glucocorticoid Resistance.", "journal": "Human mutation", "date": "2016", "authors": "Vitellius G, Fagart J, Delemer B, Amazit L, Ramos N, Bouligand J, Le Billan F, Castinetti F, Guiochon-Mantel A, Trabado S, Lombes M", "reference": { "type": "PubMed", "id": "27120390", "url": "https://pubmed.ncbi.nlm.nih.gov/27120390" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27120390", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Vitamin D interferes with glucocorticoid responsiveness in human peripheral blood mononuclear target cells.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2016", "authors": "Kassi E, Nasiri-Ansari N, Spilioti E, Kalotychou V, Apostolou PE, Moutsatsou P, Papavassiliou AG", "reference": { "type": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.27220430", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CD38 Deficiency Protects the Heart from Ischemia/Reperfusion Injury through Activating SIRT1/FOXOs-Mediated Antioxidative Stress Pathway.", "journal": "Oxidative medicine and cellular longevity", "date": "2016", "authors": "Guan XH, Liu XH, Hong X, Zhao N, Xiao YF, Wang LF, Tang L, Jiang K, Qian YS, Deng KY, Ji G, Fu M, Xin HB", "reference": { "type": "PubMed", "id": "27547294", "url": "https://pubmed.ncbi.nlm.nih.gov/27547294" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12778-1", "protein_name": "Forkhead box protein O1", "gene_name": "FOXO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01303-1", "protein_name": "Pro-neuropeptide Y", "gene_name": "NPY", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35558-1", "protein_name": "Phosphoenolpyruvate carboxykinase, cytosolic [GTP]", "gene_name": "PCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HD89-1", "protein_name": "Resistin", "gene_name": "RETN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04179-1", "protein_name": "Superoxide dismutase [Mn], mitochondrial", "gene_name": "SOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54252-2", "protein_name": "Ataxin-3", "gene_name": "ATXN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTG7-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-3, mitochondrial", "gene_name": "SIRT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01189-1", "protein_name": "Pro-opiomelanocortin", "gene_name": "POMC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04040-1", "protein_name": "Catalase", "gene_name": "CAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969Q1-1", "protein_name": "E3 ubiquitin-protein ligase TRIM63", "gene_name": "TRIM63", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36956-1", "protein_name": "Sterol regulatory element-binding protein 1", "gene_name": "SREBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96ST3-1", "protein_name": "Paired amphipathic helix protein Sin3a", "gene_name": "SIN3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35575-1", "protein_name": "Glucose-6-phosphatase catalytic subunit 1", "gene_name": "G6PC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00253-1", "protein_name": "Agouti-related protein", "gene_name": "AGRP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N139-1", "protein_name": "ATP-binding cassette sub-family A member 6", "gene_name": "ABCA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98177-1", "protein_name": "Forkhead box protein O4", "gene_name": "FOXO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969P5-1", "protein_name": "F-box only protein 32", "gene_name": "FBXO32", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MYZ6-1", "protein_name": "Forkhead box protein O6", "gene_name": "FOXO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCM2-1", "protein_name": "Plexin-A4", "gene_name": "PLXNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35557-1", "protein_name": "Hexokinase-4", "gene_name": "GCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08833-1", "protein_name": "Insulin-like growth factor-binding protein 1", "gene_name": "IGFBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27547294", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Janus and PI3-kinases mediate glucocorticoid resistance in activated chronic leukemia cells.", "journal": "Oncotarget", "date": "2016", "authors": "Oppermann S, Lam AJ, Tung S, Shi Y, McCaw L, Wang G, Ylanko J, Leber B, Andrews D, Spaner DE", "reference": { "type": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.27579615", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AKT1 has dual actions on the glucocorticoid receptor by cooperating with 14-3-3.", "journal": "Molecular and cellular endocrinology", "date": "2017", "authors": "Habib T, Sadoun A, Nader N, Suzuki S, Liu W, Jithesh PV, Kino T", "reference": { "type": "PubMed", "id": "27717743", "url": "https://pubmed.ncbi.nlm.nih.gov/27717743" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 134, "end_pos": 134, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "21930780", "url": "https://pubmed.ncbi.nlm.nih.gov/21930780" }, { "database": "PubMed", "id": "24291004", "url": "https://pubmed.ncbi.nlm.nih.gov/24291004" }, { "database": "PubMed", "id": "26825173", "url": "https://pubmed.ncbi.nlm.nih.gov/26825173" }, { "database": "PubMed", "id": "27717743", "url": "https://pubmed.ncbi.nlm.nih.gov/27717743" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "32357907", "url": "https://pubmed.ncbi.nlm.nih.gov/32357907" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser134", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.27717743", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide Regulatory Roles of the C2H2-type Zinc Finger Protein ZNF764 on the Glucocorticoid Receptor.", "journal": "Scientific reports", "date": "2017-01-31", "authors": "Fadda Abeer, Syed Najeeb, Mackeh Rafah, Papadopoulou Anna, Suzuki Shigeru, Jithesh Puthen V, Kino Tomoshige", "reference": { "type": "PubMed", "id": "28139699", "url": "https://pubmed.ncbi.nlm.nih.gov/28139699" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H86-1", "protein_name": "Zinc finger protein 764", "gene_name": "ZNF764", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28139699", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association Between N363S and BclI Polymorphisms of the Glucocorticoid Receptor Gene (NR3C1) and Glucocorticoid Side Effects During Childhood Acute Lymphoblastic Leukemia Treatment.", "journal": "Turkish journal of haematology : official journal of Turkish Society of Haematology", "date": "2017", "authors": "Kaymak Cihan M, Karabulut HG, Yurur Kutlay N, Ilgin Ruhi H, Tukun A, Olcay L", "reference": { "type": "PubMed", "id": "28179212", "url": "https://pubmed.ncbi.nlm.nih.gov/28179212" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28179212", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential regulation of cell death pathways by the microenvironment correlates with chemoresistance and survival in leukaemia.", "journal": "PloS one", "date": "2017", "authors": "Qattan MY, Bakker EY, Rajendran R, Chen DW, Saha V, Liu J, Zeef L, Schwartz JM, Mutti L, Demonacos C, Krstic-Demonacos M", "reference": { "type": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.28582465", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Primary structure and expression of a functional human glucocorticoid receptor cDNA.", "journal": "Nature", "date": "1985", "authors": "Hollenberg S M, Weinberger C, Ong E S, Cerelli G, Oro A, Lebo R, Thompson E B, Rosenfeld M G, Evans R M", "reference": { "type": "PubMed", "id": "2867473", "url": "https://pubmed.ncbi.nlm.nih.gov/2867473" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2867473", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoid therapy regulates podocyte motility by inhibition of Rac1.", "journal": "Scientific reports", "date": "2017", "authors": "McCaffrey JC, Webb NJ, Poolman TM, Fresquet M, Moxey C, Zeef LAH, Donaldson IJ, Ray DW, Lennon R", "reference": { "type": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.28751734", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Compound A influences gene regulation of the Dexamethasone-activated glucocorticoid receptor by alternative cofactor recruitment.", "journal": "Scientific reports", "date": "2017", "authors": "Desmet SJ, Bougarne N, Van Moortel L, De Cauwer L, Thommis J, Vuylsteke M, Ratman D, Houtman R, Tavernier J, De Bosscher K", "reference": { "type": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.28808239", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoid Receptor-mediated transactivation is hampered by Striatin-3, a novel interaction partner of the receptor.", "journal": "Scientific reports", "date": "2017", "authors": "Petta I, Bougarne N, Vandewalle J, Dejager L, Vandevyver S, Ballegeer M, Desmet S, Thommis J, De Cauwer L, Lievens S, Libert C, Tavernier J, De Bosscher K", "reference": { "type": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.28827617", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Site-specific phosphorylation regulates the structure and function of an intrinsically disordered domain of the glucocorticoid receptor.", "journal": "Scientific reports", "date": "2017", "authors": "Khan SH, McLaughlin WA, Kumar R", "reference": { "type": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.29133811", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Selective Glucocorticoid Receptor Properties of GSK866 Analogs with Cysteine Reactive Warheads.", "journal": "Frontiers in immunology", "date": "2017", "authors": "Chirumamilla CS, Palagani A, Kamaraj B, Declerck K, Verbeek MWC, Oksana R, De Bosscher K, Bougarne N, Ruttens B, Gevaert K, Houtman R, De Vos WH, Joossens J, Van Der Veken P, Augustyns K, Van Ostade X, Bogaerts A, De Winter H, Vanden Berghe W", "reference": { "type": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.29163463", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Selinexor synergizes with dexamethasone to repress mTORC1 signaling and induce multiple myeloma cell death.", "journal": "Oncotarget", "date": "2018", "authors": "Argueta C, Kashyap T, Klebanov B, Unger TJ, Guo C, Harrington S, Baloglu E, Lee M, Senapedis W, Shacham S, Landesman Y", "reference": { "type": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42345-1", "protein_name": "Serine/threonine-protein kinase mTOR", "gene_name": "MTOR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 2448, "end_pos": 2448, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by RPS6KB1", "evidence": [ { "database": "UniProtKB", "id": "P42345", "url": "https://www.uniprot.org/uniprotkb/P42345" }, { "database": "iPTMnet", "id": "P42345", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42345" }, { "database": "PubMed", "id": "10910062", "url": "https://pubmed.ncbi.nlm.nih.gov/10910062" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "10567225", "url": "https://pubmed.ncbi.nlm.nih.gov/10567225" }, { "database": "PubMed", "id": "11884412", "url": "https://pubmed.ncbi.nlm.nih.gov/11884412" }, { "database": "PubMed", "id": "12937293", "url": "https://pubmed.ncbi.nlm.nih.gov/12937293" }, { "database": "PubMed", "id": "14560963", "url": "https://pubmed.ncbi.nlm.nih.gov/14560963" }, { "database": "PubMed", "id": "14970221", "url": "https://pubmed.ncbi.nlm.nih.gov/14970221" }, { "database": "PubMed", "id": "15208671", "url": "https://pubmed.ncbi.nlm.nih.gov/15208671" }, { "database": "PubMed", "id": "15292249", "url": "https://pubmed.ncbi.nlm.nih.gov/15292249" }, { "database": "PubMed", "id": "15388509", "url": "https://pubmed.ncbi.nlm.nih.gov/15388509" }, { "database": "PubMed", "id": "15388791", "url": "https://pubmed.ncbi.nlm.nih.gov/15388791" }, { "database": "PubMed", "id": "15625077", "url": "https://pubmed.ncbi.nlm.nih.gov/15625077" }, { "database": "PubMed", "id": "15899889", "url": "https://pubmed.ncbi.nlm.nih.gov/15899889" }, { "database": "PubMed", "id": "15905173", "url": "https://pubmed.ncbi.nlm.nih.gov/15905173" }, { "database": "PubMed", "id": "15963500", "url": "https://pubmed.ncbi.nlm.nih.gov/15963500" }, { "database": "PubMed", "id": "16263769", "url": "https://pubmed.ncbi.nlm.nih.gov/16263769" }, { "database": "PubMed", "id": "16288304", "url": "https://pubmed.ncbi.nlm.nih.gov/16288304" }, { "database": "PubMed", "id": "16584539", "url": "https://pubmed.ncbi.nlm.nih.gov/16584539" }, { "database": "PubMed", "id": "16886599", "url": "https://pubmed.ncbi.nlm.nih.gov/16886599" }, { "database": "PubMed", "id": "16920842", "url": "https://pubmed.ncbi.nlm.nih.gov/16920842" }, { "database": "PubMed", "id": "16934436", "url": "https://pubmed.ncbi.nlm.nih.gov/16934436" }, { "database": "PubMed", "id": "16952420", "url": "https://pubmed.ncbi.nlm.nih.gov/16952420" }, { "database": "PubMed", "id": "17110594", "url": "https://pubmed.ncbi.nlm.nih.gov/17110594" }, { "database": "PubMed", "id": "17142137", "url": "https://pubmed.ncbi.nlm.nih.gov/17142137" }, { "database": "PubMed", "id": "17162089", "url": "https://pubmed.ncbi.nlm.nih.gov/17162089" }, { "database": "PubMed", "id": "17178807", "url": "https://pubmed.ncbi.nlm.nih.gov/17178807" }, { "database": "PubMed", "id": "17646396", "url": "https://pubmed.ncbi.nlm.nih.gov/17646396" }, { "database": "PubMed", "id": "17721885", "url": "https://pubmed.ncbi.nlm.nih.gov/17721885" }, { "database": "PubMed", "id": "17971512", "url": "https://pubmed.ncbi.nlm.nih.gov/17971512" }, { "database": "PubMed", "id": "17976640", "url": "https://pubmed.ncbi.nlm.nih.gov/17976640" }, { "database": "PubMed", "id": "18033679", "url": "https://pubmed.ncbi.nlm.nih.gov/18033679" }, { "database": "PubMed", "id": "18276949", "url": "https://pubmed.ncbi.nlm.nih.gov/18276949" }, { "database": "PubMed", "id": "18466352", "url": "https://pubmed.ncbi.nlm.nih.gov/18466352" }, { "database": "PubMed", "id": "18577697", "url": "https://pubmed.ncbi.nlm.nih.gov/18577697" }, { "database": "PubMed", "id": "18668345", "url": "https://pubmed.ncbi.nlm.nih.gov/18668345" }, { "database": "PubMed", "id": "19019920", "url": "https://pubmed.ncbi.nlm.nih.gov/19019920" }, { "database": "PubMed", "id": "19055754", "url": "https://pubmed.ncbi.nlm.nih.gov/19055754" }, { "database": "PubMed", "id": "19079619", "url": "https://pubmed.ncbi.nlm.nih.gov/19079619" }, { "database": "PubMed", "id": "19125612", "url": "https://pubmed.ncbi.nlm.nih.gov/19125612" }, { "database": "PubMed", "id": "19145465", "url": "https://pubmed.ncbi.nlm.nih.gov/19145465" }, { "database": "PubMed", "id": "19153210", "url": "https://pubmed.ncbi.nlm.nih.gov/19153210" }, { "database": "PubMed", "id": "19244117", "url": "https://pubmed.ncbi.nlm.nih.gov/19244117" }, { "database": "PubMed", "id": "19293927", "url": "https://pubmed.ncbi.nlm.nih.gov/19293927" }, { "database": "PubMed", "id": "19439614", "url": "https://pubmed.ncbi.nlm.nih.gov/19439614" }, { "database": "PubMed", "id": "19540199", "url": "https://pubmed.ncbi.nlm.nih.gov/19540199" }, { "database": "PubMed", "id": "19549760", "url": "https://pubmed.ncbi.nlm.nih.gov/19549760" }, { "database": "PubMed", "id": "19576515", "url": "https://pubmed.ncbi.nlm.nih.gov/19576515" }, { "database": "PubMed", "id": "19587783", "url": "https://pubmed.ncbi.nlm.nih.gov/19587783" }, { "database": "PubMed", "id": "19641606", "url": "https://pubmed.ncbi.nlm.nih.gov/19641606" }, { "database": "PubMed", "id": "19644030", "url": "https://pubmed.ncbi.nlm.nih.gov/19644030" }, { "database": "PubMed", "id": "19834494", "url": "https://pubmed.ncbi.nlm.nih.gov/19834494" }, { "database": "PubMed", "id": "19943972", "url": "https://pubmed.ncbi.nlm.nih.gov/19943972" }, { "database": "PubMed", "id": "19956876", "url": "https://pubmed.ncbi.nlm.nih.gov/19956876" }, { "database": "PubMed", "id": "19959541", "url": "https://pubmed.ncbi.nlm.nih.gov/19959541" }, { "database": "PubMed", "id": "20144629", "url": "https://pubmed.ncbi.nlm.nih.gov/20144629" }, { "database": "PubMed", "id": "20152809", "url": "https://pubmed.ncbi.nlm.nih.gov/20152809" }, { "database": "PubMed", "id": "20216949", "url": "https://pubmed.ncbi.nlm.nih.gov/20216949" }, { "database": "PubMed", "id": "20459645", "url": "https://pubmed.ncbi.nlm.nih.gov/20459645" }, { "database": "PubMed", "id": "20484036", "url": "https://pubmed.ncbi.nlm.nih.gov/20484036" }, { "database": "PubMed", "id": "20736160", "url": "https://pubmed.ncbi.nlm.nih.gov/20736160" }, { "database": "PubMed", "id": "21132000", "url": "https://pubmed.ncbi.nlm.nih.gov/21132000" }, { "database": "PubMed", "id": "21208419", "url": "https://pubmed.ncbi.nlm.nih.gov/21208419" }, { "database": "PubMed", "id": "21289204", "url": "https://pubmed.ncbi.nlm.nih.gov/21289204" }, { "database": "PubMed", "id": "21430254", "url": "https://pubmed.ncbi.nlm.nih.gov/21430254" }, { "database": "PubMed", "id": "21501117", "url": "https://pubmed.ncbi.nlm.nih.gov/21501117" }, { "database": "PubMed", "id": "21702994", "url": "https://pubmed.ncbi.nlm.nih.gov/21702994" }, { "database": "PubMed", "id": "21763421", "url": "https://pubmed.ncbi.nlm.nih.gov/21763421" }, { "database": "PubMed", "id": "21798089", "url": "https://pubmed.ncbi.nlm.nih.gov/21798089" }, { "database": "PubMed", "id": "21840189", "url": "https://pubmed.ncbi.nlm.nih.gov/21840189" }, { "database": "PubMed", "id": "21937645", "url": "https://pubmed.ncbi.nlm.nih.gov/21937645" }, { "database": "PubMed", "id": "22028912", "url": "https://pubmed.ncbi.nlm.nih.gov/22028912" }, { "database": "PubMed", "id": "22039466", "url": "https://pubmed.ncbi.nlm.nih.gov/22039466" }, { "database": "PubMed", "id": "22230498", "url": "https://pubmed.ncbi.nlm.nih.gov/22230498" }, { "database": "PubMed", "id": "22253983", "url": "https://pubmed.ncbi.nlm.nih.gov/22253983" }, { "database": "PubMed", "id": "22347457", "url": "https://pubmed.ncbi.nlm.nih.gov/22347457" }, { "database": "PubMed", "id": "22357971", "url": "https://pubmed.ncbi.nlm.nih.gov/22357971" }, { "database": "PubMed", "id": "22383503", "url": "https://pubmed.ncbi.nlm.nih.gov/22383503" }, { "database": "PubMed", "id": "22421143", "url": "https://pubmed.ncbi.nlm.nih.gov/22421143" }, { "database": "PubMed", "id": "22422828", "url": "https://pubmed.ncbi.nlm.nih.gov/22422828" }, { "database": "PubMed", "id": "22452803", "url": "https://pubmed.ncbi.nlm.nih.gov/22452803" }, { "database": "PubMed", "id": "22460505", "url": "https://pubmed.ncbi.nlm.nih.gov/22460505" }, { "database": "PubMed", "id": "22567115", "url": "https://pubmed.ncbi.nlm.nih.gov/22567115" }, { "database": "PubMed", "id": "22817638", "url": "https://pubmed.ncbi.nlm.nih.gov/22817638" }, { "database": "PubMed", "id": "22886792", "url": "https://pubmed.ncbi.nlm.nih.gov/22886792" }, { "database": "PubMed", "id": "22969779", "url": "https://pubmed.ncbi.nlm.nih.gov/22969779" }, { "database": "PubMed", "id": "23027611", "url": "https://pubmed.ncbi.nlm.nih.gov/23027611" }, { "database": "PubMed", "id": "23094058", "url": "https://pubmed.ncbi.nlm.nih.gov/23094058" }, { "database": "PubMed", "id": "23095638", "url": "https://pubmed.ncbi.nlm.nih.gov/23095638" }, { "database": "PubMed", "id": "23185989", "url": "https://pubmed.ncbi.nlm.nih.gov/23185989" }, { "database": "PubMed", "id": "23272152", "url": "https://pubmed.ncbi.nlm.nih.gov/23272152" }, { "database": "PubMed", "id": "23348097", "url": "https://pubmed.ncbi.nlm.nih.gov/23348097" }, { "database": "PubMed", "id": "23349989", "url": "https://pubmed.ncbi.nlm.nih.gov/23349989" }, { "database": "PubMed", "id": "23383195", "url": "https://pubmed.ncbi.nlm.nih.gov/23383195" }, { "database": "PubMed", "id": "23415012", "url": "https://pubmed.ncbi.nlm.nih.gov/23415012" }, { "database": "PubMed", "id": "23471000", "url": "https://pubmed.ncbi.nlm.nih.gov/23471000" }, { "database": "PubMed", "id": "23537100", "url": "https://pubmed.ncbi.nlm.nih.gov/23537100" }, { "database": "PubMed", "id": "23557706", "url": "https://pubmed.ncbi.nlm.nih.gov/23557706" }, { "database": "PubMed", "id": "23563240", "url": "https://pubmed.ncbi.nlm.nih.gov/23563240" }, { "database": "PubMed", "id": "23569215", "url": "https://pubmed.ncbi.nlm.nih.gov/23569215" }, { "database": "PubMed", "id": "23632629", "url": "https://pubmed.ncbi.nlm.nih.gov/23632629" }, { "database": "PubMed", "id": "23691056", "url": "https://pubmed.ncbi.nlm.nih.gov/23691056" }, { "database": "PubMed", "id": "23724051", "url": "https://pubmed.ncbi.nlm.nih.gov/23724051" }, { "database": "PubMed", "id": "23861877", "url": "https://pubmed.ncbi.nlm.nih.gov/23861877" }, { "database": "PubMed", "id": "24023012", "url": "https://pubmed.ncbi.nlm.nih.gov/24023012" }, { "database": "PubMed", "id": "24057571", "url": "https://pubmed.ncbi.nlm.nih.gov/24057571" }, { "database": "PubMed", "id": "24073922", "url": "https://pubmed.ncbi.nlm.nih.gov/24073922" }, { "database": "PubMed", "id": "24098154", "url": "https://pubmed.ncbi.nlm.nih.gov/24098154" }, { "database": "PubMed", "id": "24133625", "url": "https://pubmed.ncbi.nlm.nih.gov/24133625" }, { "database": "PubMed", "id": "24180592", "url": "https://pubmed.ncbi.nlm.nih.gov/24180592" }, { "database": "PubMed", "id": "24201812", "url": "https://pubmed.ncbi.nlm.nih.gov/24201812" }, { "database": "PubMed", "id": "24245980", "url": "https://pubmed.ncbi.nlm.nih.gov/24245980" }, { "database": "PubMed", "id": "24262949", "url": "https://pubmed.ncbi.nlm.nih.gov/24262949" }, { "database": "PubMed", "id": "24273605", "url": "https://pubmed.ncbi.nlm.nih.gov/24273605" }, { "database": "PubMed", "id": "24287900", "url": "https://pubmed.ncbi.nlm.nih.gov/24287900" }, { "database": "PubMed", "id": "24303161", "url": "https://pubmed.ncbi.nlm.nih.gov/24303161" }, { "database": "PubMed", "id": "24376606", "url": "https://pubmed.ncbi.nlm.nih.gov/24376606" }, { "database": "PubMed", "id": "24384983", "url": "https://pubmed.ncbi.nlm.nih.gov/24384983" }, { "database": "PubMed", "id": "24416349", "url": "https://pubmed.ncbi.nlm.nih.gov/24416349" }, { "database": "PubMed", "id": "24496460", "url": "https://pubmed.ncbi.nlm.nih.gov/24496460" }, { "database": "PubMed", "id": "24527093", "url": "https://pubmed.ncbi.nlm.nih.gov/24527093" }, { "database": "PubMed", "id": "24587596", "url": "https://pubmed.ncbi.nlm.nih.gov/24587596" }, { "database": "PubMed", "id": "24590896", "url": "https://pubmed.ncbi.nlm.nih.gov/24590896" }, { "database": "PubMed", "id": "24606695", "url": "https://pubmed.ncbi.nlm.nih.gov/24606695" }, { "database": "PubMed", "id": "24691032", "url": "https://pubmed.ncbi.nlm.nih.gov/24691032" }, { "database": "PubMed", "id": "24810758", "url": "https://pubmed.ncbi.nlm.nih.gov/24810758" }, { "database": "PubMed", "id": "24887419", "url": "https://pubmed.ncbi.nlm.nih.gov/24887419" }, { "database": "PubMed", "id": "24932295", "url": "https://pubmed.ncbi.nlm.nih.gov/24932295" }, { "database": "PubMed", "id": "24952732", "url": "https://pubmed.ncbi.nlm.nih.gov/24952732" }, { "database": "PubMed", "id": "24984001", "url": "https://pubmed.ncbi.nlm.nih.gov/24984001" }, { "database": "PubMed", "id": "24995775", "url": "https://pubmed.ncbi.nlm.nih.gov/24995775" }, { "database": "PubMed", "id": "25005758", "url": "https://pubmed.ncbi.nlm.nih.gov/25005758" }, { "database": "PubMed", "id": "25020061", "url": "https://pubmed.ncbi.nlm.nih.gov/25020061" }, { "database": "PubMed", "id": "25026292", "url": "https://pubmed.ncbi.nlm.nih.gov/25026292" }, { "database": "PubMed", "id": "25028121", "url": "https://pubmed.ncbi.nlm.nih.gov/25028121" }, { "database": "PubMed", "id": "25035961", "url": "https://pubmed.ncbi.nlm.nih.gov/25035961" }, { "database": "PubMed", "id": "25051975", "url": "https://pubmed.ncbi.nlm.nih.gov/25051975" }, { "database": "PubMed", "id": "25088800", "url": "https://pubmed.ncbi.nlm.nih.gov/25088800" }, { "database": "PubMed", "id": "25153728", "url": "https://pubmed.ncbi.nlm.nih.gov/25153728" }, { "database": "PubMed", "id": "25183163", "url": "https://pubmed.ncbi.nlm.nih.gov/25183163" }, { "database": "PubMed", "id": "25200751", "url": "https://pubmed.ncbi.nlm.nih.gov/25200751" }, { "database": "PubMed", "id": "25221647", "url": "https://pubmed.ncbi.nlm.nih.gov/25221647" }, { "database": "PubMed", "id": "25283550", "url": "https://pubmed.ncbi.nlm.nih.gov/25283550" }, { "database": "PubMed", "id": "25296981", "url": "https://pubmed.ncbi.nlm.nih.gov/25296981" }, { "database": "PubMed", "id": "25302072", "url": "https://pubmed.ncbi.nlm.nih.gov/25302072" }, { "database": "PubMed", "id": "25356866", "url": "https://pubmed.ncbi.nlm.nih.gov/25356866" }, { "database": "PubMed", "id": "25385184", "url": "https://pubmed.ncbi.nlm.nih.gov/25385184" }, { "database": "PubMed", "id": "25460505", "url": "https://pubmed.ncbi.nlm.nih.gov/25460505" }, { "database": "PubMed", "id": "25592318", "url": "https://pubmed.ncbi.nlm.nih.gov/25592318" }, { "database": "PubMed", "id": "25596749", "url": "https://pubmed.ncbi.nlm.nih.gov/25596749" }, { "database": "PubMed", "id": "25609923", "url": "https://pubmed.ncbi.nlm.nih.gov/25609923" }, { "database": "PubMed", "id": "25624750", "url": "https://pubmed.ncbi.nlm.nih.gov/25624750" }, { "database": "PubMed", "id": "25721419", "url": "https://pubmed.ncbi.nlm.nih.gov/25721419" }, { "database": "PubMed", "id": "25724269", "url": "https://pubmed.ncbi.nlm.nih.gov/25724269" }, { "database": "PubMed", "id": "25738356", "url": "https://pubmed.ncbi.nlm.nih.gov/25738356" }, { "database": "PubMed", "id": "25775774", "url": "https://pubmed.ncbi.nlm.nih.gov/25775774" }, { "database": "PubMed", "id": "25792811", "url": "https://pubmed.ncbi.nlm.nih.gov/25792811" }, { "database": "PubMed", "id": "25793983", "url": "https://pubmed.ncbi.nlm.nih.gov/25793983" }, { "database": "PubMed", "id": "25815363", "url": "https://pubmed.ncbi.nlm.nih.gov/25815363" }, { "database": "PubMed", "id": "25834399", "url": "https://pubmed.ncbi.nlm.nih.gov/25834399" }, { "database": "PubMed", "id": "25849580", "url": "https://pubmed.ncbi.nlm.nih.gov/25849580" }, { "database": "PubMed", "id": "25884331", "url": "https://pubmed.ncbi.nlm.nih.gov/25884331" }, { "database": "PubMed", "id": "25902785", "url": "https://pubmed.ncbi.nlm.nih.gov/25902785" }, { "database": "PubMed", "id": "25909895", "url": "https://pubmed.ncbi.nlm.nih.gov/25909895" }, { "database": "PubMed", "id": "25926716", "url": "https://pubmed.ncbi.nlm.nih.gov/25926716" }, { "database": "PubMed", "id": "25945839", "url": "https://pubmed.ncbi.nlm.nih.gov/25945839" }, { "database": "PubMed", "id": "25978653", "url": "https://pubmed.ncbi.nlm.nih.gov/25978653" }, { "database": "PubMed", "id": "26071201", "url": "https://pubmed.ncbi.nlm.nih.gov/26071201" }, { "database": "PubMed", "id": "26114294", "url": "https://pubmed.ncbi.nlm.nih.gov/26114294" }, { "database": "PubMed", "id": "26151180", "url": "https://pubmed.ncbi.nlm.nih.gov/26151180" }, { "database": "PubMed", "id": "26158518", "url": "https://pubmed.ncbi.nlm.nih.gov/26158518" }, { "database": "PubMed", "id": "26291325", "url": "https://pubmed.ncbi.nlm.nih.gov/26291325" }, { "database": "PubMed", "id": "26313911", "url": "https://pubmed.ncbi.nlm.nih.gov/26313911" }, { "database": "PubMed", "id": "26317515", "url": "https://pubmed.ncbi.nlm.nih.gov/26317515" }, { "database": "PubMed", "id": "26329846", "url": "https://pubmed.ncbi.nlm.nih.gov/26329846" }, { "database": "PubMed", "id": "26367276", "url": "https://pubmed.ncbi.nlm.nih.gov/26367276" }, { "database": "PubMed", "id": "26369790", "url": "https://pubmed.ncbi.nlm.nih.gov/26369790" }, { "database": "PubMed", "id": "26384306", "url": "https://pubmed.ncbi.nlm.nih.gov/26384306" }, { "database": "PubMed", "id": "26397133", "url": "https://pubmed.ncbi.nlm.nih.gov/26397133" }, { "database": "PubMed", "id": "26397365", "url": "https://pubmed.ncbi.nlm.nih.gov/26397365" }, { "database": "PubMed", "id": "26413815", "url": "https://pubmed.ncbi.nlm.nih.gov/26413815" }, { "database": "PubMed", "id": "26416965", "url": "https://pubmed.ncbi.nlm.nih.gov/26416965" }, { "database": "PubMed", "id": "26417067", "url": "https://pubmed.ncbi.nlm.nih.gov/26417067" }, { "database": "PubMed", "id": "26437614", "url": "https://pubmed.ncbi.nlm.nih.gov/26437614" }, { "database": "PubMed", "id": "26447757", "url": "https://pubmed.ncbi.nlm.nih.gov/26447757" }, { "database": "PubMed", "id": "26496360", "url": "https://pubmed.ncbi.nlm.nih.gov/26496360" }, { "database": "PubMed", "id": "26536660", "url": "https://pubmed.ncbi.nlm.nih.gov/26536660" }, { "database": "PubMed", "id": "26557719", "url": "https://pubmed.ncbi.nlm.nih.gov/26557719" }, { "database": "PubMed", "id": "26580601", "url": "https://pubmed.ncbi.nlm.nih.gov/26580601" }, { "database": "PubMed", "id": "26641458", "url": "https://pubmed.ncbi.nlm.nih.gov/26641458" }, { "database": "PubMed", "id": "26657290", "url": "https://pubmed.ncbi.nlm.nih.gov/26657290" }, { "database": "PubMed", "id": "26674543", "url": "https://pubmed.ncbi.nlm.nih.gov/26674543" }, { "database": "PubMed", "id": "26698679", "url": "https://pubmed.ncbi.nlm.nih.gov/26698679" }, { "database": "PubMed", "id": "26734992", "url": "https://pubmed.ncbi.nlm.nih.gov/26734992" }, { "database": "PubMed", "id": "26775697", "url": "https://pubmed.ncbi.nlm.nih.gov/26775697" }, { "database": "PubMed", "id": "26775708", "url": "https://pubmed.ncbi.nlm.nih.gov/26775708" }, { "database": "PubMed", "id": "26791827", "url": "https://pubmed.ncbi.nlm.nih.gov/26791827" }, { "database": "PubMed", "id": "26879868", "url": "https://pubmed.ncbi.nlm.nih.gov/26879868" }, { "database": "PubMed", "id": "26887051", "url": "https://pubmed.ncbi.nlm.nih.gov/26887051" }, { "database": "PubMed", "id": "26909611", "url": "https://pubmed.ncbi.nlm.nih.gov/26909611" }, { "database": "PubMed", "id": "26919097", "url": "https://pubmed.ncbi.nlm.nih.gov/26919097" }, { "database": "PubMed", "id": "26934000", "url": "https://pubmed.ncbi.nlm.nih.gov/26934000" }, { "database": "PubMed", "id": "26940018", "url": "https://pubmed.ncbi.nlm.nih.gov/26940018" }, { "database": "PubMed", "id": "26985829", "url": "https://pubmed.ncbi.nlm.nih.gov/26985829" }, { "database": "PubMed", "id": "27009203", "url": "https://pubmed.ncbi.nlm.nih.gov/27009203" }, { "database": "PubMed", "id": "27031247", "url": "https://pubmed.ncbi.nlm.nih.gov/27031247" }, { "database": "PubMed", "id": "27048233", "url": "https://pubmed.ncbi.nlm.nih.gov/27048233" }, { "database": "PubMed", "id": "27070592", "url": "https://pubmed.ncbi.nlm.nih.gov/27070592" }, { "database": "PubMed", "id": "27096957", "url": "https://pubmed.ncbi.nlm.nih.gov/27096957" }, { "database": "PubMed", "id": "27098617", "url": "https://pubmed.ncbi.nlm.nih.gov/27098617" }, { "database": "PubMed", "id": "27147579", "url": "https://pubmed.ncbi.nlm.nih.gov/27147579" }, { "database": "PubMed", "id": "27223432", "url": "https://pubmed.ncbi.nlm.nih.gov/27223432" }, { "database": "PubMed", "id": "27227776", "url": "https://pubmed.ncbi.nlm.nih.gov/27227776" }, { "database": "PubMed", "id": "27239959", "url": "https://pubmed.ncbi.nlm.nih.gov/27239959" }, { "database": "PubMed", "id": "27259258", "url": "https://pubmed.ncbi.nlm.nih.gov/27259258" }, { "database": "PubMed", "id": "27264178", "url": "https://pubmed.ncbi.nlm.nih.gov/27264178" }, { "database": "PubMed", "id": "27304189", "url": "https://pubmed.ncbi.nlm.nih.gov/27304189" }, { "database": "PubMed", "id": "27322212", "url": "https://pubmed.ncbi.nlm.nih.gov/27322212" }, { "database": "PubMed", "id": "27329724", "url": "https://pubmed.ncbi.nlm.nih.gov/27329724" }, { "database": "PubMed", "id": "27379204", "url": "https://pubmed.ncbi.nlm.nih.gov/27379204" }, { "database": "PubMed", "id": "27467530", "url": "https://pubmed.ncbi.nlm.nih.gov/27467530" }, { "database": "PubMed", "id": "27486771", "url": "https://pubmed.ncbi.nlm.nih.gov/27486771" }, { "database": "PubMed", "id": "27494886", "url": "https://pubmed.ncbi.nlm.nih.gov/27494886" }, { "database": "PubMed", "id": "27506466", "url": "https://pubmed.ncbi.nlm.nih.gov/27506466" }, { "database": "PubMed", "id": "27517315", "url": "https://pubmed.ncbi.nlm.nih.gov/27517315" }, { "database": "PubMed", "id": "27551516", "url": "https://pubmed.ncbi.nlm.nih.gov/27551516" }, { "database": "PubMed", "id": "27611696", "url": "https://pubmed.ncbi.nlm.nih.gov/27611696" }, { "database": "PubMed", "id": "27654866", "url": "https://pubmed.ncbi.nlm.nih.gov/27654866" }, { "database": "PubMed", "id": "27656263", "url": "https://pubmed.ncbi.nlm.nih.gov/27656263" }, { "database": "PubMed", "id": "27658964", "url": "https://pubmed.ncbi.nlm.nih.gov/27658964" }, { "database": "PubMed", "id": "27680387", "url": "https://pubmed.ncbi.nlm.nih.gov/27680387" }, { "database": "PubMed", "id": "27769069", "url": "https://pubmed.ncbi.nlm.nih.gov/27769069" }, { "database": "PubMed", "id": "27863387", "url": "https://pubmed.ncbi.nlm.nih.gov/27863387" }, { "database": "PubMed", "id": "27903908", "url": "https://pubmed.ncbi.nlm.nih.gov/27903908" }, { "database": "PubMed", "id": "27903966", "url": "https://pubmed.ncbi.nlm.nih.gov/27903966" }, { "database": "PubMed", "id": "27935582", "url": "https://pubmed.ncbi.nlm.nih.gov/27935582" }, { "database": "PubMed", "id": "27957793", "url": "https://pubmed.ncbi.nlm.nih.gov/27957793" }, { "database": "PubMed", "id": "28061443", "url": "https://pubmed.ncbi.nlm.nih.gov/28061443" }, { "database": "PubMed", "id": "28102849", "url": "https://pubmed.ncbi.nlm.nih.gov/28102849" }, { "database": "PubMed", "id": "28146421", "url": "https://pubmed.ncbi.nlm.nih.gov/28146421" }, { "database": "PubMed", "id": "28152510", "url": "https://pubmed.ncbi.nlm.nih.gov/28152510" }, { "database": "PubMed", "id": "28191279", "url": "https://pubmed.ncbi.nlm.nih.gov/28191279" }, { "database": "PubMed", "id": "28252104", "url": "https://pubmed.ncbi.nlm.nih.gov/28252104" }, { "database": "PubMed", "id": "28272965", "url": "https://pubmed.ncbi.nlm.nih.gov/28272965" }, { "database": "PubMed", "id": "28400912", "url": "https://pubmed.ncbi.nlm.nih.gov/28400912" }, { "database": "PubMed", "id": "28475412", "url": "https://pubmed.ncbi.nlm.nih.gov/28475412" }, { "database": "PubMed", "id": "28481292", "url": "https://pubmed.ncbi.nlm.nih.gov/28481292" }, { "database": "PubMed", "id": "28569781", "url": "https://pubmed.ncbi.nlm.nih.gov/28569781" }, { "database": "PubMed", "id": "28591197", "url": "https://pubmed.ncbi.nlm.nih.gov/28591197" }, { "database": "PubMed", "id": "28592812", "url": "https://pubmed.ncbi.nlm.nih.gov/28592812" }, { "database": "PubMed", "id": "28652768", "url": "https://pubmed.ncbi.nlm.nih.gov/28652768" }, { "database": "PubMed", "id": "28675026", "url": "https://pubmed.ncbi.nlm.nih.gov/28675026" }, { "database": "PubMed", "id": "28675785", "url": "https://pubmed.ncbi.nlm.nih.gov/28675785" }, { "database": "PubMed", "id": "28710431", "url": "https://pubmed.ncbi.nlm.nih.gov/28710431" }, { "database": "PubMed", "id": "28750861", "url": "https://pubmed.ncbi.nlm.nih.gov/28750861" }, { "database": "PubMed", "id": "28808322", "url": "https://pubmed.ncbi.nlm.nih.gov/28808322" }, { "database": "PubMed", "id": "28837154", "url": "https://pubmed.ncbi.nlm.nih.gov/28837154" }, { "database": "PubMed", "id": "28857517", "url": "https://pubmed.ncbi.nlm.nih.gov/28857517" }, { "database": "PubMed", "id": "28860574", "url": "https://pubmed.ncbi.nlm.nih.gov/28860574" }, { "database": "PubMed", "id": "28881606", "url": "https://pubmed.ncbi.nlm.nih.gov/28881606" }, { "database": "PubMed", "id": "28903328", "url": "https://pubmed.ncbi.nlm.nih.gov/28903328" }, { "database": "PubMed", "id": "28923059", "url": "https://pubmed.ncbi.nlm.nih.gov/28923059" }, { "database": "PubMed", "id": "28962438", "url": "https://pubmed.ncbi.nlm.nih.gov/28962438" }, { "database": "PubMed", "id": "28963552", "url": "https://pubmed.ncbi.nlm.nih.gov/28963552" }, { "database": "PubMed", "id": "28974016", "url": "https://pubmed.ncbi.nlm.nih.gov/28974016" }, { "database": "PubMed", "id": "29072696", "url": "https://pubmed.ncbi.nlm.nih.gov/29072696" }, { "database": "PubMed", "id": "29156703", "url": "https://pubmed.ncbi.nlm.nih.gov/29156703" }, { "database": "PubMed", "id": "29162840", "url": "https://pubmed.ncbi.nlm.nih.gov/29162840" }, { "database": "PubMed", "id": "29167516", "url": "https://pubmed.ncbi.nlm.nih.gov/29167516" }, { "database": "PubMed", "id": "29175420", "url": "https://pubmed.ncbi.nlm.nih.gov/29175420" }, { "database": "PubMed", "id": "29190940", "url": "https://pubmed.ncbi.nlm.nih.gov/29190940" }, { "database": "PubMed", "id": "29233971", "url": "https://pubmed.ncbi.nlm.nih.gov/29233971" }, { "database": "PubMed", "id": "29331082", "url": "https://pubmed.ncbi.nlm.nih.gov/29331082" }, { "database": "PubMed", "id": "29379304", "url": "https://pubmed.ncbi.nlm.nih.gov/29379304" }, { "database": "PubMed", "id": "29396411", "url": "https://pubmed.ncbi.nlm.nih.gov/29396411" }, { "database": "PubMed", "id": "29396506", "url": "https://pubmed.ncbi.nlm.nih.gov/29396506" }, { "database": "PubMed", "id": "29423932", "url": "https://pubmed.ncbi.nlm.nih.gov/29423932" }, { "database": "PubMed", "id": "29434840", "url": "https://pubmed.ncbi.nlm.nih.gov/29434840" }, { "database": "PubMed", "id": "29448085", "url": "https://pubmed.ncbi.nlm.nih.gov/29448085" }, { "database": "PubMed", "id": "29463831", "url": "https://pubmed.ncbi.nlm.nih.gov/29463831" }, { "database": "PubMed", "id": "29472585", "url": "https://pubmed.ncbi.nlm.nih.gov/29472585" }, { "database": "PubMed", "id": "29472733", "url": "https://pubmed.ncbi.nlm.nih.gov/29472733" }, { "database": "PubMed", "id": "29476223", "url": "https://pubmed.ncbi.nlm.nih.gov/29476223" }, { "database": "PubMed", "id": "29484131", "url": "https://pubmed.ncbi.nlm.nih.gov/29484131" }, { "database": "PubMed", "id": "29533017", "url": "https://pubmed.ncbi.nlm.nih.gov/29533017" }, { "database": "PubMed", "id": "29552187", "url": "https://pubmed.ncbi.nlm.nih.gov/29552187" }, { "database": "PubMed", "id": "29662627", "url": "https://pubmed.ncbi.nlm.nih.gov/29662627" }, { "database": "PubMed", "id": "29665227", "url": "https://pubmed.ncbi.nlm.nih.gov/29665227" }, { "database": "PubMed", "id": "29692710", "url": "https://pubmed.ncbi.nlm.nih.gov/29692710" }, { "database": "PubMed", "id": "29712904", "url": "https://pubmed.ncbi.nlm.nih.gov/29712904" }, { "database": "PubMed", "id": "29716528", "url": "https://pubmed.ncbi.nlm.nih.gov/29716528" }, { "database": "PubMed", "id": "29719593", "url": "https://pubmed.ncbi.nlm.nih.gov/29719593" }, { "database": "PubMed", "id": "29731844", "url": "https://pubmed.ncbi.nlm.nih.gov/29731844" }, { "database": "PubMed", "id": "29749377", "url": "https://pubmed.ncbi.nlm.nih.gov/29749377" }, { "database": "PubMed", "id": "29755672", "url": "https://pubmed.ncbi.nlm.nih.gov/29755672" }, { "database": "PubMed", "id": "29774133", "url": "https://pubmed.ncbi.nlm.nih.gov/29774133" }, { "database": "PubMed", "id": "29780826", "url": "https://pubmed.ncbi.nlm.nih.gov/29780826" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "29933163", "url": "https://pubmed.ncbi.nlm.nih.gov/29933163" }, { "database": "PubMed", "id": "30036188", "url": "https://pubmed.ncbi.nlm.nih.gov/30036188" }, { "database": "PubMed", "id": "30067827", "url": "https://pubmed.ncbi.nlm.nih.gov/30067827" }, { "database": "PubMed", "id": "30073169", "url": "https://pubmed.ncbi.nlm.nih.gov/30073169" }, { "database": "PubMed", "id": "30108651", "url": "https://pubmed.ncbi.nlm.nih.gov/30108651" }, { "database": "PubMed", "id": "30132043", "url": "https://pubmed.ncbi.nlm.nih.gov/30132043" }, { "database": "PubMed", "id": "30154572", "url": "https://pubmed.ncbi.nlm.nih.gov/30154572" }, { "database": "PubMed", "id": "30208604", "url": "https://pubmed.ncbi.nlm.nih.gov/30208604" }, { "database": "PubMed", "id": "30250025", "url": "https://pubmed.ncbi.nlm.nih.gov/30250025" }, { "database": "PubMed", "id": "30258945", "url": "https://pubmed.ncbi.nlm.nih.gov/30258945" }, { "database": "PubMed", "id": "30274346", "url": "https://pubmed.ncbi.nlm.nih.gov/30274346" }, { "database": "PubMed", "id": "30282964", "url": "https://pubmed.ncbi.nlm.nih.gov/30282964" }, { "database": "PubMed", "id": "30285764", "url": "https://pubmed.ncbi.nlm.nih.gov/30285764" }, { "database": "PubMed", "id": "30326670", "url": "https://pubmed.ncbi.nlm.nih.gov/30326670" }, { "database": "PubMed", "id": "30341283", "url": "https://pubmed.ncbi.nlm.nih.gov/30341283" }, { "database": "PubMed", "id": "30359321", "url": "https://pubmed.ncbi.nlm.nih.gov/30359321" }, { "database": "PubMed", "id": "30373220", "url": "https://pubmed.ncbi.nlm.nih.gov/30373220" }, { "database": "PubMed", "id": "30473630", "url": "https://pubmed.ncbi.nlm.nih.gov/30473630" }, { "database": "PubMed", "id": "30514289", "url": "https://pubmed.ncbi.nlm.nih.gov/30514289" }, { "database": "PubMed", "id": "30599894", "url": "https://pubmed.ncbi.nlm.nih.gov/30599894" }, { "database": "PubMed", "id": "30619462", "url": "https://pubmed.ncbi.nlm.nih.gov/30619462" }, { "database": "PubMed", "id": "30622543", "url": "https://pubmed.ncbi.nlm.nih.gov/30622543" }, { "database": "PubMed", "id": "30633777", "url": "https://pubmed.ncbi.nlm.nih.gov/30633777" }, { "database": "PubMed", "id": "30654190", "url": "https://pubmed.ncbi.nlm.nih.gov/30654190" }, { "database": "PubMed", "id": "30675291", "url": "https://pubmed.ncbi.nlm.nih.gov/30675291" }, { "database": "PubMed", "id": "30699367", "url": "https://pubmed.ncbi.nlm.nih.gov/30699367" }, { "database": "PubMed", "id": "30716115", "url": "https://pubmed.ncbi.nlm.nih.gov/30716115" }, { "database": "PubMed", "id": "30753671", "url": "https://pubmed.ncbi.nlm.nih.gov/30753671" }, { "database": "PubMed", "id": "30755581", "url": "https://pubmed.ncbi.nlm.nih.gov/30755581" }, { "database": "PubMed", "id": "30758811", "url": "https://pubmed.ncbi.nlm.nih.gov/30758811" }, { "database": "PubMed", "id": "30761524", "url": "https://pubmed.ncbi.nlm.nih.gov/30761524" }, { "database": "PubMed", "id": "30771309", "url": "https://pubmed.ncbi.nlm.nih.gov/30771309" }, { "database": "PubMed", "id": "30813295", "url": "https://pubmed.ncbi.nlm.nih.gov/30813295" }, { "database": "PubMed", "id": "30816192", "url": "https://pubmed.ncbi.nlm.nih.gov/30816192" }, { "database": "PubMed", "id": "30816216", "url": "https://pubmed.ncbi.nlm.nih.gov/30816216" }, { "database": "PubMed", "id": "30864709", "url": "https://pubmed.ncbi.nlm.nih.gov/30864709" }, { "database": "PubMed", "id": "30959969", "url": "https://pubmed.ncbi.nlm.nih.gov/30959969" }, { "database": "PubMed", "id": "30965356", "url": "https://pubmed.ncbi.nlm.nih.gov/30965356" }, { "database": "PubMed", "id": "30986276", "url": "https://pubmed.ncbi.nlm.nih.gov/30986276" }, { "database": "PubMed", "id": "31031856", "url": "https://pubmed.ncbi.nlm.nih.gov/31031856" }, { "database": "PubMed", "id": "31032225", "url": "https://pubmed.ncbi.nlm.nih.gov/31032225" }, { "database": "PubMed", "id": "31037139", "url": "https://pubmed.ncbi.nlm.nih.gov/31037139" }, { "database": "PubMed", "id": "31046771", "url": "https://pubmed.ncbi.nlm.nih.gov/31046771" }, { "database": "PubMed", "id": "31083403", "url": "https://pubmed.ncbi.nlm.nih.gov/31083403" }, { "database": "PubMed", "id": "31089421", "url": "https://pubmed.ncbi.nlm.nih.gov/31089421" }, { "database": "PubMed", "id": "31160490", "url": "https://pubmed.ncbi.nlm.nih.gov/31160490" }, { "database": "PubMed", "id": "31195027", "url": "https://pubmed.ncbi.nlm.nih.gov/31195027" }, { "database": "PubMed", "id": "31197106", "url": "https://pubmed.ncbi.nlm.nih.gov/31197106" }, { "database": "PubMed", "id": "31247000", "url": "https://pubmed.ncbi.nlm.nih.gov/31247000" }, { "database": "PubMed", "id": "31284427", "url": "https://pubmed.ncbi.nlm.nih.gov/31284427" }, { "database": "PubMed", "id": "31294029", "url": "https://pubmed.ncbi.nlm.nih.gov/31294029" }, { "database": "PubMed", "id": "31332166", "url": "https://pubmed.ncbi.nlm.nih.gov/31332166" }, { "database": "PubMed", "id": "31383843", "url": "https://pubmed.ncbi.nlm.nih.gov/31383843" }, { "database": "PubMed", "id": "31383875", "url": "https://pubmed.ncbi.nlm.nih.gov/31383875" }, { "database": "PubMed", "id": "31388935", "url": "https://pubmed.ncbi.nlm.nih.gov/31388935" }, { "database": "PubMed", "id": "31404320", "url": "https://pubmed.ncbi.nlm.nih.gov/31404320" }, { "database": "PubMed", "id": "31428575", "url": "https://pubmed.ncbi.nlm.nih.gov/31428575" }, { "database": "PubMed", "id": "31546610", "url": "https://pubmed.ncbi.nlm.nih.gov/31546610" }, { "database": "PubMed", "id": "31572212", "url": "https://pubmed.ncbi.nlm.nih.gov/31572212" }, { "database": "PubMed", "id": "31586300", "url": "https://pubmed.ncbi.nlm.nih.gov/31586300" }, { "database": "PubMed", "id": "31601269", "url": "https://pubmed.ncbi.nlm.nih.gov/31601269" }, { "database": "PubMed", "id": "31710966", "url": "https://pubmed.ncbi.nlm.nih.gov/31710966" }, { "database": "PubMed", "id": "31889970", "url": "https://pubmed.ncbi.nlm.nih.gov/31889970" }, { "database": "PubMed", "id": "32012648", "url": "https://pubmed.ncbi.nlm.nih.gov/32012648" }, { "database": "PubMed", "id": "32019055", "url": "https://pubmed.ncbi.nlm.nih.gov/32019055" }, { "database": "PubMed", "id": "32051464", "url": "https://pubmed.ncbi.nlm.nih.gov/32051464" }, { "database": "PubMed", "id": "32066788", "url": "https://pubmed.ncbi.nlm.nih.gov/32066788" }, { "database": "PubMed", "id": "32103999", "url": "https://pubmed.ncbi.nlm.nih.gov/32103999" }, { "database": "PubMed", "id": "32363163", "url": "https://pubmed.ncbi.nlm.nih.gov/32363163" }, { "database": "PubMed", "id": "32444674", "url": "https://pubmed.ncbi.nlm.nih.gov/32444674" }, { "database": "PubMed", "id": "32460884", "url": "https://pubmed.ncbi.nlm.nih.gov/32460884" }, { "database": "PubMed", "id": "32563986", "url": "https://pubmed.ncbi.nlm.nih.gov/32563986" }, { "database": "PubMed", "id": "32575925", "url": "https://pubmed.ncbi.nlm.nih.gov/32575925" }, { "database": "PubMed", "id": "32576196", "url": "https://pubmed.ncbi.nlm.nih.gov/32576196" }, { "database": "PubMed", "id": "32642725", "url": "https://pubmed.ncbi.nlm.nih.gov/32642725" }, { "database": "PubMed", "id": "32676067", "url": "https://pubmed.ncbi.nlm.nih.gov/32676067" }, { "database": "PubMed", "id": "32707827", "url": "https://pubmed.ncbi.nlm.nih.gov/32707827" }, { "database": "PubMed", "id": "32753891", "url": "https://pubmed.ncbi.nlm.nih.gov/32753891" }, { "database": "PubMed", "id": "32765083", "url": "https://pubmed.ncbi.nlm.nih.gov/32765083" }, { "database": "PubMed", "id": "32766308", "url": "https://pubmed.ncbi.nlm.nih.gov/32766308" }, { "database": "PubMed", "id": "32863214", "url": "https://pubmed.ncbi.nlm.nih.gov/32863214" }, { "database": "PubMed", "id": "32943998", "url": "https://pubmed.ncbi.nlm.nih.gov/32943998" }, { "database": "PubMed", "id": "32958058", "url": "https://pubmed.ncbi.nlm.nih.gov/32958058" }, { "database": "PubMed", "id": "33003310", "url": "https://pubmed.ncbi.nlm.nih.gov/33003310" }, { "database": "PubMed", "id": "33071789", "url": "https://pubmed.ncbi.nlm.nih.gov/33071789" }, { "database": "PubMed", "id": "33101031", "url": "https://pubmed.ncbi.nlm.nih.gov/33101031" }, { "database": "PubMed", "id": "33116125", "url": "https://pubmed.ncbi.nlm.nih.gov/33116125" }, { "database": "PubMed", "id": "33219302", "url": "https://pubmed.ncbi.nlm.nih.gov/33219302" }, { "database": "PubMed", "id": "33226960", "url": "https://pubmed.ncbi.nlm.nih.gov/33226960" }, { "database": "PubMed", "id": "33249469", "url": "https://pubmed.ncbi.nlm.nih.gov/33249469" }, { "database": "PubMed", "id": "33411714", "url": "https://pubmed.ncbi.nlm.nih.gov/33411714" }, { "database": "PubMed", "id": "33414447", "url": "https://pubmed.ncbi.nlm.nih.gov/33414447" }, { "database": "PubMed", "id": "33456359", "url": "https://pubmed.ncbi.nlm.nih.gov/33456359" }, { "database": "PubMed", "id": "33473107", "url": "https://pubmed.ncbi.nlm.nih.gov/33473107" }, { "database": "PubMed", "id": "33509041", "url": "https://pubmed.ncbi.nlm.nih.gov/33509041" }, { "database": "PubMed", "id": "33523588", "url": "https://pubmed.ncbi.nlm.nih.gov/33523588" }, { "database": "PubMed", "id": "33526785", "url": "https://pubmed.ncbi.nlm.nih.gov/33526785" }, { "database": "PubMed", "id": "33549048", "url": "https://pubmed.ncbi.nlm.nih.gov/33549048" }, { "database": "PubMed", "id": "33609078", "url": "https://pubmed.ncbi.nlm.nih.gov/33609078" }, { "database": "PubMed", "id": "33658929", "url": "https://pubmed.ncbi.nlm.nih.gov/33658929" }, { "database": "PubMed", "id": "33664437", "url": "https://pubmed.ncbi.nlm.nih.gov/33664437" }, { "database": "PubMed", "id": "33679734", "url": "https://pubmed.ncbi.nlm.nih.gov/33679734" }, { "database": "PubMed", "id": "33718332", "url": "https://pubmed.ncbi.nlm.nih.gov/33718332" }, { "database": "PubMed", "id": "33723215", "url": "https://pubmed.ncbi.nlm.nih.gov/33723215" }, { "database": "PubMed", "id": "33731670", "url": "https://pubmed.ncbi.nlm.nih.gov/33731670" }, { "database": "PubMed", "id": "33806593", "url": "https://pubmed.ncbi.nlm.nih.gov/33806593" }, { "database": "PubMed", "id": "33833996", "url": "https://pubmed.ncbi.nlm.nih.gov/33833996" }, { "database": "PubMed", "id": "33845796", "url": "https://pubmed.ncbi.nlm.nih.gov/33845796" }, { "database": "PubMed", "id": "33849427", "url": "https://pubmed.ncbi.nlm.nih.gov/33849427" }, { "database": "PubMed", "id": "33893278", "url": "https://pubmed.ncbi.nlm.nih.gov/33893278" }, { "database": "PubMed", "id": "33907223", "url": "https://pubmed.ncbi.nlm.nih.gov/33907223" }, { "database": "PubMed", "id": "33912163", "url": "https://pubmed.ncbi.nlm.nih.gov/33912163" }, { "database": "PubMed", "id": "33920031", "url": "https://pubmed.ncbi.nlm.nih.gov/33920031" }, { "database": "PubMed", "id": "33920772", "url": "https://pubmed.ncbi.nlm.nih.gov/33920772" }, { "database": "PubMed", "id": "33923895", "url": "https://pubmed.ncbi.nlm.nih.gov/33923895" }, { "database": "PubMed", "id": "33967735", "url": "https://pubmed.ncbi.nlm.nih.gov/33967735" }, { "database": "PubMed", "id": "35783523", "url": "https://pubmed.ncbi.nlm.nih.gov/35783523" }, { "database": "PubMed", "id": "35912992", "url": "https://pubmed.ncbi.nlm.nih.gov/35912992" }, { "database": "PubMed", "id": "36386326", "url": "https://pubmed.ncbi.nlm.nih.gov/36386326" }, { "database": "PubMed", "id": "36471885", "url": "https://pubmed.ncbi.nlm.nih.gov/36471885" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" } ], "site_lbl": "Ser2448", "uniprot_canonical_ac": "P42345-1" } ], "record_id": "pubmed.29876006", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sex-based differences in resting MAPK, androgen, and glucocorticoid receptor phosphorylation in human skeletal muscle.", "journal": "Steroids", "date": "2019-01", "authors": "Nicoll Justin X, Fry Andrew C, Mosier Eric M", "reference": { "type": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 134, "end_pos": 134, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "21930780", "url": "https://pubmed.ncbi.nlm.nih.gov/21930780" }, { "database": "PubMed", "id": "24291004", "url": "https://pubmed.ncbi.nlm.nih.gov/24291004" }, { "database": "PubMed", "id": "26825173", "url": "https://pubmed.ncbi.nlm.nih.gov/26825173" }, { "database": "PubMed", "id": "27717743", "url": "https://pubmed.ncbi.nlm.nih.gov/27717743" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "32357907", "url": "https://pubmed.ncbi.nlm.nih.gov/32357907" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser134", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.30414425", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ARGLU1 is a transcriptional coactivator and splicing regulator important for stress hormone signaling and development.", "journal": "Nucleic Acids Res.", "date": "2019", "authors": "Magomedova L, Tiefenbach J, Zilberman E, Le Billan F, Voisin V, Saikali M, Boivin V, Robitaille M, Gueroussov S, Irimia M, Ray D, Patel R, Xu C, Jeyasuria P, Bader GD, Hughes TR, Morris QD, Scott MS, Krause H, Angers S, Blencowe BJ, Cummins CL", "reference": { "type": "PubMed", "id": "30698747", "url": "https://pubmed.ncbi.nlm.nih.gov/30698747" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NWB6-1", "protein_name": "Arginine and glutamate-rich protein 1", "gene_name": "ARGLU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7ZVW9-1", "protein_name": "Arginine and glutamate-rich protein 1-B", "gene_name": "arglu1b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q9UHX1-1", "protein_name": "Poly(U)-binding-splicing factor PUF60", "gene_name": "PUF60", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06537-1", "protein_name": "Glucocorticoid receptor", "gene_name": "Nr3c1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P26368-1", "protein_name": "Splicing factor U2AF 65 kDa subunit", "gene_name": "U2AF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3UL36-1", "protein_name": "Arginine and glutamate-rich protein 1", "gene_name": "Arglu1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6NYC1-1", "protein_name": "Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6", "gene_name": "JMJD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P5L7-1", "protein_name": "Arginine and glutamate-rich protein 1-A", "gene_name": "arglu1a", "tax_name": "Zebrafish" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 172, "end_pos": 176, "sequence_org": "LLEEL", "sequence_mut": "AAEEA", "comment": "Does not disrupt nuclear receptor coactivator activity; on its own or when associated with 201-AERAA-205.", "evidence": [ { "database": "UniProtKB", "id": "Q9NWB6", "url": "https://www.uniprot.org/uniprotkb/Q9NWB6" }, { "database": "PubMed", "id": "30698747", "url": "https://pubmed.ncbi.nlm.nih.gov/30698747" } ], "uniprot_canonical_ac": "Q9NWB6-1" }, { "start_pos": 201, "end_pos": 205, "sequence_org": "LERIL", "sequence_mut": "AERAA", "comment": "Does not disrupt nuclear receptor coactivator activity; on its own or when associated with 172-AAEEA-176.", "evidence": [ { "database": "UniProtKB", "id": "Q9NWB6", "url": "https://www.uniprot.org/uniprotkb/Q9NWB6" }, { "database": "PubMed", "id": "30698747", "url": "https://pubmed.ncbi.nlm.nih.gov/30698747" } ], "uniprot_canonical_ac": "Q9NWB6-1" } ], "record_id": "pubmed.30698747", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cdk5 Deletion Enhances the Anti-inflammatory Potential of GC-Mediated GR Activation During Inflammation.", "journal": "Frontiers in immunology", "date": "2019", "authors": "Pfander P, Fidan M, Burret U, Lipinski L, Vettorazzi S", "reference": { "type": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.31354714", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoid receptors are required effectors of TGF\u03b21-induced p38 MAPK signaling to advanced cancer phenotypes in triple-negative breast cancer.", "journal": "Breast cancer research : BCR", "date": "2020-05-01", "authors": "Perez Kerkvliet Carlos, Dwyer Amy R, Diep Caroline H, Oakley Robert H, Liddle Christopher, Cidlowski John A, Lange Carol A", "reference": { "type": "PubMed", "id": "32357907", "url": "https://pubmed.ncbi.nlm.nih.gov/32357907" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 134, "end_pos": 134, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "21930780", "url": "https://pubmed.ncbi.nlm.nih.gov/21930780" }, { "database": "PubMed", "id": "24291004", "url": "https://pubmed.ncbi.nlm.nih.gov/24291004" }, { "database": "PubMed", "id": "26825173", "url": "https://pubmed.ncbi.nlm.nih.gov/26825173" }, { "database": "PubMed", "id": "27717743", "url": "https://pubmed.ncbi.nlm.nih.gov/27717743" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "32357907", "url": "https://pubmed.ncbi.nlm.nih.gov/32357907" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser134", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.32357907", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insufficient glucocorticoid receptor signaling and flattened salivary cortisol profile are associated with metabolic and inflammatory indices in type 2 diabetes.", "journal": "Journal of endocrinological investigation", "date": "2021-01", "authors": "Panagiotou C, Lambadiari V, Maratou E, Geromeriati C, Artemiadis A, Dimitriadis G, Moutsatsou P", "reference": { "type": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.32394161", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hypoxia regulates GR function through multiple mechanisms involving microRNAs 103 and 107.", "journal": "Molecular and cellular endocrinology", "date": "2020-12-01", "authors": "Yang Nan, Berry Andrew, Sauer Carolin, Baxter Matthew, Donaldson Ian J, Forbes Karen, Donn Rachelle, Matthews Laura, Ray David", "reference": { "type": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.32871225", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complex fibroblast response to glucocorticoids may underlie variability of clinical efficacy in the vocal folds.", "journal": "Scientific reports", "date": "2020-11-24", "authors": "Nakamura Ryosuke, Mukudai Shigeyuki, Bing Renjie, Garabedian Michael J, Branski Ryan C", "reference": { "type": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22736-1", "protein_name": "Nuclear receptor subfamily 4immunitygroup A member 1", "gene_name": "NR4A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 134, "end_pos": 134, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "21930780", "url": "https://pubmed.ncbi.nlm.nih.gov/21930780" }, { "database": "PubMed", "id": "24291004", "url": "https://pubmed.ncbi.nlm.nih.gov/24291004" }, { "database": "PubMed", "id": "26825173", "url": "https://pubmed.ncbi.nlm.nih.gov/26825173" }, { "database": "PubMed", "id": "27717743", "url": "https://pubmed.ncbi.nlm.nih.gov/27717743" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "32357907", "url": "https://pubmed.ncbi.nlm.nih.gov/32357907" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser134", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "PubMed", "id": "12000743", "url": "https://pubmed.ncbi.nlm.nih.gov/12000743" }, { "database": "PubMed", "id": "25847991", "url": "https://pubmed.ncbi.nlm.nih.gov/25847991" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "17391526", "url": "https://pubmed.ncbi.nlm.nih.gov/17391526" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "18682536", "url": "https://pubmed.ncbi.nlm.nih.gov/18682536" }, { "database": "PubMed", "id": "19101597", "url": "https://pubmed.ncbi.nlm.nih.gov/19101597" }, { "database": "PubMed", "id": "19359101", "url": "https://pubmed.ncbi.nlm.nih.gov/19359101" }, { "database": "PubMed", "id": "19586900", "url": "https://pubmed.ncbi.nlm.nih.gov/19586900" }, { "database": "PubMed", "id": "19729027", "url": "https://pubmed.ncbi.nlm.nih.gov/19729027" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "20660302", "url": "https://pubmed.ncbi.nlm.nih.gov/20660302" }, { "database": "PubMed", "id": "21267416", "url": "https://pubmed.ncbi.nlm.nih.gov/21267416" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "21829454", "url": "https://pubmed.ncbi.nlm.nih.gov/21829454" }, { "database": "PubMed", "id": "22285804", "url": "https://pubmed.ncbi.nlm.nih.gov/22285804" }, { "database": "PubMed", "id": "22745689", "url": "https://pubmed.ncbi.nlm.nih.gov/22745689" }, { "database": "PubMed", "id": "23152905", "url": "https://pubmed.ncbi.nlm.nih.gov/23152905" }, { "database": "PubMed", "id": "23239753", "url": "https://pubmed.ncbi.nlm.nih.gov/23239753" }, { "database": "PubMed", "id": "23593222", "url": "https://pubmed.ncbi.nlm.nih.gov/23593222" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "24030073", "url": "https://pubmed.ncbi.nlm.nih.gov/24030073" }, { "database": "PubMed", "id": "24166279", "url": "https://pubmed.ncbi.nlm.nih.gov/24166279" }, { "database": "PubMed", "id": "24795534", "url": "https://pubmed.ncbi.nlm.nih.gov/24795534" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "25678784", "url": "https://pubmed.ncbi.nlm.nih.gov/25678784" }, { "database": "PubMed", "id": "26993765", "url": "https://pubmed.ncbi.nlm.nih.gov/26993765" }, { "database": "PubMed", "id": "27220430", "url": "https://pubmed.ncbi.nlm.nih.gov/27220430" }, { "database": "PubMed", "id": "27579615", "url": "https://pubmed.ncbi.nlm.nih.gov/27579615" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "28751734", "url": "https://pubmed.ncbi.nlm.nih.gov/28751734" }, { "database": "PubMed", "id": "28808239", "url": "https://pubmed.ncbi.nlm.nih.gov/28808239" }, { "database": "PubMed", "id": "28827617", "url": "https://pubmed.ncbi.nlm.nih.gov/28827617" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "29163463", "url": "https://pubmed.ncbi.nlm.nih.gov/29163463" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "31354714", "url": "https://pubmed.ncbi.nlm.nih.gov/31354714" }, { "database": "PubMed", "id": "32394161", "url": "https://pubmed.ncbi.nlm.nih.gov/32394161" }, { "database": "PubMed", "id": "32871225", "url": "https://pubmed.ncbi.nlm.nih.gov/32871225" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18483179", "url": "https://pubmed.ncbi.nlm.nih.gov/18483179" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "17440046", "url": "https://pubmed.ncbi.nlm.nih.gov/17440046" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "17185395", "url": "https://pubmed.ncbi.nlm.nih.gov/17185395" }, { "database": "PubMed", "id": "18304804", "url": "https://pubmed.ncbi.nlm.nih.gov/18304804" }, { "database": "PubMed", "id": "20086048", "url": "https://pubmed.ncbi.nlm.nih.gov/20086048" }, { "database": "PubMed", "id": "20156337", "url": "https://pubmed.ncbi.nlm.nih.gov/20156337" }, { "database": "PubMed", "id": "20561560", "url": "https://pubmed.ncbi.nlm.nih.gov/20561560" }, { "database": "PubMed", "id": "21474440", "url": "https://pubmed.ncbi.nlm.nih.gov/21474440" }, { "database": "PubMed", "id": "21483429", "url": "https://pubmed.ncbi.nlm.nih.gov/21483429" }, { "database": "PubMed", "id": "22205926", "url": "https://pubmed.ncbi.nlm.nih.gov/22205926" }, { "database": "PubMed", "id": "22911818", "url": "https://pubmed.ncbi.nlm.nih.gov/22911818" }, { "database": "PubMed", "id": "23123359", "url": "https://pubmed.ncbi.nlm.nih.gov/23123359" }, { "database": "PubMed", "id": "23704983", "url": "https://pubmed.ncbi.nlm.nih.gov/23704983" }, { "database": "PubMed", "id": "25355489", "url": "https://pubmed.ncbi.nlm.nih.gov/25355489" }, { "database": "PubMed", "id": "25511704", "url": "https://pubmed.ncbi.nlm.nih.gov/25511704" }, { "database": "PubMed", "id": "26052031", "url": "https://pubmed.ncbi.nlm.nih.gov/26052031" }, { "database": "PubMed", "id": "28582465", "url": "https://pubmed.ncbi.nlm.nih.gov/28582465" }, { "database": "PubMed", "id": "29133811", "url": "https://pubmed.ncbi.nlm.nih.gov/29133811" }, { "database": "PubMed", "id": "30414425", "url": "https://pubmed.ncbi.nlm.nih.gov/30414425" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 267, "end_pos": 267, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser267", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 351, "end_pos": 351, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P22736", "url": "https://www.uniprot.org/uniprotkb/P22736" }, { "database": "PubMed", "id": "17360704", "url": "https://pubmed.ncbi.nlm.nih.gov/17360704" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "iPTMnet", "id": "P22736", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22736" }, { "database": "PubMed", "id": "14525795", "url": "https://pubmed.ncbi.nlm.nih.gov/14525795" }, { "database": "PubMed", "id": "16434970", "url": "https://pubmed.ncbi.nlm.nih.gov/16434970" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser351", "uniprot_canonical_ac": "P22736-1" } ], "record_id": "pubmed.33235235", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoid receptor Thr524 phosphorylation by MINK1 induces interactions with 14-3-3 protein regulators.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Munier Claire C, De Maria Leonardo, Edman Karl, Gunnarsson Anders, Longo Marianna, MacKintosh Carol, Patel Saleha, Snijder Arjan, Wissler Lisa, Brunsveld Luc, Ottmann Christian, Perry Matthew W D", "reference": { "type": "PubMed", "id": "33744286", "url": "https://pubmed.ncbi.nlm.nih.gov/33744286" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 524, "end_pos": 524, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "33744286", "url": "https://pubmed.ncbi.nlm.nih.gov/33744286" } ], "site_lbl": "Thr524", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.33744286", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "UBR5 forms ligand-dependent complexes on chromatin to regulate nuclear hormone receptor stability.", "journal": "Molecular cell", "date": "2023-08-03", "authors": "Tsai Jonathan M, Aguirre Jacob D, Li Yen-Der, Brown Jared, Focht Vivian, Kater Lukas, Kempf Georg, Sandoval Brittany, Schmitt Stefan, Rutter Justine C, Galli Pius, Sandate Colby R, Cutler Jevon A, Zou Charles, Donovan Katherine A, Lumpkin Ryan J, Cavadini Simone, Park Paul M C, Sievers Quinlan, Hatton Charlie, Ener Elizabeth, Regalado Brandon D, Sperling Micah T, S\u0142abicki Miko\u0142aj, Kim Jeonghyeon, Zon Rebecca, Zhang Zinan, Miller Peter G, Belizaire Roger, Sperling Adam S, Fischer Eric S, Irizarry Rafael, Armstrong Scott A, Thom\u00e4 Nicolas H, Ebert Benjamin L", "reference": { "type": "PubMed", "id": "37478846", "url": "https://pubmed.ncbi.nlm.nih.gov/37478846" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95071-1", "protein_name": "E3 ubiquitin-protein ligase UBR5", "gene_name": "UBR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13133-1", "protein_name": "Oxysterols receptor LXR-alpha", "gene_name": "NR1H3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11473-1", "protein_name": "Vitamin D3 receptor", "gene_name": "VDR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 240, "end_pos": 240, "sequence_org": "V", "sequence_mut": "A", "comment": "Abolished ubiquitination and degradation by UBR5.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PubMed", "id": "37478846", "url": "https://pubmed.ncbi.nlm.nih.gov/37478846" } ], "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 254, "end_pos": 254, "sequence_org": "I", "sequence_mut": "A", "comment": "Reduced ubiquitination and degradation by UBR5.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PubMed", "id": "37478846", "url": "https://pubmed.ncbi.nlm.nih.gov/37478846" } ], "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 258, "end_pos": 258, "sequence_org": "I", "sequence_mut": "A", "comment": "Reduced ubiquitination and degradation by UBR5.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PubMed", "id": "37478846", "url": "https://pubmed.ncbi.nlm.nih.gov/37478846" } ], "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 280, "end_pos": 280, "sequence_org": "V", "sequence_mut": "A", "comment": "Abolished ubiquitination and degradation by UBR5.", "evidence": [ { "database": "UniProtKB", "id": "P19793", "url": "https://www.uniprot.org/uniprotkb/P19793" }, { "database": "PubMed", "id": "37478846", "url": "https://pubmed.ncbi.nlm.nih.gov/37478846" } ], "uniprot_canonical_ac": "P19793-1" }, { "start_pos": 196, "end_pos": 196, "sequence_org": "V", "sequence_mut": "K", "comment": "Abolished binding to ubiquitin, leading to strongly reduced E3 ubiquitin-protein ligase activity.", "evidence": [ { "database": "UniProtKB", "id": "O95071", "url": "https://www.uniprot.org/uniprotkb/O95071" }, { "database": "PubMed", "id": "17897937", "url": "https://pubmed.ncbi.nlm.nih.gov/17897937" }, { "database": "PubMed", "id": "37478846", "url": "https://pubmed.ncbi.nlm.nih.gov/37478846" }, { "database": "PubMed", "id": "37409633", "url": "https://pubmed.ncbi.nlm.nih.gov/37409633" }, { "database": "PubMed", "id": "37040767", "url": "https://pubmed.ncbi.nlm.nih.gov/37040767" } ], "uniprot_canonical_ac": "O95071-1" } ], "record_id": "pubmed.37478846", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Domain structure of human glucocorticoid receptor and its relationship to the v-erb-A oncogene product.", "journal": "Nature", "date": "1985", "authors": "Weinberger C, Hollenberg S M, Rosenfeld M G, Evans R M", "reference": { "type": "PubMed", "id": "3841189", "url": "https://pubmed.ncbi.nlm.nih.gov/3841189" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3841189", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Glucocorticoid Receptor: Isoforms, Functions, and Contribution to Glucocorticoid Sensitivity.", "journal": "Endocrine reviews", "date": "2024-07-12", "authors": "Lockett Jack, Inder Warrick J, Clifton Vicki L", "reference": { "type": "PubMed", "id": "38551091", "url": "https://pubmed.ncbi.nlm.nih.gov/38551091" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38551091", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential impact of prenatal PTSD symptoms and preconception trauma exposure on placental NR3C1 and FKBP5 methylation.", "journal": "Stress (Amsterdam, Netherlands)", "date": "2024-01", "authors": "Stroud Laura R, Jao Nancy C, Ward L G, Lee Sharon Y, Marsit Carmen J", "reference": { "type": "PubMed", "id": "38676353", "url": "https://pubmed.ncbi.nlm.nih.gov/38676353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38676353", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Maternal perceived stress and green spaces during pregnancy are associated with adult offspring gene (NR3C1 and IGF2/H19) methylation patterns in adulthood: A pilot study.", "journal": "Psychoneuroendocrinology", "date": "2024-09", "authors": "Vos Stijn, Van den Bergh Bea R H, Martens Dries S, Bijnens Esm\u00e9e, Shkedy Ziv, Kindermans Hanne, Platzer Matthias, Schwab Matthias, Nawrot Tim S", "reference": { "type": "PubMed", "id": "38924829", "url": "https://pubmed.ncbi.nlm.nih.gov/38924829" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01344-1", "protein_name": "Insulin-like growth factor 2", "gene_name": "IGF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38924829", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "O-GlcNAc transferase promotes immune evasion and immunotherapy resistance in uterine corpus endometrial cancer by targeting the glucocorticoid receptor.", "journal": "Journal for immunotherapy of cancer", "date": "2025-10-05", "authors": "Wang Jingjing, Xie Yang, Liu Li, Rong Shuo, Cai Huanhuan, Zeng Hao, Zhou Li, Deng Keqiong, Dai Mengqiao, Xu Chao, Zhu Ying, Lu Zhibing, Song Xuemin, Zeng Xiangtai, Liu Shi", "reference": { "type": "PubMed", "id": "41052879", "url": "https://pubmed.ncbi.nlm.nih.gov/41052879" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 132, "start_aa": "Ser", "end_pos": 132, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser132", "evidence": [ { "id": "29237092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29237092" }, { "id": "P04150", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04150" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "37340703", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37340703" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "41052879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41052879" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34846842", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P04150-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 38, "start_aa": "Thr", "end_pos": 38, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr38", "evidence": [ { "id": "29237092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29237092" }, { "id": "P04150", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04150" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "37340703", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37340703" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "41052879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41052879" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34846842", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "P04150", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04150" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P04150-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 42, "start_aa": "Ser", "end_pos": 42, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser42", "evidence": [ { "id": "29237092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29237092" }, { "id": "P04150", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04150" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "37340703", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37340703" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "41052879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41052879" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34846842", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "P04150", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04150" }, { "id": "32938750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32938750" }, { "id": "35513511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35513511" }, { "id": "35705054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35705054" }, { "id": "38838015", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38838015" }, { "id": "31373491", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31373491" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P04150-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 44, "start_aa": "Ser", "end_pos": 44, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser44", "evidence": [ { "id": "29237092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29237092" }, { "id": "P04150", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04150" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "37340703", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37340703" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "41052879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41052879" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34846842", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "P04150", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04150" }, { "id": "31373491", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31373491" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P04150-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 45, "start_aa": "Ser", "end_pos": 45, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser45", "evidence": [ { "id": "29237092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29237092" }, { "id": "P04150", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04150" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "37340703", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37340703" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "41052879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41052879" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34846842", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "P04150", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04150" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P04150-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 47, "start_aa": "Ser", "end_pos": 47, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser47", "evidence": [ { "id": "29237092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29237092" }, { "id": "P04150", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04150" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "37340703", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37340703" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "41052879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41052879" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34846842", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "P04150", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04150" }, { "id": "31373491", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31373491" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P04150-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 52, "start_aa": "Ser", "end_pos": 52, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser52", "evidence": [ { "id": "29237092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29237092" }, { "id": "P04150", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04150" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "37340703", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37340703" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "41052879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41052879" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34846842", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "P04150", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04150" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P04150-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 54, "start_aa": "Ser", "end_pos": 54, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser54", "evidence": [ { "id": "29237092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29237092" }, { "id": "P04150", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04150" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "37340703", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37340703" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "41052879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41052879" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34846842", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "P04150", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04150" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P04150-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 56, "start_aa": "Ser", "end_pos": 56, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser56", "evidence": [ { "id": "29237092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29237092" }, { "id": "P04150", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04150" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "37340703", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37340703" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "41052879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41052879" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34846842", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "P04150", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04150" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.41052879", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 9 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 9 }, { "field": "exact_o_linked_sites", "count": 9 }, { "field": "exact_o_linked_glycan_sites", "count": 9 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 9 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 9 }, { "field": "exact_o_linked_sites", "count": 9 }, { "field": "exact_o_linked_glycan_sites", "count": 9 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mutation of the glucocorticoid receptor in primary cortisol resistance.", "journal": "The Journal of clinical investigation", "date": "1993", "authors": "Malchoff DM, Brufsky A, Reardon G, McDermott P, Javier EC, Bergh CH, Rowe D, Malchoff CD", "reference": { "type": "PubMed", "id": "7683692", "url": "https://pubmed.ncbi.nlm.nih.gov/7683692" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7683692", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoid receptor beta, a potential endogenous inhibitor of glucocorticoid action in humans.", "journal": "The Journal of clinical investigation", "date": "1995-06", "authors": "Bamberger C M, Bamberger A M, de Castro M, Chrousos G P", "reference": { "type": "PubMed", "id": "7769088", "url": "https://pubmed.ncbi.nlm.nih.gov/7769088" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7769088", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hormone-induced hyperphosphorylation of specific phosphorylated sites in the mouse glucocorticoid receptor.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "1995", "authors": "Bodwell JE, Hu JM, Orti E, Munck A", "reference": { "type": "PubMed", "id": "7873448", "url": "https://pubmed.ncbi.nlm.nih.gov/7873448" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 113, "end_pos": 113, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "2019585", "url": "https://pubmed.ncbi.nlm.nih.gov/2019585" }, { "database": "PubMed", "id": "7873448", "url": "https://pubmed.ncbi.nlm.nih.gov/7873448" } ], "site_lbl": "Ser113", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "2019585", "url": "https://pubmed.ncbi.nlm.nih.gov/2019585" }, { "database": "PubMed", "id": "7873448", "url": "https://pubmed.ncbi.nlm.nih.gov/7873448" } ], "site_lbl": "Ser141", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.7873448", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the activation-labile gene: a single point mutation in the human glucocorticoid receptor presents as two distinct receptor phenotypes.", "journal": "Mol. Endocrinol.", "date": "1993", "authors": "Ashraf J, Thompson E B", "reference": { "type": "PubMed", "id": "8316249", "url": "https://pubmed.ncbi.nlm.nih.gov/8316249" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8316249", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alternatively spliced glucocorticoid receptor messenger RNAs in glucocorticoid-resistant human multiple myeloma cells.", "journal": "Cancer Res.", "date": "1993", "authors": "Moalli P A, Pillay S, Krett N L, Rosen S T", "reference": { "type": "PubMed", "id": "8358712", "url": "https://pubmed.ncbi.nlm.nih.gov/8358712" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8358712", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and expression of mutant glucocorticoid receptors from glucocorticoid-sensitive and -resistant human leukemic cells.", "journal": "Cancer Res.", "date": "1993", "authors": "Powers J H, Hillmann A G, Tang D C, Harmon J M", "reference": { "type": "PubMed", "id": "8358735", "url": "https://pubmed.ncbi.nlm.nih.gov/8358735" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8358735", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Familial glucocorticoid resistance caused by a splice site deletion in the human glucocorticoid receptor gene.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1993", "authors": "Karl M, Lamberts SW, Detera-Wadleigh SD, Encio IJ, Stratakis CA, Hurley DM, Accili D, Chrousos GP", "reference": { "type": "PubMed", "id": "8445027", "url": "https://pubmed.ncbi.nlm.nih.gov/8445027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs104893909", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs104893909" }, { "id": "rs104893909", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs104893909" }, { "id": "11701741", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11701741" }, { "id": "8445027", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8445027" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 559, "end_pos": 559, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 filters: n-glyco-sequon-gain (IMT->NMT).", "chr_id": "5", "chr_pos": "143300556", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I559", "keywords": [ "ebi", "germline" ], "filter_code": "000000000100000000000.00000000000000.000000000001000000.00001.10.000.100", "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.8445027", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human glucocorticoid receptor beta isoform. Expression, biochemical properties, and putative function.", "journal": "The Journal of biological chemistry", "date": "1996-04-19", "authors": "Oakley R H, Sar M, Cidlowski J A", "reference": { "type": "PubMed", "id": "8621628", "url": "https://pubmed.ncbi.nlm.nih.gov/8621628" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8621628", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence-specific DNA binding and transcription factor phosphorylation by Ku Autoantigen/DNA-dependent protein kinase. Phosphorylation of Ser-527 of the rat glucocorticoid receptor.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Giffin W, Kwast-Welfeld J, Rodda DJ, Prefontaine GG, Traykova-Andonova M, Zhang Y, Weigel NL, Lefebvre YA, Hache RJ", "reference": { "type": "PubMed", "id": "9038175", "url": "https://pubmed.ncbi.nlm.nih.gov/9038175" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06536-1", "protein_name": "Glucocorticoid receptor", "gene_name": "Nr3c1", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 508, "end_pos": 508, "kinase_uniprot_canonical_ac": "P78527-1", "kinase_gene_name": "PRKDC", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "9038175", "url": "https://pubmed.ncbi.nlm.nih.gov/9038175" } ], "site_lbl": "Ser508", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 508, "end_pos": 508, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "9038175", "url": "https://pubmed.ncbi.nlm.nih.gov/9038175" } ], "site_lbl": "Ser508", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 527, "end_pos": 527, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06536", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06536" }, { "database": "PubMed", "id": "9038175", "url": "https://pubmed.ncbi.nlm.nih.gov/9038175" } ], "site_lbl": "Ser527", "uniprot_canonical_ac": "P06536-1" } ], "record_id": "pubmed.9038175", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lack of association between five polymorphisms in the human glucocorticoid receptor gene and glucocorticoid resistance.", "journal": "Human genetics", "date": "1997", "authors": "Koper JW, Stolk RP, de Lange P, Huizenga NA, Molijn GJ, Pols HA, Grobbee DE, Karl M, de Jong FH, Brinkmann AO, Lamberts SW", "reference": { "type": "PubMed", "id": "9150737", "url": "https://pubmed.ncbi.nlm.nih.gov/9150737" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9150737", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of the Ada adaptor complex in gene activation by the glucocorticoid receptor.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Henriksson A, Almlof T, Ford J, McEwan IJ, Gustafsson JA, Wright AP", "reference": { "type": "PubMed", "id": "9154805", "url": "https://pubmed.ncbi.nlm.nih.gov/9154805" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75478-1", "protein_name": "Transcriptional adapter 2-alpha", "gene_name": "TADA2A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 191, "end_pos": 191, "sequence_org": "F", "sequence_mut": "D", "comment": "Reduces transactivation by the ADA complex.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "9154805", "url": "https://pubmed.ncbi.nlm.nih.gov/9154805" } ], "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 193, "end_pos": 193, "sequence_org": "I", "sequence_mut": "D", "comment": "Reduces transactivation by the ADA complex.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "9154805", "url": "https://pubmed.ncbi.nlm.nih.gov/9154805" } ], "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 194, "end_pos": 194, "sequence_org": "L", "sequence_mut": "A", "comment": "Strongly reduces transactivation by the ADA complex; when associated with V-224 and F-225.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "9154805", "url": "https://pubmed.ncbi.nlm.nih.gov/9154805" } ], "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 197, "end_pos": 197, "sequence_org": "L", "sequence_mut": "E", "comment": "Reduces transactivation by the ADA complex.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "9154805", "url": "https://pubmed.ncbi.nlm.nih.gov/9154805" } ], "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 213, "end_pos": 213, "sequence_org": "W", "sequence_mut": "A", "comment": "Strongly reduces transactivation by the ADA complex.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "9154805", "url": "https://pubmed.ncbi.nlm.nih.gov/9154805" } ], "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 224, "end_pos": 224, "sequence_org": "L", "sequence_mut": "V", "comment": "Strongly reduces transactivation by the ADA complex; when associated with A-194 and F-225.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "9154805", "url": "https://pubmed.ncbi.nlm.nih.gov/9154805" } ], "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 225, "end_pos": 225, "sequence_org": "L", "sequence_mut": "F", "comment": "Strongly reduces transactivation by the ADA complex; when associated with A-194 and V-224.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "9154805", "url": "https://pubmed.ncbi.nlm.nih.gov/9154805" } ], "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 235, "end_pos": 235, "sequence_org": "F", "sequence_mut": "L", "comment": "Strongly reduces transactivation by the ADA complex; when associated with V-236.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "9154805", "url": "https://pubmed.ncbi.nlm.nih.gov/9154805" } ], "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 236, "end_pos": 236, "sequence_org": "L", "sequence_mut": "V", "comment": "Strongly reduces transactivation by the ADA complex; when associated with L-235.", "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" }, { "database": "PubMed", "id": "9154805", "url": "https://pubmed.ncbi.nlm.nih.gov/9154805" } ], "uniprot_canonical_ac": "P04150-1" } ], "record_id": "pubmed.9154805", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitogen-activated and cyclin-dependent protein kinases selectively and differentially modulate transcriptional enhancement by the glucocorticoid receptor.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Krstic MD, Rogatsky I, Yamamoto KR, Garabedian MJ", "reference": { "type": "PubMed", "id": "9199329", "url": "https://pubmed.ncbi.nlm.nih.gov/9199329" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06536-1", "protein_name": "Glucocorticoid receptor", "gene_name": "Nr3c1", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "9199329", "url": "https://pubmed.ncbi.nlm.nih.gov/9199329" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04150", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04150" }, { "database": "PubMed", "id": "12351702", "url": "https://pubmed.ncbi.nlm.nih.gov/12351702" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "9199329", "url": "https://pubmed.ncbi.nlm.nih.gov/9199329" }, { "database": "PubMed", "id": "18337589", "url": "https://pubmed.ncbi.nlm.nih.gov/18337589" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P04150-1" }, { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P06536", "url": "https://www.uniprot.org/uniprotkb/P06536" }, { "database": "PubMed", "id": "9603939", "url": "https://pubmed.ncbi.nlm.nih.gov/9603939" }, { "database": "iPTMnet", "id": "P06536", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06536" }, { "database": "PubMed", "id": "9199329", "url": "https://pubmed.ncbi.nlm.nih.gov/9199329" } ], "site_lbl": "Thr171", "uniprot_canonical_ac": "P06536-1" }, { "start_pos": 246, "end_pos": 246, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06536", "url": "https://www.uniprot.org/uniprotkb/P06536" }, { "database": "PubMed", "id": "9603939", "url": "https://pubmed.ncbi.nlm.nih.gov/9603939" }, { "database": "iPTMnet", "id": "P06536", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06536" }, { "database": "PubMed", "id": "19406955", "url": "https://pubmed.ncbi.nlm.nih.gov/19406955" }, { "database": "PubMed", "id": "27387895", "url": "https://pubmed.ncbi.nlm.nih.gov/27387895" }, { "database": "PubMed", "id": "9199329", "url": "https://pubmed.ncbi.nlm.nih.gov/9199329" } ], "site_lbl": "Ser246", "uniprot_canonical_ac": "P06536-1" } ], "record_id": "pubmed.9199329", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The glucocorticoid receptor is associated with the RNA-binding nuclear matrix protein hnRNP U.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Eggert M, Michel J, Schneider S, Bornfleth H, Baniahmad A, Fackelmayer F O, Schmidt S, Renkawitz R", "reference": { "type": "PubMed", "id": "9353307", "url": "https://pubmed.ncbi.nlm.nih.gov/9353307" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00839-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein U", "gene_name": "HNRNPU", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04150", "url": "https://www.uniprot.org/uniprotkb/P04150" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9353307", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication.", "journal": "J. Virol.", "date": "2010", "authors": "Ao Zhujun, Danappa Jayappa Kallesh, Wang Binchen, Zheng Yingfeng, Kung Sam, Rassart Eric, Depping Reinhard, Kohler Matthias, Cohen Eric A, Yao Xiaojian", "reference": { "type": "PubMed", "id": "20554775", "url": "https://pubmed.ncbi.nlm.nih.gov/20554775" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00505-1", "protein_name": "Importin subunit alpha-4", "gene_name": "KPNA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00505", "url": "https://www.uniprot.org/uniprotkb/O00505" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20554775", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dominant KPNA3 Mutations Cause Infantile-Onset Hereditary Spastic Paraplegia.", "journal": "Annals of neurology", "date": "2021", "authors": "Schob C, Hempel M, Safka Brozkova D, Jiang H, Kim SY, Batzir NA, Orenstein N, Bierhals T, Johannsen J, Uhrova Meszarosova A, Chae JH, Seeman P, Woidy M, Fang F, Kubisch C, Kindler S, Denecke J", "reference": { "type": "PubMed", "id": "34564892", "url": "https://pubmed.ncbi.nlm.nih.gov/34564892" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00505-1", "protein_name": "Importin subunit alpha-4", "gene_name": "KPNA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR30-1", "protein_name": "Nucleolar RNA helicase 2", "gene_name": "DDX21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18754-1", "protein_name": "Regulator of chromosome condensation", "gene_name": "RCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52298-1", "protein_name": "Nuclear cap-binding protein subunit 2", "gene_name": "NCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09161-1", "protein_name": "Nuclear cap-binding protein subunit 1", "gene_name": "NCBP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00505", "url": "https://www.uniprot.org/uniprotkb/O00505" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34564892", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heterozygous De Novo KPNA3 Mutations Cause Complex Hereditary Spastic Paraplegia.", "journal": "Annals of neurology", "date": "2022-05", "authors": "Estiar Mehrdad A, Lail Noor, Dyment David A, Varghaei Parizad, Hartley Taila, Gillespie Meredith K, Yoon Grace, Boycott Kym M, Rouleau Guy A, Gan-Or Ziv", "reference": { "type": "PubMed", "id": "34825409", "url": "https://pubmed.ncbi.nlm.nih.gov/34825409" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00505-1", "protein_name": "Importin subunit alpha-4", "gene_name": "KPNA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00505", "url": "https://www.uniprot.org/uniprotkb/O00505" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34825409", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Recurrent KPNA3 Missense Variant Causing Infantile Pure Spastic Paraplegia.", "journal": "Annals of neurology", "date": "2022-02", "authors": "De Winter Jonathan, Van de Vondel Liedewei, Z\u00fcchner Stephan, Ortibus Els, Baets Jonathan", "reference": { "type": "PubMed", "id": "34981581", "url": "https://pubmed.ncbi.nlm.nih.gov/34981581" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00505-1", "protein_name": "Importin subunit alpha-4", "gene_name": "KPNA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00505", "url": "https://www.uniprot.org/uniprotkb/O00505" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34981581", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "\ufeff\ufeffKPNA3 promotes epithelial-mesenchymal transition by regulating TGF-\u03b2 and AKT signaling pathways in MDA-MB-231, a triple-negative breast cancer cell line.", "journal": "BMB reports", "date": "2023-01-03", "authors": "Choi Jaesung, Choi Jee-Hye, Lee Ho Woon, Seo Dongbeom, Lkhagvasuren Gavaachimed, Kim Jung-Woong, Seo Sang-Beom, Lee Kangseok, Lee Kwang-Ho", "reference": { "type": "PubMed", "id": "36593106", "url": "https://pubmed.ncbi.nlm.nih.gov/36593106" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00505-1", "protein_name": "Importin subunit alpha-4", "gene_name": "KPNA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00505", "url": "https://www.uniprot.org/uniprotkb/O00505" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36593106", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The RNA-binding protein ZC3H11A interacts with the nuclear poly(A)-binding protein PABPN1 and alters polyadenylation of viral transcripts.", "journal": "J. Biol. Chem.", "date": "2023", "authors": "Kases Katharina, Schubert Erik, Hajikhezri Zamaneh, Larsson M\u00e5rten, Devi Priya, Darweesh Mahmoud, Andersson Leif, Akusj\u00e4rvi G\u00f6ran, Punga Tanel, Younis Shady", "reference": { "type": "PubMed", "id": "37356722", "url": "https://pubmed.ncbi.nlm.nih.gov/37356722" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00505-1", "protein_name": "Importin subunit alpha-4", "gene_name": "KPNA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8CCS6-1", "protein_name": "Polyadenylate-binding protein 2", "gene_name": "Pabpn1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O75152-1", "protein_name": "Zinc finger CCCH domain-containing protein 11A", "gene_name": "ZC3H11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86U42-1", "protein_name": "Polyadenylate-binding protein 2", "gene_name": "PABPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NZF1-1", "protein_name": "Zinc finger CCCH domain-containing protein 11A", "gene_name": "Zc3h11a", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00505", "url": "https://www.uniprot.org/uniprotkb/O00505" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 286, "end_pos": 301, "sequence_org": "KRKFSAGGDSDPPLKR", "sequence_mut": "AAAFSAGGDSDPPLAA", "comment": "No effect on nuclear localization. Loss of nuclear localization; when associated with 661-V--K-699 del.", "evidence": [ { "database": "UniProtKB", "id": "O75152", "url": "https://www.uniprot.org/uniprotkb/O75152" }, { "database": "PubMed", "id": "37356722", "url": "https://pubmed.ncbi.nlm.nih.gov/37356722" } ], "uniprot_canonical_ac": "O75152-1" }, { "start_pos": 37, "end_pos": 37, "sequence_org": "C", "sequence_mut": "A", "comment": "Reduced interaction with PABPN1, decreased localization to nuclear speckles and reduced binding to viral transcripts. Loss of interaction with PABPN1, loss of localization to nuclear speckles and reduced binding to viral transcripts; when associated with A-8 and A-66.", "evidence": [ { "database": "UniProtKB", "id": "O75152", "url": "https://www.uniprot.org/uniprotkb/O75152" }, { "database": "PubMed", "id": "37356722", "url": "https://pubmed.ncbi.nlm.nih.gov/37356722" } ], "uniprot_canonical_ac": "O75152-1" }, { "start_pos": 661, "end_pos": 699, "sequence_org": "VSSPKLAPKRKAVEMHAAVIAAVKPLSSSSVLQEPPAKK", "sequence_mut": "", "comment": "No effect on nuclear localization. Loss of nuclear localization; when associated with 286-A--A-301.", "evidence": [ { "database": "UniProtKB", "id": "O75152", "url": "https://www.uniprot.org/uniprotkb/O75152" }, { "database": "PubMed", "id": "37356722", "url": "https://pubmed.ncbi.nlm.nih.gov/37356722" } ], "uniprot_canonical_ac": "O75152-1" }, { "start_pos": 66, "end_pos": 66, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of interaction with PABPN1, loss of localization to nuclear speckles and reduced binding to viral transcripts. Loss of interaction with PABPN1, loss of localization to nuclear speckles and reduced binding to viral transcripts; when associated with A-8 and A-37.", "evidence": [ { "database": "UniProtKB", "id": "O75152", "url": "https://www.uniprot.org/uniprotkb/O75152" }, { "database": "PubMed", "id": "37356722", "url": "https://pubmed.ncbi.nlm.nih.gov/37356722" } ], "uniprot_canonical_ac": "O75152-1" }, { "start_pos": 8, "end_pos": 8, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of interaction with PABPN1, loss of localization to nuclear speckles and strong reduction in the binding to viral transcripts. Loss of interaction with PABPN1, loss of localization to nuclear speckles and reduced binding to viral transcripts; when associated with A-37 and A-66.", "evidence": [ { "database": "UniProtKB", "id": "O75152", "url": "https://www.uniprot.org/uniprotkb/O75152" }, { "database": "PubMed", "id": "37356722", "url": "https://pubmed.ncbi.nlm.nih.gov/37356722" } ], "uniprot_canonical_ac": "O75152-1" } ], "record_id": "pubmed.37356722", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]