[ { "title": "Role of SYT11 in human pan-cancer using comprehensive approaches.", "journal": "European journal of medical research", "date": "2024-06-18", "authors": "Noh Kyunghee, Choi Hyunji, Jo Eun-Hye, Yoo Wonbeak, Park Kyung Chan", "reference": { "type": "PubMed", "id": "38890718", "url": "https://pubmed.ncbi.nlm.nih.gov/38890718" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT88-1", "protein_name": "Synaptotagmin-11", "gene_name": "SYT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT88", "url": "https://www.uniprot.org/uniprotkb/Q9BT88" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38890718", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gene trapping identifies a putative tumor suppressor and a new inducer of cell migration.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Guardiola-Serrano F, Haendeler J, Lukosz M, Sturm K, Melchner Hv, Altschmied J", "reference": { "type": "PubMed", "id": "18814840", "url": "https://pubmed.ncbi.nlm.nih.gov/18814840" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96K80-1", "protein_name": "Zinc finger CCCH domain-containing protein 10", "gene_name": "ZC3H10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TE85-1", "protein_name": "Grainyhead-like protein 3 homolog", "gene_name": "GRHL3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96K80", "url": "https://www.uniprot.org/uniprotkb/Q96K80" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18814840", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Compendium of RNA-Binding Proteins that Regulate MicroRNA Biogenesis.", "journal": "Molecular cell", "date": "2017", "authors": "Treiber T, Treiber N, Plessmann U, Harlander S, Daiss JL, Eichner N, Lehmann G, Schall K, Urlaub H, Meister G", "reference": { "type": "PubMed", "id": "28431233", "url": "https://pubmed.ncbi.nlm.nih.gov/28431233" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96K80-1", "protein_name": "Zinc finger CCCH domain-containing protein 10", "gene_name": "ZC3H10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR30-1", "protein_name": "Nucleolar RNA helicase 2", "gene_name": "DDX21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Q1W2-1", "protein_name": "E3 ubiquitin-protein ligase TRIM71", "gene_name": "TRIM71", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09651-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein A1", "gene_name": "HNRNPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95319-1", "protein_name": "CUGBP Elav-like family member 2", "gene_name": "CELF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92879-1", "protein_name": "CUGBP Elav-like family member 1", "gene_name": "CELF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T280-1", "protein_name": "28S rRNA (uridine-N(3))-methyltransferase", "gene_name": "SPOUT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98175-1", "protein_name": "RNA-binding protein 10", "gene_name": "RBM10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWR0-1", "protein_name": "Zinc finger CCCH domain-containing protein 7A", "gene_name": "ZC3H7A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGR2-1", "protein_name": "Zinc finger CCCH domain-containing protein 7B", "gene_name": "ZC3H7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14671-1", "protein_name": "Pumilio homolog 1", "gene_name": "PUM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43243-1", "protein_name": "Matrin-3", "gene_name": "MATR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TB72-1", "protein_name": "Pumilio homolog 2", "gene_name": "PUM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL40-1", "protein_name": "Zinc finger protein 346", "gene_name": "ZNF346", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96K80", "url": "https://www.uniprot.org/uniprotkb/Q96K80" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 148, "end_pos": 154, "sequence_org": "CQRGAKC", "sequence_mut": "SQRGAKS", "comment": "Reduces binding to pri-MIR143.", "evidence": [ { "database": "UniProtKB", "id": "Q96K80", "url": "https://www.uniprot.org/uniprotkb/Q96K80" }, { "database": "PubMed", "id": "28431233", "url": "https://pubmed.ncbi.nlm.nih.gov/28431233" } ], "uniprot_canonical_ac": "Q96K80-1" }, { "start_pos": 50, "end_pos": 56, "sequence_org": "CKRGKRC", "sequence_mut": "SKRGKRS", "comment": "Abolishes binding to pri-MIR143.", "evidence": [ { "database": "UniProtKB", "id": "Q96K80", "url": "https://www.uniprot.org/uniprotkb/Q96K80" }, { "database": "PubMed", "id": "28431233", "url": "https://pubmed.ncbi.nlm.nih.gov/28431233" } ], "uniprot_canonical_ac": "Q96K80-1" }, { "start_pos": 87, "end_pos": 92, "sequence_org": "CSRPNC", "sequence_mut": "SSRPNS", "comment": "Abolishes binding to pri-MIR143.", "evidence": [ { "database": "UniProtKB", "id": "Q96K80", "url": "https://www.uniprot.org/uniprotkb/Q96K80" }, { "database": "PubMed", "id": "28431233", "url": "https://pubmed.ncbi.nlm.nih.gov/28431233" } ], "uniprot_canonical_ac": "Q96K80-1" } ], "record_id": "pubmed.28431233", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zc3h10 is a novel mitochondrial regulator.", "journal": "EMBO reports", "date": "2018", "authors": "Audano M, Pedretti S, Cermenati G, Brioschi E, Diaferia GR, Ghisletti S, Cuomo A, Bonaldi T, Salerno F, Mora M, Grigore L, Garlaschelli K, Baragetti A, Bonacina F, Catapano AL, Norata GD, Crestani M, Caruso D, Saez E, De Fabiani E, Mitro N", "reference": { "type": "PubMed", "id": "29507079", "url": "https://pubmed.ncbi.nlm.nih.gov/29507079" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96K80-1", "protein_name": "Zinc finger CCCH domain-containing protein 10", "gene_name": "ZC3H10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8R205-1", "protein_name": "Zinc finger CCCH domain-containing protein 10", "gene_name": "Zc3h10", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96K80", "url": "https://www.uniprot.org/uniprotkb/Q96K80" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29507079", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zc3h10 Acts as a Transcription Factor and Is Phosphorylated to Activate the Thermogenic Program.", "journal": "Cell reports", "date": "2019", "authors": "Yi D, Dempersmier JM, Nguyen HP, Viscarra JA, Dinh J, Tabuchi C, Wang Y, Sul HS", "reference": { "type": "PubMed", "id": "31775033", "url": "https://pubmed.ncbi.nlm.nih.gov/31775033" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96K80-1", "protein_name": "Zinc finger CCCH domain-containing protein 10", "gene_name": "ZC3H10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8R205-1", "protein_name": "Zinc finger CCCH domain-containing protein 10", "gene_name": "Zc3h10", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96K80", "url": "https://www.uniprot.org/uniprotkb/Q96K80" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 126, "end_pos": 126, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8R205", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8R205" }, { "database": "PubMed", "id": "31775033", "url": "https://pubmed.ncbi.nlm.nih.gov/31775033" } ], "site_lbl": "Ser126", "uniprot_canonical_ac": "Q8R205-1" } ], "record_id": "pubmed.31775033", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A HOTAIR regulatory element modulates glioma cell sensitivity to temozolomide through long-range regulation of multiple target genes.", "journal": "Genome research", "date": "2020", "authors": "Zhang L, He A, Chen B, Bi J, Chen J, Guo D, Qian Y, Wang W, Shi T, Zhao Z, Shi J, An W, Attenello F, Lu W", "reference": { "type": "PubMed", "id": "31953347", "url": "https://pubmed.ncbi.nlm.nih.gov/31953347" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96K80-1", "protein_name": "Zinc finger CCCH domain-containing protein 10", "gene_name": "ZC3H10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96K80", "url": "https://www.uniprot.org/uniprotkb/Q96K80" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31953347", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ERO1-L, a human protein that favors disulfide bond formation in the endoplasmic reticulum.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cabibbo A, Pagani M, Fabbri M, Rocchi M, Farmery MR, Bulleid NJ, Sitia R", "reference": { "type": "PubMed", "id": "10671517", "url": "https://pubmed.ncbi.nlm.nih.gov/10671517" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9V3A6-1", "protein_name": "Ero1-like protein", "gene_name": "Ero1L", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8R180-1", "protein_name": "ERO1-like protein alpha", "gene_name": "Ero1a", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 391, "end_pos": 391, "sequence_org": "C", "sequence_mut": "A", "comment": "Alters protein folding. Prevents formation of regulatory disulfide bond and down-regulation of activity. Decreases association with P4HB.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "10671517", "url": "https://pubmed.ncbi.nlm.nih.gov/10671517" }, { "database": "PubMed", "id": "10970843", "url": "https://pubmed.ncbi.nlm.nih.gov/10970843" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 394, "end_pos": 394, "sequence_org": "C", "sequence_mut": "A", "comment": "Retains activity towards P4HB. Does not act as a dominant negative mutant. Induces defects in folding. Remains associated with P4HB.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "11707400", "url": "https://pubmed.ncbi.nlm.nih.gov/11707400" }, { "database": "PubMed", "id": "10671517", "url": "https://pubmed.ncbi.nlm.nih.gov/10671517" }, { "database": "PubMed", "id": "18833192", "url": "https://pubmed.ncbi.nlm.nih.gov/18833192" }, { "database": "PubMed", "id": "10970843", "url": "https://pubmed.ncbi.nlm.nih.gov/10970843" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" } ], "record_id": "pubmed.10671517", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Endoplasmic reticulum oxidoreductin 1-lbeta (ERO1-Lbeta), a human gene induced in the course of the unfolded protein response.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Pagani M, Fabbri M, Benedetti C, Fassio A, Pilati S, Bulleid NJ, Cabibbo A, Sitia R", "reference": { "type": "PubMed", "id": "10818100", "url": "https://pubmed.ncbi.nlm.nih.gov/10818100" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YB8-1", "protein_name": "ERO1-like protein beta", "gene_name": "ERO1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10818100", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The CXXCXXC motif determines the folding, structure and stability of human Ero1-Lalpha.", "journal": "The EMBO journal", "date": "2000", "authors": "Benham AM, Cabibbo A, Fassio A, Bulleid N, Sitia R, Braakman I", "reference": { "type": "PubMed", "id": "10970843", "url": "https://pubmed.ncbi.nlm.nih.gov/10970843" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 391, "end_pos": 391, "sequence_org": "C", "sequence_mut": "A", "comment": "Alters protein folding. Prevents formation of regulatory disulfide bond and down-regulation of activity. Decreases association with P4HB.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "10671517", "url": "https://pubmed.ncbi.nlm.nih.gov/10671517" }, { "database": "PubMed", "id": "10970843", "url": "https://pubmed.ncbi.nlm.nih.gov/10970843" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 394, "end_pos": 394, "sequence_org": "C", "sequence_mut": "A", "comment": "Retains activity towards P4HB. Does not act as a dominant negative mutant. Induces defects in folding. Remains associated with P4HB.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "11707400", "url": "https://pubmed.ncbi.nlm.nih.gov/11707400" }, { "database": "PubMed", "id": "10671517", "url": "https://pubmed.ncbi.nlm.nih.gov/10671517" }, { "database": "PubMed", "id": "18833192", "url": "https://pubmed.ncbi.nlm.nih.gov/18833192" }, { "database": "PubMed", "id": "10970843", "url": "https://pubmed.ncbi.nlm.nih.gov/10970843" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 397, "end_pos": 397, "sequence_org": "C", "sequence_mut": "A", "comment": "Acts as a dominant negative mutant; does not induce defects in folding; remains associated with P4HB.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "11707400", "url": "https://pubmed.ncbi.nlm.nih.gov/11707400" }, { "database": "PubMed", "id": "10970843", "url": "https://pubmed.ncbi.nlm.nih.gov/10970843" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" } ], "record_id": "pubmed.10970843", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The C-terminal domain of yeast Ero1p mediates membrane localization and is essential for function.", "journal": "FEBS Lett.", "date": "2001", "authors": "Pagani M, Pilati S, Bertoli G, Valsasina B, Sitia R", "reference": { "type": "PubMed", "id": "11707280", "url": "https://pubmed.ncbi.nlm.nih.gov/11707280" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03103-1", "protein_name": "Endoplasmic oxidoreductin-1", "gene_name": "ERO1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11707280", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Manipulation of oxidative protein folding and PDI redox state in mammalian cells.", "journal": "The EMBO journal", "date": "2001", "authors": "Mezghrani A, Fassio A, Benham A, Simmen T, Braakman I, Sitia R", "reference": { "type": "PubMed", "id": "11707400", "url": "https://pubmed.ncbi.nlm.nih.gov/11707400" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00471-1", "protein_name": "Exocyst complex component 5", "gene_name": "EXOC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07237-1", "protein_name": "Protein disulfide-isomerase", "gene_name": "P4HB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YB8-1", "protein_name": "ERO1-like protein beta", "gene_name": "ERO1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KP1-1", "protein_name": "Exocyst complex component 2", "gene_name": "EXOC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51159-1", "protein_name": "Ras-related protein Rab-27A", "gene_name": "RAB27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63027-1", "protein_name": "Vesicle-associated membrane protein 2", "gene_name": "VAMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60282-1", "protein_name": "Kinesin heavy chain isoform 5C", "gene_name": "KIF5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFW9-1", "protein_name": "Rab effector MyRIP", "gene_name": "MYRIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWU4-1", "protein_name": "Proton-coupled zinc antiporter SLC30A8", "gene_name": "SLC30A8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAD4-1", "protein_name": "Proton-coupled zinc antiporter SLC30A5", "gene_name": "SLC30A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYI6-1", "protein_name": "Exocyst complex component 8", "gene_name": "EXOC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A65-1", "protein_name": "Exocyst complex component 4", "gene_name": "EXOC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4I1-1", "protein_name": "Unconventional myosin-Va", "gene_name": "MYO5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBJ8-1", "protein_name": "Collectrin", "gene_name": "CLTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16519-1", "protein_name": "Neuroendocrine convertase 2", "gene_name": "PCSK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16623-1", "protein_name": "Syntaxin-1A", "gene_name": "STX1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16870-1", "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60645-1", "protein_name": "Exocyst complex component 3", "gene_name": "EXOC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPT5-3", "protein_name": "Exocyst complex component 7", "gene_name": "EXOC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NV70-1", "protein_name": "Exocyst complex component 1", "gene_name": "EXOC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAG9-1", "protein_name": "Exocyst complex component 6", "gene_name": "EXOC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29120-1", "protein_name": "Neuroendocrine convertase 1", "gene_name": "PCSK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 394, "end_pos": 394, "sequence_org": "C", "sequence_mut": "A", "comment": "Retains activity towards P4HB. Does not act as a dominant negative mutant. Induces defects in folding. Remains associated with P4HB.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "11707400", "url": "https://pubmed.ncbi.nlm.nih.gov/11707400" }, { "database": "PubMed", "id": "10671517", "url": "https://pubmed.ncbi.nlm.nih.gov/10671517" }, { "database": "PubMed", "id": "18833192", "url": "https://pubmed.ncbi.nlm.nih.gov/18833192" }, { "database": "PubMed", "id": "10970843", "url": "https://pubmed.ncbi.nlm.nih.gov/10970843" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 397, "end_pos": 397, "sequence_org": "C", "sequence_mut": "A", "comment": "Acts as a dominant negative mutant; does not induce defects in folding; remains associated with P4HB.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "11707400", "url": "https://pubmed.ncbi.nlm.nih.gov/11707400" }, { "database": "PubMed", "id": "10970843", "url": "https://pubmed.ncbi.nlm.nih.gov/10970843" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" } ], "record_id": "pubmed.11707400", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ERp44, a novel endoplasmic reticulum folding assistant of the thioredoxin family.", "journal": "EMBO J.", "date": "2002", "authors": "Anelli T, Alessio M, Mezghrani A, Simmen T, Talamo F, Bachi A, Sitia R", "reference": { "type": "PubMed", "id": "11847130", "url": "https://pubmed.ncbi.nlm.nih.gov/11847130" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YB8-1", "protein_name": "ERO1-like protein beta", "gene_name": "ERO1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BS26-1", "protein_name": "Endoplasmic reticulum resident protein 44", "gene_name": "ERP44", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11847130", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Unfolded cholera toxin is transferred to the ER membrane and released from protein disulfide isomerase upon oxidation by Ero1.", "journal": "The Journal of cell biology", "date": "2002-10-28", "authors": "Tsai Billy, Rapoport Tom A", "reference": { "type": "PubMed", "id": "12403808", "url": "https://pubmed.ncbi.nlm.nih.gov/12403808" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12403808", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The cellular oxygen tension regulates expression of the endoplasmic oxidoreductase ERO1-Lalpha.", "journal": "Eur. J. Biochem.", "date": "2003", "authors": "Gess B, Hofbauer KH, Wenger RH, Lohaus C, Meyer HE, Kurtz A", "reference": { "type": "PubMed", "id": "12752442", "url": "https://pubmed.ncbi.nlm.nih.gov/12752442" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8R4A1-1", "protein_name": "ERO1-like protein alpha", "gene_name": "Ero1a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q86YB8-1", "protein_name": "ERO1-like protein beta", "gene_name": "ERO1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8R180-1", "protein_name": "ERO1-like protein alpha", "gene_name": "Ero1a", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12752442", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Thiol-mediated protein retention in the endoplasmic reticulum: the role of ERp44.", "journal": "EMBO J.", "date": "2003", "authors": "Anelli T, Alessio M, Bachi A, Bergamelli L, Bertoli G, Camerini S, Mezghrani A, Ruffato E, Simmen T, Sitia R", "reference": { "type": "PubMed", "id": "14517240", "url": "https://pubmed.ncbi.nlm.nih.gov/14517240" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BS26-1", "protein_name": "Endoplasmic reticulum resident protein 44", "gene_name": "ERP44", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14517240", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two conserved cysteine triads in human Ero1alpha cooperate for efficient disulfide bond formation in the endoplasmic reticulum.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Bertoli G, Simmen T, Anelli T, Molteni SN, Fesce R, Sitia R", "reference": { "type": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 104, "end_pos": 104, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect. Strongly increased activity towards P4HB and UPR induction, but no broad oxidative injury; when associated with A-131.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" }, { "database": "PubMed", "id": "23027870", "url": "https://pubmed.ncbi.nlm.nih.gov/23027870" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 104, "end_pos": 104, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" }, { "database": "PubMed", "id": "23027870", "url": "https://pubmed.ncbi.nlm.nih.gov/23027870" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 131, "end_pos": 131, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of regulatory disulfide bond formation and increased activity towards P4HB. Loss of regulatory disulfide bond formation and strongly increased activity towards P4HB; when associated with A-85. Loss of regulatory disulfide bond formation, strongly increased activity towards P4HB and UPR induction, but no broad oxidative injury; when associated with A-104.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18833192", "url": "https://pubmed.ncbi.nlm.nih.gov/18833192" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" }, { "database": "PubMed", "id": "23027870", "url": "https://pubmed.ncbi.nlm.nih.gov/23027870" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 166, "end_pos": 166, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 208, "end_pos": 208, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 208, "end_pos": 208, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 241, "end_pos": 241, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 241, "end_pos": 241, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 280, "end_pos": 280, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect on activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 384, "end_pos": 384, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect on activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 391, "end_pos": 391, "sequence_org": "C", "sequence_mut": "A", "comment": "Alters protein folding. Prevents formation of regulatory disulfide bond and down-regulation of activity. Decreases association with P4HB.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "10671517", "url": "https://pubmed.ncbi.nlm.nih.gov/10671517" }, { "database": "PubMed", "id": "10970843", "url": "https://pubmed.ncbi.nlm.nih.gov/10970843" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 394, "end_pos": 394, "sequence_org": "C", "sequence_mut": "A", "comment": "Retains activity towards P4HB. Does not act as a dominant negative mutant. Induces defects in folding. Remains associated with P4HB.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "11707400", "url": "https://pubmed.ncbi.nlm.nih.gov/11707400" }, { "database": "PubMed", "id": "10671517", "url": "https://pubmed.ncbi.nlm.nih.gov/10671517" }, { "database": "PubMed", "id": "18833192", "url": "https://pubmed.ncbi.nlm.nih.gov/18833192" }, { "database": "PubMed", "id": "10970843", "url": "https://pubmed.ncbi.nlm.nih.gov/10970843" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 397, "end_pos": 397, "sequence_org": "C", "sequence_mut": "A", "comment": "Acts as a dominant negative mutant; does not induce defects in folding; remains associated with P4HB.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "11707400", "url": "https://pubmed.ncbi.nlm.nih.gov/11707400" }, { "database": "PubMed", "id": "10970843", "url": "https://pubmed.ncbi.nlm.nih.gov/10970843" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 85, "end_pos": 85, "sequence_org": "C", "sequence_mut": "A", "comment": "Alters protein folding and stability. Loss of regulatory disulfide bond formation and increased activity towards P4HB; when associated with A-131.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 85, "end_pos": 85, "sequence_org": "C", "sequence_mut": "S", "comment": "Induces a decrease in activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 94, "end_pos": 94, "sequence_org": "C", "sequence_mut": "S", "comment": "Induces a decrease in activity towards thioredoxin. Loss of activity towards thioredoxin and loss of regulatory disulfide bond formation; when associated with A-99.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 99, "end_pos": 99, "sequence_org": "C", "sequence_mut": "A", "comment": "Acts as a weak dominant-negative mutant. Loss of activity towards thioredoxin. Loss of regulatory disulfide bond formation; when associated with A-94.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" } ], "record_id": "pubmed.15136577", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glutathione limits Ero1-dependent oxidation in the endoplasmic reticulum.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Molteni SN, Fassio A, Ciriolo MR, Filomeni G, Pasqualetto E, Fagioli C, Sitia R", "reference": { "type": "PubMed", "id": "15161913", "url": "https://pubmed.ncbi.nlm.nih.gov/15161913" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YB8-1", "protein_name": "ERO1-like protein beta", "gene_name": "ERO1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15161913", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PDILT, a divergent testis-specific protein disulfide isomerase with a non-classical SXXC motif that engages in disulfide-dependent interactions in the endoplasmic reticulum.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "van Lith M, Hartigan N, Hatch J, Benham AM", "reference": { "type": "PubMed", "id": "15475357", "url": "https://pubmed.ncbi.nlm.nih.gov/15475357" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N807-1", "protein_name": "Protein disulfide-isomerase-like protein of the testis", "gene_name": "PDILT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9DAN1-1", "protein_name": "Protein disulfide-isomerase-like protein of the testis", "gene_name": "Pdilt", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15475357", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel disulphide switch mechanism in Ero1alpha balances ER oxidation in human cells.", "journal": "The EMBO journal", "date": "2008", "authors": "Appenzeller-Herzog C, Riemer J, Christensen B, Sorensen ES, Ellgaard L", "reference": { "type": "PubMed", "id": "18833192", "url": "https://pubmed.ncbi.nlm.nih.gov/18833192" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 131, "end_pos": 131, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of regulatory disulfide bond formation and increased activity towards P4HB. Loss of regulatory disulfide bond formation and strongly increased activity towards P4HB; when associated with A-85. Loss of regulatory disulfide bond formation, strongly increased activity towards P4HB and UPR induction, but no broad oxidative injury; when associated with A-104.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18833192", "url": "https://pubmed.ncbi.nlm.nih.gov/18833192" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" }, { "database": "PubMed", "id": "23027870", "url": "https://pubmed.ncbi.nlm.nih.gov/23027870" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 394, "end_pos": 394, "sequence_org": "C", "sequence_mut": "A", "comment": "Retains activity towards P4HB. Does not act as a dominant negative mutant. Induces defects in folding. Remains associated with P4HB.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "11707400", "url": "https://pubmed.ncbi.nlm.nih.gov/11707400" }, { "database": "PubMed", "id": "10671517", "url": "https://pubmed.ncbi.nlm.nih.gov/10671517" }, { "database": "PubMed", "id": "18833192", "url": "https://pubmed.ncbi.nlm.nih.gov/18833192" }, { "database": "PubMed", "id": "10970843", "url": "https://pubmed.ncbi.nlm.nih.gov/10970843" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" } ], "record_id": "pubmed.18833192", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Low reduction potential of Ero1alpha regulatory disulphides ensures tight control of substrate oxidation.", "journal": "The EMBO journal", "date": "2008", "authors": "Baker KM, Chakravarthi S, Langton KP, Sheppard AM, Lu H, Bulleid NJ", "reference": { "type": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 104, "end_pos": 104, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect. Strongly increased activity towards P4HB and UPR induction, but no broad oxidative injury; when associated with A-131.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" }, { "database": "PubMed", "id": "23027870", "url": "https://pubmed.ncbi.nlm.nih.gov/23027870" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 104, "end_pos": 104, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" }, { "database": "PubMed", "id": "23027870", "url": "https://pubmed.ncbi.nlm.nih.gov/23027870" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 131, "end_pos": 131, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of regulatory disulfide bond formation and increased activity towards P4HB. Loss of regulatory disulfide bond formation and strongly increased activity towards P4HB; when associated with A-85. Loss of regulatory disulfide bond formation, strongly increased activity towards P4HB and UPR induction, but no broad oxidative injury; when associated with A-104.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18833192", "url": "https://pubmed.ncbi.nlm.nih.gov/18833192" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" }, { "database": "PubMed", "id": "23027870", "url": "https://pubmed.ncbi.nlm.nih.gov/23027870" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 166, "end_pos": 166, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 208, "end_pos": 208, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 208, "end_pos": 208, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 241, "end_pos": 241, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 241, "end_pos": 241, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 85, "end_pos": 85, "sequence_org": "C", "sequence_mut": "A", "comment": "Alters protein folding and stability. Loss of regulatory disulfide bond formation and increased activity towards P4HB; when associated with A-131.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 85, "end_pos": 85, "sequence_org": "C", "sequence_mut": "S", "comment": "Induces a decrease in activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 94, "end_pos": 94, "sequence_org": "C", "sequence_mut": "S", "comment": "Induces a decrease in activity towards thioredoxin. Loss of activity towards thioredoxin and loss of regulatory disulfide bond formation; when associated with A-99.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 99, "end_pos": 99, "sequence_org": "C", "sequence_mut": "A", "comment": "Acts as a weak dominant-negative mutant. Loss of activity towards thioredoxin. Loss of regulatory disulfide bond formation; when associated with A-94.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "18971943", "url": "https://pubmed.ncbi.nlm.nih.gov/18971943" }, { "database": "PubMed", "id": "15136577", "url": "https://pubmed.ncbi.nlm.nih.gov/15136577" } ], "uniprot_canonical_ac": "Q96HE7-1" } ], "record_id": "pubmed.18971943", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structures of human Ero1alpha reveal the mechanisms of regulated and targeted oxidation of PDI.", "journal": "The EMBO journal", "date": "2010", "authors": "Inaba K, Masui S, Iida H, Vavassori S, Sitia R, Suzuki M", "reference": { "type": "PubMed", "id": "20834232", "url": "https://pubmed.ncbi.nlm.nih.gov/20834232" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20834232", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The endoplasmic reticulum sulfhydryl oxidase Ero1beta drives efficient oxidative protein folding with loose regulation.", "journal": "The Biochemical journal", "date": "2011", "authors": "Wang L, Zhu L, Wang CC", "reference": { "type": "PubMed", "id": "21091435", "url": "https://pubmed.ncbi.nlm.nih.gov/21091435" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00471-1", "protein_name": "Exocyst complex component 5", "gene_name": "EXOC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07237-1", "protein_name": "Protein disulfide-isomerase", "gene_name": "P4HB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YB8-1", "protein_name": "ERO1-like protein beta", "gene_name": "ERO1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KP1-1", "protein_name": "Exocyst complex component 2", "gene_name": "EXOC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51159-1", "protein_name": "Ras-related protein Rab-27A", "gene_name": "RAB27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63027-1", "protein_name": "Vesicle-associated membrane protein 2", "gene_name": "VAMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60282-1", "protein_name": "Kinesin heavy chain isoform 5C", "gene_name": "KIF5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFW9-1", "protein_name": "Rab effector MyRIP", "gene_name": "MYRIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWU4-1", "protein_name": "Proton-coupled zinc antiporter SLC30A8", "gene_name": "SLC30A8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAD4-1", "protein_name": "Proton-coupled zinc antiporter SLC30A5", "gene_name": "SLC30A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYI6-1", "protein_name": "Exocyst complex component 8", "gene_name": "EXOC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A65-1", "protein_name": "Exocyst complex component 4", "gene_name": "EXOC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4I1-1", "protein_name": "Unconventional myosin-Va", "gene_name": "MYO5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBJ8-1", "protein_name": "Collectrin", "gene_name": "CLTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16519-1", "protein_name": "Neuroendocrine convertase 2", "gene_name": "PCSK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16623-1", "protein_name": "Syntaxin-1A", "gene_name": "STX1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16870-1", "protein_name": "Carboxypeptidase E", "gene_name": "CPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60645-1", "protein_name": "Exocyst complex component 3", "gene_name": "EXOC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPT5-3", "protein_name": "Exocyst complex component 7", "gene_name": "EXOC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NV70-1", "protein_name": "Exocyst complex component 1", "gene_name": "EXOC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAG9-1", "protein_name": "Exocyst complex component 6", "gene_name": "EXOC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29120-1", "protein_name": "Neuroendocrine convertase 1", "gene_name": "PCSK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 395, "end_pos": 395, "sequence_org": "F", "sequence_mut": "D", "comment": "Increased catalytical activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "21091435", "url": "https://pubmed.ncbi.nlm.nih.gov/21091435" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 100, "end_pos": 100, "sequence_org": "C", "sequence_mut": "A", "comment": "Slightly decreased thiol oxidase activity. Significant increased thiol oxidase activity; when associated with A-130.", "evidence": [ { "database": "UniProtKB", "id": "Q86YB8", "url": "https://www.uniprot.org/uniprotkb/Q86YB8" }, { "database": "PubMed", "id": "21091435", "url": "https://pubmed.ncbi.nlm.nih.gov/21091435" } ], "uniprot_canonical_ac": "Q86YB8-1" }, { "start_pos": 130, "end_pos": 130, "sequence_org": "C", "sequence_mut": "A", "comment": "Small increase in thiol oxidase activity. Significant increased thiol oxidase activity; when associated with A-130.", "evidence": [ { "database": "UniProtKB", "id": "Q86YB8", "url": "https://www.uniprot.org/uniprotkb/Q86YB8" }, { "database": "PubMed", "id": "21091435", "url": "https://pubmed.ncbi.nlm.nih.gov/21091435" } ], "uniprot_canonical_ac": "Q86YB8-1" }, { "start_pos": 393, "end_pos": 393, "sequence_org": "C", "sequence_mut": "A", "comment": "Some decrease in P4HB-binding. Efficient homodimerization with wild-type protein. Loss of thiol oxidase activity when DTT or P4HB are used as an electron donor; when associated with A-396.", "evidence": [ { "database": "UniProtKB", "id": "Q86YB8", "url": "https://www.uniprot.org/uniprotkb/Q86YB8" }, { "database": "PubMed", "id": "16012172", "url": "https://pubmed.ncbi.nlm.nih.gov/16012172" }, { "database": "PubMed", "id": "21091435", "url": "https://pubmed.ncbi.nlm.nih.gov/21091435" } ], "uniprot_canonical_ac": "Q86YB8-1" }, { "start_pos": 396, "end_pos": 396, "sequence_org": "C", "sequence_mut": "A", "comment": "Some decrease in P4HB-binding. Efficient homodimerization with wild-type protein, but loss of homodimerization with A-396 mutated protein. Loss of thiol oxidase activity when DTT or P4HB are used as an electron donor; when associated with A-393.", "evidence": [ { "database": "UniProtKB", "id": "Q86YB8", "url": "https://www.uniprot.org/uniprotkb/Q86YB8" }, { "database": "PubMed", "id": "16012172", "url": "https://pubmed.ncbi.nlm.nih.gov/16012172" }, { "database": "PubMed", "id": "21091435", "url": "https://pubmed.ncbi.nlm.nih.gov/21091435" } ], "uniprot_canonical_ac": "Q86YB8-1" }, { "start_pos": 90, "end_pos": 90, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on thiol oxidase activity when DTT is used as an electron donor; when associated with A-95. Loss of thiol oxidase activity when P4HB is used as an electron donor; when associated with A-95.", "evidence": [ { "database": "UniProtKB", "id": "Q86YB8", "url": "https://www.uniprot.org/uniprotkb/Q86YB8" }, { "database": "PubMed", "id": "21091435", "url": "https://pubmed.ncbi.nlm.nih.gov/21091435" } ], "uniprot_canonical_ac": "Q86YB8-1" }, { "start_pos": 95, "end_pos": 95, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on thiol oxidase activity when DTT is used as an electron donor; when associated with A-90. Loss of thiol oxidase activity when P4HB is used as an electron donor; when associated with A-90.", "evidence": [ { "database": "UniProtKB", "id": "Q86YB8", "url": "https://www.uniprot.org/uniprotkb/Q86YB8" }, { "database": "PubMed", "id": "21091435", "url": "https://pubmed.ncbi.nlm.nih.gov/21091435" } ], "uniprot_canonical_ac": "Q86YB8-1" } ], "record_id": "pubmed.21091435", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Secretory kinase Fam20C tunes endoplasmic reticulum redox state via phosphorylation of Ero1alpha.", "journal": "The EMBO journal", "date": "2018", "authors": "Zhang J, Zhu Q, Wang X, Yu J, Chen X, Wang J, Wang X, Xiao J, Wang CC, Wang L", "reference": { "type": "PubMed", "id": "29858230", "url": "https://pubmed.ncbi.nlm.nih.gov/29858230" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BS26-1", "protein_name": "Endoplasmic reticulum resident protein 44", "gene_name": "ERP44", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8R180-1", "protein_name": "ERO1-like protein alpha", "gene_name": "Ero1a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8IXL6-1", "protein_name": "Extracellular serine/threonine protein kinase FAM20C", "gene_name": "FAM20C", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 145, "end_pos": 145, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation. Does not affect interaction with ERP44.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "29858230", "url": "https://pubmed.ncbi.nlm.nih.gov/29858230" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 145, "end_pos": 145, "sequence_org": "S", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Does not affect interaction with ERP44. Shows two-fold increase in enzyme activity. Accelerates immunoglobulin folding.", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "PubMed", "id": "29858230", "url": "https://pubmed.ncbi.nlm.nih.gov/29858230" } ], "uniprot_canonical_ac": "Q96HE7-1" }, { "start_pos": 478, "end_pos": 478, "sequence_org": "D", "sequence_mut": "A", "comment": "Unable to bind manganese. Abrogates kinase activity. Loss of ERO1A phosphorylation. Loss of autophosphorylation. Loss of ability to promote osteoblast differentiation.", "evidence": [ { "database": "UniProtKB", "id": "Q8IXL6", "url": "https://www.uniprot.org/uniprotkb/Q8IXL6" }, { "database": "PubMed", "id": "22582013", "url": "https://pubmed.ncbi.nlm.nih.gov/22582013" }, { "database": "PubMed", "id": "26091039", "url": "https://pubmed.ncbi.nlm.nih.gov/26091039" }, { "database": "PubMed", "id": "23754375", "url": "https://pubmed.ncbi.nlm.nih.gov/23754375" }, { "database": "PubMed", "id": "25789606", "url": "https://pubmed.ncbi.nlm.nih.gov/25789606" }, { "database": "PubMed", "id": "29858230", "url": "https://pubmed.ncbi.nlm.nih.gov/29858230" }, { "database": "PubMed", "id": "34349020", "url": "https://pubmed.ncbi.nlm.nih.gov/34349020" } ], "uniprot_canonical_ac": "Q8IXL6-1" } ], "phosphorylation": [ { "start_pos": 145, "end_pos": 145, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" }, { "database": "iPTMnet", "id": "Q96HE7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q96HE7" }, { "database": "PubMed", "id": "29858230", "url": "https://pubmed.ncbi.nlm.nih.gov/29858230" } ], "site_lbl": "Ser145", "uniprot_canonical_ac": "Q96HE7-1" } ], "record_id": "pubmed.29858230", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ablation of ERO1A induces lethal endoplasmic reticulum stress responses and immunogenic cell death to activate anti-tumor immunity.", "journal": "Cell reports. Medicine", "date": "2023-10-17", "authors": "Liu Lihui, Li Sini, Qu Yan, Bai Hua, Pan Xiangyu, Wang Jian, Wang Zhijie, Duan Jianchun, Zhong Jia, Wan Rui, Fei Kailun, Xu Jiachen, Yuan Li, Wang Chao, Xue Pei, Zhang Xue, Ma Zixiao, Wang Jie", "reference": { "type": "PubMed", "id": "37769655", "url": "https://pubmed.ncbi.nlm.nih.gov/37769655" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37769655", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ERO1\u03b1 promotes the proliferation and inhibits apoptosis of colorectal cancer cells by regulating the PI3K/AKT pathway.", "journal": "Journal of molecular histology", "date": "2023-12", "authors": "Wu Min, Li Ruixue, Qin Jianyan, Wang Ziyuan, Guo Jiasen, Lv Fenghong, Wang Guoqin, Huang Youguang", "reference": { "type": "PubMed", "id": "37776473", "url": "https://pubmed.ncbi.nlm.nih.gov/37776473" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37776473", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SEPN1-related myopathy depends on the oxidoreductase ERO1A and is druggable with the chemical chaperone TUDCA.", "journal": "Cell reports. Medicine", "date": "2024-03-19", "authors": "Germani Serena, Van Ho Andrew Tri, Cherubini Alessandro, Varone Ersilia, Chernorudskiy Alexander, Renna Giorgia Maria, Fumagalli Stefano, Gobbi Marco, Lucchetti Jacopo, Bolis Marco, Guarrera Luca, Craparotta Ilaria, Rastelli Giorgia, Piccoli Giorgia, de Napoli Cosimo, Nogara Leonardo, Poggio Elena, Brini Marisa, Cattaneo Angela, Bachi Angela, Simmen Thomas, Cal\u00ec Tito, Quijano-Roy Susana, Boncompagni Simona, Blaauw Bert, Ferreiro Ana, Zito Ester", "reference": { "type": "PubMed", "id": "38402623", "url": "https://pubmed.ncbi.nlm.nih.gov/38402623" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8R180-1", "protein_name": "ERO1-like protein alpha", "gene_name": "Ero1a", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38402623", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biological mechanisms and clinical significance of endoplasmic reticulum oxidoreductase 1 alpha (ERO1\u03b1) in human cancer.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2024-03-08", "authors": "Chen Peng, Sharma Amit, Weiher Hans, Schmidt-Wolf Ingo G H", "reference": { "type": "PubMed", "id": "38454454", "url": "https://pubmed.ncbi.nlm.nih.gov/38454454" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96HE7-1", "protein_name": "ERO1-like protein alpha", "gene_name": "ERO1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96HE7", "url": "https://www.uniprot.org/uniprotkb/Q96HE7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38454454", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification of the serine palmitoyltransferase complex responsible for sphingoid base synthesis by using affinity peptide chromatography techniques.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hanada K, Hara T, Nishijima M", "reference": { "type": "PubMed", "id": "10722674", "url": "https://pubmed.ncbi.nlm.nih.gov/10722674" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10722674", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and functional characterization of a novel mammalian sphingosine kinase type 2 isoform.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Liu H, Sugiura M, Nava VE, Edsall LC, Kono K, Poulton S, Milstien S, Kohama T, Spiegel S", "reference": { "type": "PubMed", "id": "10751414", "url": "https://pubmed.ncbi.nlm.nih.gov/10751414" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9JIA7-1", "protein_name": "Sphingosine kinase 2", "gene_name": "Sphk2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10751414", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human sphingosine kinase: purification, molecular cloning and characterization of the native and recombinant enzymes.", "journal": "The Biochemical journal", "date": "2000", "authors": "Pitson SM, D'andrea RJ, Vandeleur L, Moretti PA, Xia P, Gamble JR, Vadas MA, Wattenberg BW", "reference": { "type": "PubMed", "id": "10947957", "url": "https://pubmed.ncbi.nlm.nih.gov/10947957" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10947957", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of a sphingolipid delta 4-desaturase family.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Ternes P, Franke S, Zahringer U, Sperling P, Heinz E", "reference": { "type": "PubMed", "id": "11937514", "url": "https://pubmed.ncbi.nlm.nih.gov/11937514" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q94515-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "ifc", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O09005-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "Degs1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8R2F2-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "Degs2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11937514", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 39 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a family of animal sphingomyelin synthases.", "journal": "The EMBO journal", "date": "2004", "authors": "Huitema K, van den Dikkenberg J, Brouwers JF, Holthuis JC", "reference": { "type": "PubMed", "id": "14685263", "url": "https://pubmed.ncbi.nlm.nih.gov/14685263" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9DA37-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "Samd8", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VS60-1", "protein_name": "Ceramide phosphoethanolamine synthase", "gene_name": "SMSr", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VCQ6-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "Sgms1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9D4B1-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "Sgms2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14685263", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 40 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression cloning of a human cDNA restoring sphingomyelin synthesis and cell growth in sphingomyelin synthase-defective lymphoid cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yamaoka S, Miyaji M, Kitano T, Umehara H, Okazaki T", "reference": { "type": "PubMed", "id": "14976195", "url": "https://pubmed.ncbi.nlm.nih.gov/14976195" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14976195", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the human sphingolipid C4-hydroxylase, hDES2, and its up-regulation during keratinocyte differentiation.", "journal": "FEBS letters", "date": "2004", "authors": "Mizutani Y, Kihara A, Igarashi Y", "reference": { "type": "PubMed", "id": "15063729", "url": "https://pubmed.ncbi.nlm.nih.gov/15063729" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15063729", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human FA2H gene encodes a fatty acid 2-hydroxylase.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Alderson NL, Rembiesa BM, Walla MD, Bielawska A, Bielawski J, Hama H", "reference": { "type": "PubMed", "id": "15337768", "url": "https://pubmed.ncbi.nlm.nih.gov/15337768" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15337768", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LASS5 is a bona fide dihydroceramide synthase that selectively utilizes palmitoyl-CoA as acyl donor.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Lahiri S, Futerman AH", "reference": { "type": "PubMed", "id": "16100120", "url": "https://pubmed.ncbi.nlm.nih.gov/16100120" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D6K9-1", "protein_name": "Ceramide synthase 5", "gene_name": "Cers5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16100120", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SphK1 and SphK2, sphingosine kinase isoenzymes with opposing functions in sphingolipid metabolism.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Maceyka M, Sankala H, Hait NC, Le Stunff H, Liu H, Toman R, Collier C, Zhang M, Satin LS, Merrill AH Jr, Milstien S, Spiegel S", "reference": { "type": "PubMed", "id": "16118219", "url": "https://pubmed.ncbi.nlm.nih.gov/16118219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8CI15-1", "protein_name": "Sphingosine kinase 1", "gene_name": "Sphk1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q91V26-1", "protein_name": "Sphingosine kinase 1", "gene_name": "Sphk1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9JIA7-1", "protein_name": "Sphingosine kinase 2", "gene_name": "Sphk2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 82, "end_pos": 82, "sequence_org": "G", "sequence_mut": "D", "comment": "Loss of sphingosine kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q91V26", "url": "https://www.uniprot.org/uniprotkb/Q91V26" }, { "database": "PubMed", "id": "16118219", "url": "https://pubmed.ncbi.nlm.nih.gov/16118219" } ], "uniprot_canonical_ac": "Q91V26-1" }, { "start_pos": 213, "end_pos": 213, "sequence_org": "G", "sequence_mut": "E", "comment": "Abolishes sphingosine kinase activity. Decreases apoptosis induction. Abolishes sphingosine kinase activity. No effect on endoplasmic reticulum location increase upon serum starvation. Abolishes sphingosine kinase activity and decreases apoptosis induction; when associated with A-219.", "evidence": [ { "database": "UniProtKB", "id": "Q9JIA7", "url": "https://www.uniprot.org/uniprotkb/Q9JIA7" }, { "database": "PubMed", "id": "16118219", "url": "https://pubmed.ncbi.nlm.nih.gov/16118219" } ], "uniprot_canonical_ac": "Q9JIA7-1" }, { "start_pos": 219, "end_pos": 219, "sequence_org": "L", "sequence_mut": "A", "comment": "Strongly decreases sphingosine kinase activity. Decreases apoptosis induction. No effect on endoplasmic reticulum location increase upon serum starvation. Abolishes sphingosine kinase activity and decreases apoptosis induction; when associated with E-213.", "evidence": [ { "database": "UniProtKB", "id": "Q9JIA7", "url": "https://www.uniprot.org/uniprotkb/Q9JIA7" }, { "database": "PubMed", "id": "16118219", "url": "https://pubmed.ncbi.nlm.nih.gov/16118219" } ], "uniprot_canonical_ac": "Q9JIA7-1" } ], "record_id": "pubmed.16118219", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 39 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oxysterol-binding protein and vesicle-associated membrane protein-associated protein are required for sterol-dependent activation of the ceramide transport protein.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Perry RJ, Ridgway ND", "reference": { "type": "PubMed", "id": "16571669", "url": "https://pubmed.ncbi.nlm.nih.gov/16571669" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16571669", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "When do Lasses (longevity assurance genes) become CerS (ceramide synthases)?: Insights into the regulation of ceramide synthesis.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Pewzner-Jung Y, Ben-Dor S, Futerman AH", "reference": { "type": "PubMed", "id": "16793762", "url": "https://pubmed.ncbi.nlm.nih.gov/16793762" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16793762", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and initial characterization of a new subunit for mammalian serine-palmitoyltransferase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Hornemann T, Richard S, Rutti MF, Wei Y, von Eckardstein A", "reference": { "type": "PubMed", "id": "17023427", "url": "https://pubmed.ncbi.nlm.nih.gov/17023427" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17023427", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of ABCC1 in export of sphingosine-1-phosphate from mast cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006-10-31", "authors": "Mitra Poulami, Oskeritzian Carole A, Payne Shawn G, Beaven Michael A, Milstien Sheldon, Spiegel Sarah", "reference": { "type": "PubMed", "id": "17050692", "url": "https://pubmed.ncbi.nlm.nih.gov/17050692" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8CG09-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "Abcc1; LOC134480646", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17050692", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Is the mammalian serine palmitoyltransferase a high-molecular-mass complex?", "journal": "The Biochemical journal", "date": "2007", "authors": "Hornemann T, Wei Y, von Eckardstein A", "reference": { "type": "PubMed", "id": "17331073", "url": "https://pubmed.ncbi.nlm.nih.gov/17331073" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17331073", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fatty acid 2-hydroxylase, encoded by FA2H, accounts for differentiation-associated increase in 2-OH ceramides during keratinocyte differentiation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Uchida Y, Hama H, Alderson NL, Douangpanya S, Wang Y, Crumrine DA, Elias PM, Holleran WM", "reference": { "type": "PubMed", "id": "17355976", "url": "https://pubmed.ncbi.nlm.nih.gov/17355976" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17355976", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Both sphingomyelin synthases SMS1 and SMS2 are required for sphingomyelin homeostasis and growth in human HeLa cells.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Tafesse FG, Huitema K, Hermansson M, van der Poel S, van den Dikkenberg J, Uphoff A, Somerharju P, Holthuis JC", "reference": { "type": "PubMed", "id": "17449912", "url": "https://pubmed.ncbi.nlm.nih.gov/17449912" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17449912", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SMS overexpression and knockdown: impact on cellular sphingomyelin and diacylglycerol metabolism, and cell apoptosis.", "journal": "Journal of lipid research", "date": "2008", "authors": "Ding T, Li Z, Hailemariam T, Mukherjee S, Maxfield FR, Wu MP, Jiang XC", "reference": { "type": "PubMed", "id": "17982138", "url": "https://pubmed.ncbi.nlm.nih.gov/17982138" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17982138", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein phosphatase 2Cepsilon is an endoplasmic reticulum integral membrane protein that dephosphorylates the ceramide transport protein CERT to enhance its association with organelle membranes.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Saito S, Matsui H, Kawano M, Kumagai K, Tomishige N, Hanada K, Echigo S, Tamura S, Kobayashi T", "reference": { "type": "PubMed", "id": "18165232", "url": "https://pubmed.ncbi.nlm.nih.gov/18165232" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0ABK0M317-1", "protein_name": "Protein phosphatase 1L", "gene_name": "Ppm1l", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BHN0-1", "protein_name": "Protein phosphatase 1L", "gene_name": "Ppm1l", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18165232", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 38 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of ceramide synthase 2: tissue distribution, substrate specificity, and inhibition by sphingosine 1-phosphate.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Laviad EL, Albee L, Pankova-Kholmyansky I, Epstein S, Park H, Merrill AH Jr, Futerman AH", "reference": { "type": "PubMed", "id": "18165233", "url": "https://pubmed.ncbi.nlm.nih.gov/18165233" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q924Z4-1", "protein_name": "Ceramide synthase 2", "gene_name": "Cers2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 230, "end_pos": 230, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolished inhibition by sphingosine-1-phosphate; when associated with A-325.", "evidence": [ { "database": "UniProtKB", "id": "Q96G23", "url": "https://www.uniprot.org/uniprotkb/Q96G23" }, { "database": "PubMed", "id": "18165233", "url": "https://pubmed.ncbi.nlm.nih.gov/18165233" } ], "uniprot_canonical_ac": "Q96G23-1" }, { "start_pos": 325, "end_pos": 325, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolished inhibition by sphingosine-1-phosphate; when associated with A-230.", "evidence": [ { "database": "UniProtKB", "id": "Q96G23", "url": "https://www.uniprot.org/uniprotkb/Q96G23" }, { "database": "PubMed", "id": "18165233", "url": "https://pubmed.ncbi.nlm.nih.gov/18165233" } ], "uniprot_canonical_ac": "Q96G23-1" } ], "record_id": "pubmed.18165233", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ligand-dependent ubiquitination of Smad3 is regulated by casein kinase 1 gamma 2, an inhibitor of TGF-beta signaling.", "journal": "Oncogene", "date": "2008", "authors": "Guo X, Waddell DS, Wang W, Wang Z, Liberati NT, Yong S, Liu X, Wang XF", "reference": { "type": "PubMed", "id": "18794808", "url": "https://pubmed.ncbi.nlm.nih.gov/18794808" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 418, "end_pos": 418, "sequence_org": "S", "sequence_mut": "A", "comment": "Increased constitutive activity.", "evidence": [ { "database": "UniProtKB", "id": "P84022", "url": "https://www.uniprot.org/uniprotkb/P84022" }, { "database": "PubMed", "id": "18794808", "url": "https://pubmed.ncbi.nlm.nih.gov/18794808" } ], "uniprot_canonical_ac": "P84022-1" }, { "start_pos": 418, "end_pos": 418, "sequence_org": "S", "sequence_mut": "D", "comment": "Decreased activity.", "evidence": [ { "database": "UniProtKB", "id": "P84022", "url": "https://www.uniprot.org/uniprotkb/P84022" }, { "database": "PubMed", "id": "18794808", "url": "https://pubmed.ncbi.nlm.nih.gov/18794808" } ], "uniprot_canonical_ac": "P84022-1" } ], "phosphorylation": [ { "start_pos": 418, "end_pos": 418, "kinase_uniprot_canonical_ac": "P78368-1", "kinase_gene_name": "CSNK1G2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P84022", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P84022" }, { "database": "PubMed", "id": "18794808", "url": "https://pubmed.ncbi.nlm.nih.gov/18794808" } ], "site_lbl": "Ser418", "uniprot_canonical_ac": "P84022-1" }, { "start_pos": 418, "end_pos": 418, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK1", "evidence": [ { "database": "UniProtKB", "id": "P84022", "url": "https://www.uniprot.org/uniprotkb/P84022" }, { "database": "iPTMnet", "id": "P84022", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P84022" }, { "database": "PubMed", "id": "18794808", "url": "https://pubmed.ncbi.nlm.nih.gov/18794808" } ], "site_lbl": "Ser418", "uniprot_canonical_ac": "P84022-1" } ], "record_id": "pubmed.18794808", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sphingomyelin synthase 2 is palmitoylated at the COOH-terminal tail, which is involved in its localization in plasma membranes.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Tani M, Kuge O", "reference": { "type": "PubMed", "id": "19233134", "url": "https://pubmed.ncbi.nlm.nih.gov/19233134" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 331, "end_pos": 332, "sequence_org": "CC", "sequence_mut": "AA", "comment": "Little effect on palmitoylation; when associated with A-343 or A-348. Abolishes palmitoylation and dramatically reduces plasma membrane localization; when associated with A-343 and A-348.", "evidence": [ { "database": "UniProtKB", "id": "Q8NHU3", "url": "https://www.uniprot.org/uniprotkb/Q8NHU3" }, { "database": "PubMed", "id": "19233134", "url": "https://pubmed.ncbi.nlm.nih.gov/19233134" } ], "uniprot_canonical_ac": "Q8NHU3-1" }, { "start_pos": 343, "end_pos": 343, "sequence_org": "C", "sequence_mut": "A", "comment": "Strongly decreases palmitoylation; when associated with A-348. Abolishes palmitoylation and dramatically reduces plasma membrane localization; when associated with 331-A-A-332 and A-348.", "evidence": [ { "database": "UniProtKB", "id": "Q8NHU3", "url": "https://www.uniprot.org/uniprotkb/Q8NHU3" }, { "database": "PubMed", "id": "19233134", "url": "https://pubmed.ncbi.nlm.nih.gov/19233134" } ], "uniprot_canonical_ac": "Q8NHU3-1" }, { "start_pos": 348, "end_pos": 348, "sequence_org": "C", "sequence_mut": "A", "comment": "Strongly decreases palmitoylation; when associated with A-343. Abolishes palmitoylation and dramatically reduces plasma membrane localization; when associated with 331-A-A-332 and A-343.", "evidence": [ { "database": "UniProtKB", "id": "Q8NHU3", "url": "https://www.uniprot.org/uniprotkb/Q8NHU3" }, { "database": "PubMed", "id": "19233134", "url": "https://pubmed.ncbi.nlm.nih.gov/19233134" } ], "uniprot_canonical_ac": "Q8NHU3-1" } ], "record_id": "pubmed.19233134", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Han G, Gupta SD, Gable K, Niranjanakumari S, Moitra P, Eichler F, Brown RH Jr, Harmon JM, Dunn TM", "reference": { "type": "PubMed", "id": "19416851", "url": "https://pubmed.ncbi.nlm.nih.gov/19416851" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19416851", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sphingomyelin synthase-related protein SMSr controls ceramide homeostasis in the ER.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Vacaru AM, Tafesse FG, Ternes P, Kondylis V, Hermansson M, Brouwers JF, Somerharju P, Rabouille C, Holthuis JC", "reference": { "type": "PubMed", "id": "19506037", "url": "https://pubmed.ncbi.nlm.nih.gov/19506037" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9VS60-1", "protein_name": "Ceramide phosphoethanolamine synthase", "gene_name": "SMSr", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 401, "end_pos": 401, "sequence_org": "H", "sequence_mut": "A", "comment": "Abolishes CPE synthase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9VS60", "url": "https://www.uniprot.org/uniprotkb/Q9VS60" }, { "database": "PubMed", "id": "19506037", "url": "https://pubmed.ncbi.nlm.nih.gov/19506037" } ], "uniprot_canonical_ac": "Q9VS60-1" }, { "start_pos": 405, "end_pos": 405, "sequence_org": "D", "sequence_mut": "E", "comment": "Abolishes CPE synthase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9VS60", "url": "https://www.uniprot.org/uniprotkb/Q9VS60" }, { "database": "PubMed", "id": "19506037", "url": "https://pubmed.ncbi.nlm.nih.gov/19506037" } ], "uniprot_canonical_ac": "Q9VS60-1" }, { "start_pos": 348, "end_pos": 348, "sequence_org": "D", "sequence_mut": "E", "comment": "Abolishes CPE synthase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96LT4", "url": "https://www.uniprot.org/uniprotkb/Q96LT4" }, { "database": "PubMed", "id": "19506037", "url": "https://pubmed.ncbi.nlm.nih.gov/19506037" } ], "uniprot_canonical_ac": "Q96LT4-1" } ], "record_id": "pubmed.19506037", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pharmacology and antitumor activity of ABC294640, a selective inhibitor of sphingosine kinase-2.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2010", "authors": "French KJ, Zhuang Y, Maines LW, Gao P, Wang W, Beljanski V, Upson JJ, Green CL, Keller SN, Smith CD", "reference": { "type": "PubMed", "id": "20061445", "url": "https://pubmed.ncbi.nlm.nih.gov/20061445" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20061445", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Estradiol induces export of sphingosine 1-phosphate from breast cancer cells via ABCC1 and ABCG2.", "journal": "The Journal of biological chemistry", "date": "2010-04-02", "authors": "Takabe Kazuaki, Kim Roger H, Allegood Jeremy C, Mitra Poulami, Ramachandran Subramaniam, Nagahashi Masayuki, Harikumar Kuzhuvelil B, Hait Nitai C, Milstien Sheldon, Spiegel Sarah", "reference": { "type": "PubMed", "id": "20110355", "url": "https://pubmed.ncbi.nlm.nih.gov/20110355" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20110355", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Orm family proteins mediate sphingolipid homeostasis.", "journal": "Nature", "date": "2010", "authors": "Breslow DK, Collins SR, Bodenmiller B, Aebersold R, Simons K, Shevchenko A, Ejsing CS, Weissman JS", "reference": { "type": "PubMed", "id": "20182505", "url": "https://pubmed.ncbi.nlm.nih.gov/20182505" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3E790-1", "protein_name": "Serine palmitoyltransferase-regulating protein TSC3", "gene_name": "TSC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25045-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "LCB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40970-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "LCB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53224-1", "protein_name": "Protein ORM1", "gene_name": "ORM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06144-1", "protein_name": "Protein ORM2", "gene_name": "ORM2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32368-1", "protein_name": "Phosphatidylinositol-3-phosphatase SAC1", "gene_name": "SAC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 29, "end_pos": 29, "sequence_org": "S", "sequence_mut": "A", "comment": "Induces dysregulation of sphingolipid synthesis; when associated with 32-A--A-36 and 51-A--A-53.", "evidence": [ { "database": "UniProtKB", "id": "P53224", "url": "https://www.uniprot.org/uniprotkb/P53224" }, { "database": "PubMed", "id": "20182505", "url": "https://pubmed.ncbi.nlm.nih.gov/20182505" } ], "uniprot_canonical_ac": "P53224-1" }, { "start_pos": 32, "end_pos": 36, "sequence_org": "SASSS", "sequence_mut": "AAAAA", "comment": "Induces dysregulation of sphingolipid synthesis; when associated with A-29 and 51-A--A-53.", "evidence": [ { "database": "UniProtKB", "id": "P53224", "url": "https://www.uniprot.org/uniprotkb/P53224" }, { "database": "PubMed", "id": "20182505", "url": "https://pubmed.ncbi.nlm.nih.gov/20182505" } ], "uniprot_canonical_ac": "P53224-1" }, { "start_pos": 51, "end_pos": 53, "sequence_org": "SSS", "sequence_mut": "AAA", "comment": "Induces dysregulation of sphingolipid synthesis; when associated with A-29 and 32-A--A-36.", "evidence": [ { "database": "UniProtKB", "id": "P53224", "url": "https://www.uniprot.org/uniprotkb/P53224" }, { "database": "PubMed", "id": "20182505", "url": "https://pubmed.ncbi.nlm.nih.gov/20182505" } ], "uniprot_canonical_ac": "P53224-1" }, { "start_pos": 15, "end_pos": 15, "sequence_org": "S", "sequence_mut": "A", "comment": "Induces dysregulation of sphingolipid synthesis; when associated with A-9, A-18, A-36 and 46-A--A-48.", "evidence": [ { "database": "UniProtKB", "id": "Q06144", "url": "https://www.uniprot.org/uniprotkb/Q06144" }, { "database": "PubMed", "id": "20182505", "url": "https://pubmed.ncbi.nlm.nih.gov/20182505" } ], "uniprot_canonical_ac": "Q06144-1" }, { "start_pos": 18, "end_pos": 18, "sequence_org": "T", "sequence_mut": "A", "comment": "Induces dysregulation of sphingolipid synthesis; when associated with A-9, A-15, A-36 and 46-A--A-48.", "evidence": [ { "database": "UniProtKB", "id": "Q06144", "url": "https://www.uniprot.org/uniprotkb/Q06144" }, { "database": "PubMed", "id": "20182505", "url": "https://pubmed.ncbi.nlm.nih.gov/20182505" } ], "uniprot_canonical_ac": "Q06144-1" }, { "start_pos": 36, "end_pos": 36, "sequence_org": "T", "sequence_mut": "A", "comment": "Induces dysregulation of sphingolipid synthesis; when associated with A-9, A-15, A-18 and 46-A--A-48.", "evidence": [ { "database": "UniProtKB", "id": "Q06144", "url": "https://www.uniprot.org/uniprotkb/Q06144" }, { "database": "PubMed", "id": "20182505", "url": "https://pubmed.ncbi.nlm.nih.gov/20182505" } ], "uniprot_canonical_ac": "Q06144-1" }, { "start_pos": 46, "end_pos": 48, "sequence_org": "SSS", "sequence_mut": "AAA", "comment": "Induces dysregulation of sphingolipid synthesis; when associated with A-9, A-15, A-18, and A-36.", "evidence": [ { "database": "UniProtKB", "id": "Q06144", "url": "https://www.uniprot.org/uniprotkb/Q06144" }, { "database": "PubMed", "id": "20182505", "url": "https://pubmed.ncbi.nlm.nih.gov/20182505" } ], "uniprot_canonical_ac": "Q06144-1" }, { "start_pos": 9, "end_pos": 9, "sequence_org": "S", "sequence_mut": "A", "comment": "Induces dysregulation of sphingolipid synthesis; when associated with A-15, A-18, A-36 and 46-A--A-48.", "evidence": [ { "database": "UniProtKB", "id": "Q06144", "url": "https://www.uniprot.org/uniprotkb/Q06144" }, { "database": "PubMed", "id": "20182505", "url": "https://pubmed.ncbi.nlm.nih.gov/20182505" } ], "uniprot_canonical_ac": "Q06144-1" } ], "phosphorylation": [ { "start_pos": 22, "end_pos": 22, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q06144", "url": "https://www.uniprot.org/uniprotkb/Q06144" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q06144", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06144" }, { "database": "PubMed", "id": "23363605", "url": "https://pubmed.ncbi.nlm.nih.gov/23363605" }, { "database": "SGD", "id": "S000004342", "url": "https://www.yeastgenome.org/locus/S000004342" }, { "database": "PubMed", "id": "20182505", "url": "https://pubmed.ncbi.nlm.nih.gov/20182505" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser22", "uniprot_canonical_ac": "Q06144-1" }, { "start_pos": 31, "end_pos": 31, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004342", "url": "https://www.yeastgenome.org/locus/S000004342" }, { "database": "iPTMnet", "id": "Q06144", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06144" }, { "database": "PubMed", "id": "20182505", "url": "https://pubmed.ncbi.nlm.nih.gov/20182505" }, { "database": "PubMed", "id": "23363605", "url": "https://pubmed.ncbi.nlm.nih.gov/23363605" } ], "site_lbl": "Ser31", "uniprot_canonical_ac": "Q06144-1" } ], "record_id": "pubmed.20182505", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 42 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "(R)-FTY720 methyl ether is a specific sphingosine kinase 2 inhibitor: Effect on sphingosine kinase 2 expression in HEK 293 cells and actin rearrangement and survival of MCF-7 breast cancer cells.", "journal": "Cellular signalling", "date": "2011", "authors": "Lim KG, Sun C, Bittman R, Pyne NJ, Pyne S", "reference": { "type": "PubMed", "id": "21620961", "url": "https://pubmed.ncbi.nlm.nih.gov/21620961" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21620961", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stereospecificity of fatty acid 2-hydroxylase and differential functions of 2-hydroxy fatty acid enantiomers.", "journal": "Journal of lipid research", "date": "2012-07", "authors": "Guo Lin, Zhang Xu, Zhou Dequan, Okunade Adewole L, Su Xiong", "reference": { "type": "PubMed", "id": "22517924", "url": "https://pubmed.ncbi.nlm.nih.gov/22517924" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5MPP0-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "Fa2h", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22517924", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of isoenzyme-selective inhibitors of human sphingosine kinases.", "journal": "PloS one", "date": "2012", "authors": "Gao P, Peterson YK, Smith RA, Smith CD", "reference": { "type": "PubMed", "id": "22970244", "url": "https://pubmed.ncbi.nlm.nih.gov/22970244" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22970244", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spns2, a transporter of phosphorylated sphingoid bases, regulates their blood and lymph levels, and the lymphatic network.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2013", "authors": "Nagahashi M, Kim EY, Yamada A, Ramachandran S, Allegood JC, Hait NC, Maceyka M, Milstien S, Takabe K, Spiegel S", "reference": { "type": "PubMed", "id": "23180825", "url": "https://pubmed.ncbi.nlm.nih.gov/23180825" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q91VM4-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "Spns2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23180825", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis of sphingosine kinase 1 substrate recognition and catalysis.", "journal": "Structure (London, England : 1993)", "date": "2013", "authors": "Wang Z, Min X, Xiao SH, Johnstone S, Romanow W, Meininger D, Xu H, Liu J, Dai J, An S, Thibault S, Walker N", "reference": { "type": "PubMed", "id": "23602659", "url": "https://pubmed.ncbi.nlm.nih.gov/23602659" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 81, "end_pos": 81, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9NYA1", "url": "https://www.uniprot.org/uniprotkb/Q9NYA1" }, { "database": "PubMed", "id": "23602659", "url": "https://pubmed.ncbi.nlm.nih.gov/23602659" } ], "uniprot_canonical_ac": "Q9NYA1-1" }, { "start_pos": 81, "end_pos": 81, "sequence_org": "D", "sequence_mut": "N", "comment": "Strongly reduced enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9NYA1", "url": "https://www.uniprot.org/uniprotkb/Q9NYA1" }, { "database": "PubMed", "id": "23602659", "url": "https://pubmed.ncbi.nlm.nih.gov/23602659" } ], "uniprot_canonical_ac": "Q9NYA1-1" } ], "record_id": "pubmed.23602659", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in CERS3 cause autosomal recessive congenital ichthyosis in humans.", "journal": "PLoS genetics", "date": "2013", "authors": "Radner FP, Marrakchi S, Kirchmeier P, Kim GJ, Ribierre F, Kamoun B, Abid L, Leipoldt M, Turki H, Schempp W, Heilig R, Lathrop M, Fischer J", "reference": { "type": "PubMed", "id": "23754960", "url": "https://pubmed.ncbi.nlm.nih.gov/23754960" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23754960", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Impairment of ceramide synthesis causes a novel progressive myoclonus epilepsy.", "journal": "Annals of neurology", "date": "2014", "authors": "Vanni N, Fruscione F, Ferlazzo E, Striano P, Robbiano A, Traverso M, Sander T, Falace A, Gazzerro E, Bramanti P, Bielawski J, Fassio A, Minetti C, Genton P, Zara F", "reference": { "type": "PubMed", "id": "24782409", "url": "https://pubmed.ncbi.nlm.nih.gov/24782409" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs200024180", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200024180" }, { "id": "rs200024180", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200024180" }, { "id": "rs200024180", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200024180" }, { "id": "rs200024180", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200024180#frequency_tab" }, { "id": "rs200024180", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200024180" }, { "id": "19243074", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19243074" }, { "id": "24782409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24782409" } ], "glycoeffect": [], "start_pos": 183, "end_pos": 183, "sequence_org": "H", "sequence_mut": "Q", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycolipid-related.", "chr_id": "19", "chr_pos": "18884128", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "H183", "disease": [ { "disease_id": "DOID:0111451", "recommended_name": { "id": "DOID:0111451", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111451", "name": "progressive myoclonus epilepsy 8", "description": "A progressive myoclonus epilepsy characterized by childhood to adolescent-onset of action myoclonus, generalized tonic-clonic seizures, and slowly progressive, moderate to severe cognitive impairment that has_material_basis_in homozygous or compound heterozygous mutation in CERS1 on chromosome 19p13.11." }, "synonyms": [ { "id": "DOID:0111451", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111451", "name": "EMP8", "description": "" }, { "id": "DOID:0111451", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111451", "name": "PME type 8", "description": "" }, { "id": "DOID:0111451", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111451", "name": "progressive myoclonic epilepsy due to CERS1 deficiency", "description": "" }, { "id": "DOID:0111451", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111451", "name": "progressive myoclonus epilepsy type 8", "description": "" }, { "id": "MONDO:0014545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014545", "name": "progressive myoclonic epilepsy type 8", "description": "Any progressive myoclonic epilepsy in which the cause of the disease is a mutation in the CERS1 gene." }, { "id": "MONDO:0014545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014545", "name": "CERS1 progressive myoclonic epilepsy", "description": "" }, { "id": "MONDO:0014545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014545", "name": "EPM8", "description": "" }, { "id": "MONDO:0014545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014545", "name": "PME type 8", "description": "" }, { "id": "MONDO:0014545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014545", "name": "epilepsy, progressive myoclonic, type 8", "description": "" }, { "id": "MONDO:0014545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014545", "name": "progressive myoclonic epilepsy caused by mutation in CERS1", "description": "" }, { "id": "MONDO:0014545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014545", "name": "progressive myoclonic epilepsy due to CERS1 deficiency", "description": "" }, { "id": "MONDO:0014545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014545", "name": "progressive myoclonus epilepsy type 8", "description": "" }, { "id": "MONDO:0014545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014545", "name": "epilepsy, progressive myoclonic, 8", "description": "" }, { "id": "MIM:616230", "resource": "MIM", "url": "https://www.omim.org/entry/616230", "name": "Epilepsy, progressive myoclonic 8", "description": "Epilepsy, progressive myoclonic 8" } ], "unlinked_id_list": [], "evidence": [ { "id": "616230", "database": "MIM", "url": "https://www.omim.org/entry/616230" }, { "id": "0111451", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111451" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000001000000000000.00000000000000.000000000001000000.00101.10.000.000", "uniprot_canonical_ac": "P27544-1" } ], "record_id": "pubmed.24782409", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A selective ATP-competitive sphingosine kinase inhibitor demonstrates anti-cancer properties.", "journal": "Oncotarget", "date": "2015", "authors": "Pitman MR, Powell JA, Coolen C, Moretti PA, Zebol JR, Pham DH, Finnie JW, Don AS, Ebert LM, Bonder CS, Gliddon BL, Pitson SM", "reference": { "type": "PubMed", "id": "25788259", "url": "https://pubmed.ncbi.nlm.nih.gov/25788259" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25788259", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Establishment of Par-Polarized Cortical Domains via Phosphoregulated Membrane Motifs.", "journal": "Developmental cell", "date": "2015", "authors": "Bailey MJ, Prehoda KE", "reference": { "type": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08111-1", "protein_name": "Lethal(2) giant larvae protein", "gene_name": "l(2)gl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q5T2T1-1", "protein_name": "MAGUK p55 subfamily member 7", "gene_name": "MPP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16554-1", "protein_name": "Protein numb", "gene_name": "numb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W3E2-1", "protein_name": "Protein PIP82", "gene_name": "PIP82", "tax_name": "Fruit fly" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 647, "end_pos": 681, "sequence_org": "AGEQLSRRKSFKKSLRESFRKLRKGRSTRTNQSNQ", "sequence_mut": "", "comment": "Reduced cortical localization and increased cytoplasmic localization.", "evidence": [ { "database": "UniProtKB", "id": "P08111", "url": "https://www.uniprot.org/uniprotkb/P08111" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P08111-1" }, { "start_pos": 653, "end_pos": 654, "sequence_org": "RR", "sequence_mut": "DD", "comment": "Reduced cortical localization and increased cytoplasmic localization.", "evidence": [ { "database": "UniProtKB", "id": "P08111", "url": "https://www.uniprot.org/uniprotkb/P08111" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P08111-1" }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "A", "comment": "In 3A; loss of phosphorylation. In the presence of aPKC remains localized to the cell cortex and does not display any decrease in phospholipid binding; when associated with A-660 and A-664.", "evidence": [ { "database": "UniProtKB", "id": "P08111", "url": "https://www.uniprot.org/uniprotkb/P08111" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P08111-1" }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "D", "comment": "In 3D; phosphomimetic mutant that displays a slight decrease in phospholipid binding and reduced cortical localization; when associated with D-660 and D-664.", "evidence": [ { "database": "UniProtKB", "id": "P08111", "url": "https://www.uniprot.org/uniprotkb/P08111" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P08111-1" }, { "start_pos": 658, "end_pos": 659, "sequence_org": "KK", "sequence_mut": "DD", "comment": "In 4k/R-D; phosphomimetic mutant that displays decreased phospholipid binding and reduced cortical localization; when associated with D-666 and D-667.", "evidence": [ { "database": "UniProtKB", "id": "P08111", "url": "https://www.uniprot.org/uniprotkb/P08111" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P08111-1" }, { "start_pos": 660, "end_pos": 660, "sequence_org": "S", "sequence_mut": "A", "comment": "In 3A; loss of phosphorylation. In the presence of aPKC remains localized to the cell cortex and does not display any decrease in phospholipid binding; when associated with A-656 and A-664.", "evidence": [ { "database": "UniProtKB", "id": "P08111", "url": "https://www.uniprot.org/uniprotkb/P08111" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P08111-1" }, { "start_pos": 660, "end_pos": 660, "sequence_org": "S", "sequence_mut": "D", "comment": "In 3D; phosphomimetic mutant that displays a slight decrease in phospholipid binding and reduced cortical localization; when associated with D-656 and D-664.", "evidence": [ { "database": "UniProtKB", "id": "P08111", "url": "https://www.uniprot.org/uniprotkb/P08111" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P08111-1" }, { "start_pos": 664, "end_pos": 664, "sequence_org": "S", "sequence_mut": "A", "comment": "In 3A; loss of phosphorylation. In the presence of aPKC remains localized to the cell cortex and does not display any decrease in phospholipid binding; when associated with A-656 and A-660.", "evidence": [ { "database": "UniProtKB", "id": "P08111", "url": "https://www.uniprot.org/uniprotkb/P08111" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P08111-1" }, { "start_pos": 664, "end_pos": 664, "sequence_org": "S", "sequence_mut": "D", "comment": "In 3D; phosphomimetic mutant that displays a slight decrease in phospholipid binding and reduced cortical localization; when associated with D-656 and D-660.", "evidence": [ { "database": "UniProtKB", "id": "P08111", "url": "https://www.uniprot.org/uniprotkb/P08111" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P08111-1" }, { "start_pos": 666, "end_pos": 667, "sequence_org": "RK", "sequence_mut": "DD", "comment": "In 4k/R-D; phosphomimetic mutant that displays decreased phospholipid binding and reduced cortical localization; when associated with 658-D--D-659.", "evidence": [ { "database": "UniProtKB", "id": "P08111", "url": "https://www.uniprot.org/uniprotkb/P08111" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P08111-1" }, { "start_pos": 24, "end_pos": 56, "sequence_org": "VKNGKSASFRFSKKSPKKMDRLRRSFRDSFRRR", "sequence_mut": "", "comment": "Reduced cortical localization and increased cytoplasmic localization.", "evidence": [ { "database": "UniProtKB", "id": "P16554", "url": "https://www.uniprot.org/uniprotkb/P16554" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P16554-1" }, { "start_pos": 36, "end_pos": 37, "sequence_org": "KK", "sequence_mut": "DD", "comment": "Slight reduction in cortical localization.", "evidence": [ { "database": "UniProtKB", "id": "P16554", "url": "https://www.uniprot.org/uniprotkb/P16554" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P16554-1" }, { "start_pos": 48, "end_pos": 48, "sequence_org": "S", "sequence_mut": "A", "comment": "In 2S-A; loss of phosphorylation. In the presence of aPKC remains localized to the cell cortex and does not display any decrease in phospholipid binding; when associated with A-52.", "evidence": [ { "database": "UniProtKB", "id": "P16554", "url": "https://www.uniprot.org/uniprotkb/P16554" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P16554-1" }, { "start_pos": 48, "end_pos": 48, "sequence_org": "S", "sequence_mut": "D", "comment": "In 2S-D; phosphomimetic mutant that displays reduced cortical localization but no significant decrease in phospholipid binding; when associated with D-52.", "evidence": [ { "database": "UniProtKB", "id": "P16554", "url": "https://www.uniprot.org/uniprotkb/P16554" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P16554-1" }, { "start_pos": 52, "end_pos": 52, "sequence_org": "S", "sequence_mut": "A", "comment": "In 2S-A; loss of phosphorylation. In the presence of aPKC remains localized to the cell cortex and does not display any decrease in phospholipid binding; when associated with A-48.", "evidence": [ { "database": "UniProtKB", "id": "P16554", "url": "https://www.uniprot.org/uniprotkb/P16554" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P16554-1" }, { "start_pos": 52, "end_pos": 52, "sequence_org": "S", "sequence_mut": "D", "comment": "In 2S-D; phosphomimetic mutant that displays reduced cortical localization but no significant decrease in phospholipid binding; when associated with D-48.", "evidence": [ { "database": "UniProtKB", "id": "P16554", "url": "https://www.uniprot.org/uniprotkb/P16554" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P16554-1" }, { "start_pos": 54, "end_pos": 55, "sequence_org": "RR", "sequence_mut": "DD", "comment": "In 4R-D; phosphomimetic mutant that displays decreased phospholipid binding and reduced cortical localization; when associated with D-46 and D-47.", "evidence": [ { "database": "UniProtKB", "id": "P16554", "url": "https://www.uniprot.org/uniprotkb/P16554" }, { "database": "PubMed", "id": "26481050", "url": "https://pubmed.ncbi.nlm.nih.gov/26481050" } ], "uniprot_canonical_ac": "P16554-1" } ], "record_id": "pubmed.26481050", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in KDSR Cause Recessive Progressive Symmetric Erythrokeratoderma.", "journal": "American journal of human genetics", "date": "2017", "authors": "Boyden LM, Vincent NG, Zhou J, Hu R, Craiglow BG, Bayliss SJ, Rosman IS, Lucky AW, Diaz LA, Goldsmith LA, Paller AS, Lifton RP, Baserga SJ, Choate KA", "reference": { "type": "PubMed", "id": "28575652", "url": "https://pubmed.ncbi.nlm.nih.gov/28575652" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs1114167452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1114167452" }, { "id": "rs1114167452", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1114167452" }, { "id": "28575652", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28575652" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 186, "end_pos": 186, "sequence_org": "Y", "sequence_mut": "F", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycolipid-related.", "chr_id": "18", "chr_pos": "63350940", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y186", "disease": [ { "disease_id": "DOID:0080250", "recommended_name": { "id": "DOID:0080250", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080250", "name": "erythrokeratodermia variabilis et progressiva 4", "description": "An erythrokeratodermia variabilis that is characterized by severe lesions of thick scaly skin on the face and genitals, as well as thickened, red, and scaly skin on the hands and feet and that has_material_basis_in compound heterozygous mutation in the KDSR gene on chromosome 18q21." }, "synonyms": [ { "id": "MONDO:0033014", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033014", "name": "erythrokeratodermia variabilis et progressiva 4", "description": "" }, { "id": "MONDO:0033014", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033014", "name": "erythrokeratodermia variabilis et progressiva 4", "description": "" }, { "id": "MONDO:0033014", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033014", "name": "EKVP4", "description": "" }, { "id": "MIM:617526", "resource": "MIM", "url": "https://www.omim.org/entry/617526", "name": "Erythrokeratodermia variabilis et progressiva 4", "description": "Erythrokeratodermia variabilis et progressiva 4" } ], "unlinked_id_list": [], "evidence": [ { "id": "617526", "database": "MIM", "url": "https://www.omim.org/entry/617526" }, { "id": "0080250", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080250" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000000100.00000000000000.000000000001000000.00101.10.000.001", "uniprot_canonical_ac": "Q06136-1" } ], "record_id": "pubmed.28575652", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discovery of a Small Side Cavity in Sphingosine Kinase 2 that Enhances Inhibitor Potency and Selectivity.", "journal": "Journal of medicinal chemistry", "date": "2020", "authors": "Sibley CD, Morris EA, Kharel Y, Brown AM, Huang T, Bevan DR, Lynch KR, Santos WL", "reference": { "type": "PubMed", "id": "31895563", "url": "https://pubmed.ncbi.nlm.nih.gov/31895563" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31895563", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CSNK1G2 differently sensitizes tamoxifen-induced decrease in PI3K/AKT/mTOR/S6K and ERK signaling according to the estrogen receptor existence in breast cancer cells.", "journal": "PloS one", "date": "2021", "authors": "Nguyen Hoang AT, Hoe KL, Lee SJ", "reference": { "type": "PubMed", "id": "33861751", "url": "https://pubmed.ncbi.nlm.nih.gov/33861751" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 118, "end_pos": 118, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P03372", "url": "https://www.uniprot.org/uniprotkb/P03372" }, { "database": "PubMed", "id": "14764652", "url": "https://pubmed.ncbi.nlm.nih.gov/14764652" }, { "database": "iPTMnet", "id": "P03372", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03372" }, { "database": "PubMed", "id": "10428798", "url": "https://pubmed.ncbi.nlm.nih.gov/10428798" }, { "database": "PRO", "id": "P03372", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P03372" }, { "database": "PubMed", "id": "18941890", "url": "https://pubmed.ncbi.nlm.nih.gov/18941890" }, { "database": "PubMed", "id": "17615152", "url": "https://pubmed.ncbi.nlm.nih.gov/17615152" }, { "database": "PubMed", "id": "10949034", "url": "https://pubmed.ncbi.nlm.nih.gov/10949034" }, { "database": "PubMed", "id": "11083859", "url": "https://pubmed.ncbi.nlm.nih.gov/11083859" }, { "database": "PubMed", "id": "12118371", "url": "https://pubmed.ncbi.nlm.nih.gov/12118371" }, { "database": "PubMed", "id": "12466266", "url": "https://pubmed.ncbi.nlm.nih.gov/12466266" }, { "database": "PubMed", "id": "12775708", "url": "https://pubmed.ncbi.nlm.nih.gov/12775708" }, { "database": "PubMed", "id": "14977836", "url": "https://pubmed.ncbi.nlm.nih.gov/14977836" }, { "database": "PubMed", "id": "15059947", "url": "https://pubmed.ncbi.nlm.nih.gov/15059947" }, { "database": "PubMed", "id": "15355923", "url": "https://pubmed.ncbi.nlm.nih.gov/15355923" }, { "database": "PubMed", "id": "15788640", "url": "https://pubmed.ncbi.nlm.nih.gov/15788640" }, { "database": "PubMed", "id": "16076840", "url": "https://pubmed.ncbi.nlm.nih.gov/16076840" }, { "database": "PubMed", "id": "16113101", "url": "https://pubmed.ncbi.nlm.nih.gov/16113101" }, { "database": "PubMed", "id": "16155796", "url": "https://pubmed.ncbi.nlm.nih.gov/16155796" }, { "database": "PubMed", "id": "16168121", "url": "https://pubmed.ncbi.nlm.nih.gov/16168121" }, { "database": "PubMed", "id": "16223974", "url": "https://pubmed.ncbi.nlm.nih.gov/16223974" }, { "database": "PubMed", "id": "16261397", "url": "https://pubmed.ncbi.nlm.nih.gov/16261397" }, { "database": "PubMed", "id": "16455819", "url": "https://pubmed.ncbi.nlm.nih.gov/16455819" }, { "database": "PubMed", "id": "16538538", "url": "https://pubmed.ncbi.nlm.nih.gov/16538538" }, { "database": "PubMed", "id": "16954434", "url": "https://pubmed.ncbi.nlm.nih.gov/16954434" }, { "database": "PubMed", "id": "17047081", "url": "https://pubmed.ncbi.nlm.nih.gov/17047081" }, { "database": "PubMed", "id": "17068199", "url": "https://pubmed.ncbi.nlm.nih.gov/17068199" }, { "database": "PubMed", "id": "17092701", "url": "https://pubmed.ncbi.nlm.nih.gov/17092701" }, { "database": "PubMed", "id": "17108142", "url": "https://pubmed.ncbi.nlm.nih.gov/17108142" }, { "database": "PubMed", "id": "17158758", "url": "https://pubmed.ncbi.nlm.nih.gov/17158758" }, { "database": "PubMed", "id": "17187784", "url": "https://pubmed.ncbi.nlm.nih.gov/17187784" }, { "database": "PubMed", "id": "17936617", "url": "https://pubmed.ncbi.nlm.nih.gov/17936617" }, { "database": "PubMed", "id": "18045953", "url": "https://pubmed.ncbi.nlm.nih.gov/18045953" }, { "database": "PubMed", "id": "18350142", "url": "https://pubmed.ncbi.nlm.nih.gov/18350142" }, { "database": "PubMed", "id": "18372406", "url": "https://pubmed.ncbi.nlm.nih.gov/18372406" }, { "database": "PubMed", "id": "18550720", "url": "https://pubmed.ncbi.nlm.nih.gov/18550720" }, { "database": "PubMed", "id": "18853184", "url": "https://pubmed.ncbi.nlm.nih.gov/18853184" }, { "database": "PubMed", "id": "19326083", "url": "https://pubmed.ncbi.nlm.nih.gov/19326083" }, { "database": "PubMed", "id": "19377875", "url": "https://pubmed.ncbi.nlm.nih.gov/19377875" }, { "database": "PubMed", "id": "20056081", "url": "https://pubmed.ncbi.nlm.nih.gov/20056081" }, { "database": "PubMed", "id": "20093341", "url": "https://pubmed.ncbi.nlm.nih.gov/20093341" }, { "database": "PubMed", "id": "20103631", "url": "https://pubmed.ncbi.nlm.nih.gov/20103631" }, { "database": "PubMed", "id": "20219974", "url": "https://pubmed.ncbi.nlm.nih.gov/20219974" }, { "database": "PubMed", "id": "20689759", "url": "https://pubmed.ncbi.nlm.nih.gov/20689759" }, { "database": "PubMed", "id": "21071990", "url": "https://pubmed.ncbi.nlm.nih.gov/21071990" }, { "database": "PubMed", "id": "21104395", "url": "https://pubmed.ncbi.nlm.nih.gov/21104395" }, { "database": "PubMed", "id": "21328450", "url": "https://pubmed.ncbi.nlm.nih.gov/21328450" }, { "database": "PubMed", "id": "21356307", "url": "https://pubmed.ncbi.nlm.nih.gov/21356307" }, { "database": "PubMed", "id": "21505052", "url": "https://pubmed.ncbi.nlm.nih.gov/21505052" }, { "database": "PubMed", "id": "21509526", "url": "https://pubmed.ncbi.nlm.nih.gov/21509526" }, { "database": "PubMed", "id": "22284681", "url": "https://pubmed.ncbi.nlm.nih.gov/22284681" }, { "database": "PubMed", "id": "22399296", "url": "https://pubmed.ncbi.nlm.nih.gov/22399296" }, { "database": "PubMed", "id": "22549111", "url": "https://pubmed.ncbi.nlm.nih.gov/22549111" }, { "database": "PubMed", "id": "22562654", "url": "https://pubmed.ncbi.nlm.nih.gov/22562654" }, { "database": "PubMed", "id": "23094148", "url": "https://pubmed.ncbi.nlm.nih.gov/23094148" }, { "database": "PubMed", "id": "23265704", "url": "https://pubmed.ncbi.nlm.nih.gov/23265704" }, { "database": "PubMed", "id": "23390529", "url": "https://pubmed.ncbi.nlm.nih.gov/23390529" }, { "database": "PubMed", "id": "23542176", "url": "https://pubmed.ncbi.nlm.nih.gov/23542176" }, { "database": "PubMed", "id": "23609470", "url": "https://pubmed.ncbi.nlm.nih.gov/23609470" }, { "database": "PubMed", "id": "23946788", "url": "https://pubmed.ncbi.nlm.nih.gov/23946788" }, { "database": "PubMed", "id": "24107627", "url": "https://pubmed.ncbi.nlm.nih.gov/24107627" }, { "database": "PubMed", "id": "24508513", "url": "https://pubmed.ncbi.nlm.nih.gov/24508513" }, { "database": "PubMed", "id": "24586459", "url": "https://pubmed.ncbi.nlm.nih.gov/24586459" }, { "database": "PubMed", "id": "24631339", "url": "https://pubmed.ncbi.nlm.nih.gov/24631339" }, { "database": "PubMed", "id": "24825747", "url": "https://pubmed.ncbi.nlm.nih.gov/24825747" }, { "database": "PubMed", "id": "25728338", "url": "https://pubmed.ncbi.nlm.nih.gov/25728338" }, { "database": "PubMed", "id": "26468985", "url": "https://pubmed.ncbi.nlm.nih.gov/26468985" }, { "database": "PubMed", "id": "26480297", "url": "https://pubmed.ncbi.nlm.nih.gov/26480297" }, { "database": "PubMed", "id": "27641443", "url": "https://pubmed.ncbi.nlm.nih.gov/27641443" }, { "database": "PubMed", "id": "27689466", "url": "https://pubmed.ncbi.nlm.nih.gov/27689466" }, { "database": "PubMed", "id": "28137613", "url": "https://pubmed.ncbi.nlm.nih.gov/28137613" }, { "database": "PubMed", "id": "28423697", "url": "https://pubmed.ncbi.nlm.nih.gov/28423697" }, { "database": "PubMed", "id": "28498246", "url": "https://pubmed.ncbi.nlm.nih.gov/28498246" }, { "database": "PubMed", "id": "28522562", "url": "https://pubmed.ncbi.nlm.nih.gov/28522562" }, { "database": "PubMed", "id": "28847747", "url": "https://pubmed.ncbi.nlm.nih.gov/28847747" }, { "database": "PubMed", "id": "29373839", "url": "https://pubmed.ncbi.nlm.nih.gov/29373839" }, { "database": "PubMed", "id": "29702197", "url": "https://pubmed.ncbi.nlm.nih.gov/29702197" }, { "database": "PubMed", "id": "30034315", "url": "https://pubmed.ncbi.nlm.nih.gov/30034315" }, { "database": "PubMed", "id": "32105160", "url": "https://pubmed.ncbi.nlm.nih.gov/32105160" }, { "database": "PubMed", "id": "33861751", "url": "https://pubmed.ncbi.nlm.nih.gov/33861751" }, { "database": "PubMed", "id": "35654737", "url": "https://pubmed.ncbi.nlm.nih.gov/35654737" }, { "database": "PubMed", "id": "36036613", "url": "https://pubmed.ncbi.nlm.nih.gov/36036613" }, { "database": "PubMed", "id": "7476978", "url": "https://pubmed.ncbi.nlm.nih.gov/7476978" }, { "database": "PubMed", "id": "7491495", "url": "https://pubmed.ncbi.nlm.nih.gov/7491495" }, { "database": "PubMed", "id": "9637719", "url": "https://pubmed.ncbi.nlm.nih.gov/9637719" }, { "database": "PubMed", "id": "9699862", "url": "https://pubmed.ncbi.nlm.nih.gov/9699862" } ], "site_lbl": "Ser118", "uniprot_canonical_ac": "P03372-1" }, { "start_pos": 167, "end_pos": 167, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK2", "evidence": [ { "database": "UniProtKB", "id": "P03372", "url": "https://www.uniprot.org/uniprotkb/P03372" }, { "database": "PRO", "id": "P03372", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P03372" }, { "database": "iPTMnet", "id": "P03372", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03372" }, { "database": "PubMed", "id": "18941890", "url": "https://pubmed.ncbi.nlm.nih.gov/18941890" }, { "database": "PubMed", "id": "19940156", "url": "https://pubmed.ncbi.nlm.nih.gov/19940156" }, { "database": "PubMed", "id": "11139588", "url": "https://pubmed.ncbi.nlm.nih.gov/11139588" }, { "database": "PubMed", "id": "11432835", "url": "https://pubmed.ncbi.nlm.nih.gov/11432835" }, { "database": "PubMed", "id": "11507039", "url": "https://pubmed.ncbi.nlm.nih.gov/11507039" }, { "database": "PubMed", "id": "15528270", "url": "https://pubmed.ncbi.nlm.nih.gov/15528270" }, { "database": "PubMed", "id": "16168121", "url": "https://pubmed.ncbi.nlm.nih.gov/16168121" }, { "database": "PubMed", "id": "16455819", "url": "https://pubmed.ncbi.nlm.nih.gov/16455819" }, { "database": "PubMed", "id": "17092701", "url": "https://pubmed.ncbi.nlm.nih.gov/17092701" }, { "database": "PubMed", "id": "17158758", "url": "https://pubmed.ncbi.nlm.nih.gov/17158758" }, { "database": "PubMed", "id": "17187784", "url": "https://pubmed.ncbi.nlm.nih.gov/17187784" }, { "database": "PubMed", "id": "17505062", "url": "https://pubmed.ncbi.nlm.nih.gov/17505062" }, { "database": "PubMed", "id": "17908967", "url": "https://pubmed.ncbi.nlm.nih.gov/17908967" }, { "database": "PubMed", "id": "18350142", "url": "https://pubmed.ncbi.nlm.nih.gov/18350142" }, { "database": "PubMed", "id": "18550720", "url": "https://pubmed.ncbi.nlm.nih.gov/18550720" }, { "database": "PubMed", "id": "19112174", "url": "https://pubmed.ncbi.nlm.nih.gov/19112174" }, { "database": "PubMed", "id": "19925796", "url": "https://pubmed.ncbi.nlm.nih.gov/19925796" }, { "database": "PubMed", "id": "20056081", "url": "https://pubmed.ncbi.nlm.nih.gov/20056081" }, { "database": "PubMed", "id": "20093341", "url": "https://pubmed.ncbi.nlm.nih.gov/20093341" }, { "database": "PubMed", "id": "21071990", "url": "https://pubmed.ncbi.nlm.nih.gov/21071990" }, { "database": "PubMed", "id": "21104395", "url": "https://pubmed.ncbi.nlm.nih.gov/21104395" }, { "database": "PubMed", "id": "21292829", "url": "https://pubmed.ncbi.nlm.nih.gov/21292829" }, { "database": "PubMed", "id": "21509526", "url": "https://pubmed.ncbi.nlm.nih.gov/21509526" }, { "database": "PubMed", "id": "22549111", "url": "https://pubmed.ncbi.nlm.nih.gov/22549111" }, { "database": "PubMed", "id": "23390529", "url": "https://pubmed.ncbi.nlm.nih.gov/23390529" }, { "database": "PubMed", "id": "23816933", "url": "https://pubmed.ncbi.nlm.nih.gov/23816933" }, { "database": "PubMed", "id": "23946788", "url": "https://pubmed.ncbi.nlm.nih.gov/23946788" }, { "database": "PubMed", "id": "24166501", "url": "https://pubmed.ncbi.nlm.nih.gov/24166501" }, { "database": "PubMed", "id": "24631339", "url": "https://pubmed.ncbi.nlm.nih.gov/24631339" }, { "database": "PubMed", "id": "24878609", "url": "https://pubmed.ncbi.nlm.nih.gov/24878609" }, { "database": "PubMed", "id": "26186972", "url": "https://pubmed.ncbi.nlm.nih.gov/26186972" }, { "database": "PubMed", "id": "26522726", "url": "https://pubmed.ncbi.nlm.nih.gov/26522726" }, { "database": "PubMed", "id": "28498246", "url": "https://pubmed.ncbi.nlm.nih.gov/28498246" }, { "database": "PubMed", "id": "29128895", "url": "https://pubmed.ncbi.nlm.nih.gov/29128895" }, { "database": "PubMed", "id": "29707142", "url": "https://pubmed.ncbi.nlm.nih.gov/29707142" }, { "database": "PubMed", "id": "30034315", "url": "https://pubmed.ncbi.nlm.nih.gov/30034315" }, { "database": "PubMed", "id": "32105160", "url": "https://pubmed.ncbi.nlm.nih.gov/32105160" }, { "database": "PubMed", "id": "33861751", "url": "https://pubmed.ncbi.nlm.nih.gov/33861751" }, { "database": "PubMed", "id": "35588983", "url": "https://pubmed.ncbi.nlm.nih.gov/35588983" }, { "database": "PubMed", "id": "7838153", "url": "https://pubmed.ncbi.nlm.nih.gov/7838153" } ], "site_lbl": "Ser167", "uniprot_canonical_ac": "P03372-1" } ], "record_id": "pubmed.33861751", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fatty Acid 2-Hydroxylase and 2-Hydroxylated Sphingolipids: Metabolism and Function in Health and Diseases.", "journal": "International journal of molecular sciences", "date": "2023-03-03", "authors": "Eckhardt Matthias", "reference": { "type": "PubMed", "id": "36902339", "url": "https://pubmed.ncbi.nlm.nih.gov/36902339" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36902339", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bifunctional DEGS2 has higher hydroxylase activity toward substrates with very-long-chain fatty acids in the production of phytosphingosine-ceramides.", "journal": "The Journal of biological chemistry", "date": "2023-03-10", "authors": "Ota Ai, Morita Hiroya, Naganuma Tatsuro, Miyamoto Masatoshi, Jojima Keisuke, Nojiri Koki, Matsuda Junko, Kihara Akio", "reference": { "type": "PubMed", "id": "36907437", "url": "https://pubmed.ncbi.nlm.nih.gov/36907437" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8R2F2-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "Degs2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36907437", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Casein kinase 1 gamma regulates oxidative stress response via interacting with the NADPH dual oxidase complex.", "journal": "PLoS genetics", "date": "2023-04", "authors": "Hu Yiman, Xu Zhaofa, Pan Qian, Ma Long", "reference": { "type": "PubMed", "id": "37099597", "url": "https://pubmed.ncbi.nlm.nih.gov/37099597" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q1HG44-1", "protein_name": "Dual oxidase maturation factor 2", "gene_name": "DUOXA2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37099597", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and functional insights into Spns2-mediated transport of sphingosine-1-phosphate.", "journal": "Cell", "date": "2023-05-17", "authors": "Chen Hongwen, Ahmed Shahbaz, Zhao Hongtu, Elghobashi-Meinhardt Nadia, Dai Yaxin, Kim Jae Hun, McDonald Jeffrey G, Li Xiaochun, Lee Chia-Hsueh", "reference": { "type": "PubMed", "id": "37224812", "url": "https://pubmed.ncbi.nlm.nih.gov/37224812" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37224812", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An erythrocyte-centric view on the MFSD2B sphingosine-1-phosphate transporter.", "journal": "Pharmacology & therapeutics", "date": "2023-09", "authors": "Ghaderi Shahrooz, Levkau Bodo", "reference": { "type": "PubMed", "id": "37390971", "url": "https://pubmed.ncbi.nlm.nih.gov/37390971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37390971", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence for a new biosynthetic pathway of sphingomyelin in SV 40 transformed mouse cells.", "journal": "Biochemical and biophysical research communications", "date": "1972", "authors": "Diringer H, Marggraf WD, Koch MA, Anderer FA", "reference": { "type": "PubMed", "id": "4339164", "url": "https://pubmed.ncbi.nlm.nih.gov/4339164" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.4339164", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The enzymatic formation of sphingomyelin from ceramide and lecithin in mouse liver.", "journal": "The Journal of biological chemistry", "date": "1974", "authors": "Ullman MD, Radin NS", "reference": { "type": "PubMed", "id": "4817756", "url": "https://pubmed.ncbi.nlm.nih.gov/4817756" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.4817756", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The product of the MLD gene is a member of the membrane fatty acid desaturase family: overexpression of MLD inhibits EGF receptor biosynthesis.", "journal": "Biochemistry", "date": "1997", "authors": "Cadena DL, Kurten RC, Gill GN", "reference": { "type": "PubMed", "id": "9188692", "url": "https://pubmed.ncbi.nlm.nih.gov/9188692" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9188692", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of ceramide synthesis. A dihydroceramide desaturase introduces the 4,5-trans-double bond of sphingosine at the level of dihydroceramide.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Michel C, van Echten-Deckert G, Rother J, Sandhoff K, Wang E, Merrill AH Jr", "reference": { "type": "PubMed", "id": "9312549", "url": "https://pubmed.ncbi.nlm.nih.gov/9312549" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9312549", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human and murine serine-palmitoyl-CoA transferase--cloning, expression and characterization of the key enzyme in sphingolipid synthesis.", "journal": "European journal of biochemistry", "date": "1997", "authors": "Weiss B, Stoffel W", "reference": { "type": "PubMed", "id": "9363775", "url": "https://pubmed.ncbi.nlm.nih.gov/9363775" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94806-1", "protein_name": "Serine/threonine-protein kinase D3", "gene_name": "PRKD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15269-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "SPTLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N138-1", "protein_name": "ORM1-like protein 3", "gene_name": "ORMDL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA82-1", "protein_name": "Ceramide synthase 4", "gene_name": "CERS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0S3-1", "protein_name": "ORM1-like protein 1", "gene_name": "ORMDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LT4-1", "protein_name": "Sphingomyelin synthase-related protein 1", "gene_name": "SAMD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O35704-1", "protein_name": "Serine palmitoyltransferase 1", "gene_name": "Sptlc1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q86VZ5-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 1", "gene_name": "SGMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G23-1", "protein_name": "Ceramide synthase 2", "gene_name": "CERS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA1-1", "protein_name": "Sphingosine kinase 1", "gene_name": "SPHK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMG9-1", "protein_name": "Ceramide synthase 6", "gene_name": "CERS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IU89-1", "protein_name": "Ceramide synthase 3", "gene_name": "CERS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27544-1", "protein_name": "Ceramide synthase 1", "gene_name": "CERS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFX1-1", "protein_name": "Sphingosine-1-phosphate transporter MFSD2B", "gene_name": "MFSD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHU3-1", "protein_name": "Phosphatidylcholine:ceramide cholinephosphotransferase 2", "gene_name": "SGMS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SGD2-1", "protein_name": "Protein phosphatase 1L", "gene_name": "PPM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15270-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "SPTLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W0-1", "protein_name": "Serine palmitoyltransferase small subunit A", "gene_name": "SPTSSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95292-1", "protein_name": "Vesicle-associated membrane protein-associated protein B/C", "gene_name": "VAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0L0-1", "protein_name": "Vesicle-associated membrane protein-associated protein A", "gene_name": "VAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43169-1", "protein_name": "Cytochrome b5 type B", "gene_name": "CYB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22059-1", "protein_name": "Oxysterol-binding protein 1", "gene_name": "OSBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15139-1", "protein_name": "Serine/threonine-protein kinase D1", "gene_name": "PRKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6QHC5-1", "protein_name": "Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2", "gene_name": "DEGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FV1-1", "protein_name": "ORM1-like protein 2", "gene_name": "ORMDL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZL6-1", "protein_name": "Serine/threonine-protein kinase D2", "gene_name": "PRKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRA0-1", "protein_name": "Sphingosine kinase 2", "gene_name": "SPHK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUV7-1", "protein_name": "Serine palmitoyltransferase 3", "gene_name": "SPTLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFR3-1", "protein_name": "Serine palmitoyltransferase small subunit B", "gene_name": "SPTSSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVW8-1", "protein_name": "Sphingosine-1-phosphate transporter SPNS2", "gene_name": "SPNS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5B7-1", "protein_name": "Ceramide synthase 5", "gene_name": "CERS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06136-1", "protein_name": "3-ketodihydrosphingosine reductase", "gene_name": "KDSR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5A8-1", "protein_name": "Fatty acid 2-hydroxylase", "gene_name": "FA2H", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97363-1", "protein_name": "Serine palmitoyltransferase 2", "gene_name": "Sptlc2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9363775", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 38 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and chromosomal mapping of human casein kinase I gamma 2 (CSNK1G2).", "journal": "Genomics", "date": "1997", "authors": "Kitabayashi A N, Kusuda J, Hirai M, Hashimoto K", "reference": { "type": "PubMed", "id": "9403068", "url": "https://pubmed.ncbi.nlm.nih.gov/9403068" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78368-1", "protein_name": "Casein kinase I isoform gamma-2", "gene_name": "CSNK1G2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78368", "url": "https://www.uniprot.org/uniprotkb/P78368" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9403068", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role for Hsp90-associated cochaperone p23 in estrogen receptor signal transduction.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Knoblauch R, Garabedian MJ", "reference": { "type": "PubMed", "id": "10207098", "url": "https://pubmed.ncbi.nlm.nih.gov/10207098" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10207098", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nonsteroid drug selectivities for cyclo-oxygenase-1 rather than cyclo-oxygenase-2 are associated with human gastrointestinal toxicity: a full in vitro analysis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Warner TD, Giuliano F, Vojnovic I, Bukasa A, Mitchell JA, Vane JR", "reference": { "type": "PubMed", "id": "10377455", "url": "https://pubmed.ncbi.nlm.nih.gov/10377455" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10377455", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multiple roles of ligand in transforming the dioxin receptor to an active basic helix-loop-helix/PAS transcription factor complex with the nuclear protein Arnt.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Lees MJ, Whitelaw ML", "reference": { "type": "PubMed", "id": "10409767", "url": "https://pubmed.ncbi.nlm.nih.gov/10409767" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A9YTQ3-1", "protein_name": "Aryl hydrocarbon receptor repressor", "gene_name": "AHRR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35869-1", "protein_name": "Aryl hydrocarbon receptor", "gene_name": "AHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27540-1", "protein_name": "Aryl hydrocarbon receptor nuclear translocator", "gene_name": "ARNT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBZ2-1", "protein_name": "Aryl hydrocarbon receptor nuclear translocator 2", "gene_name": "ARNT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00170-1", "protein_name": "AH receptor-interacting protein", "gene_name": "AIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10409767", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The interaction of raloxifene and the active metabolite of the antiestrogen EM-800 (SC 5705) with the human estrogen receptor.", "journal": "Cancer research", "date": "1999", "authors": "Schafer JI, Liu H, Tonetti DA, Jordan VC", "reference": { "type": "PubMed", "id": "10485477", "url": "https://pubmed.ncbi.nlm.nih.gov/10485477" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10485477", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Estrogen receptor beta--a new dimension in estrogen mechanism of action.", "journal": "The Journal of endocrinology", "date": "1999", "authors": "Gustafsson JA", "reference": { "type": "PubMed", "id": "10588810", "url": "https://pubmed.ncbi.nlm.nih.gov/10588810" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10588810", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA cloning, expression and characterization of human prostaglandin F synthase.", "journal": "FEBS letters", "date": "1999", "authors": "Suzuki-Yamamoto T, Nishizawa M, Fukui M, Okuda-Ashitaka E, Nakajima T, Ito S, Watanabe K", "reference": { "type": "PubMed", "id": "10622721", "url": "https://pubmed.ncbi.nlm.nih.gov/10622721" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10622721", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional probing of the human glucocorticoid receptor steroid-interacting surface by site-directed mutagenesis. Gln-642 plays an important role in steroid recognition and binding.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Lind U, Greenidge P, Gillner M, Koehler KF, Wright A, Carlstedt-Duke J", "reference": { "type": "PubMed", "id": "10747884", "url": "https://pubmed.ncbi.nlm.nih.gov/10747884" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10747884", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure and activity of human p23, a heat shock protein 90 co-chaperone.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Weaver AJ, Sullivan WP, Felts SJ, Owen BA, Toft DO", "reference": { "type": "PubMed", "id": "10811660", "url": "https://pubmed.ncbi.nlm.nih.gov/10811660" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10811660", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Control of estrogen receptor ligand binding by Hsp90.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2000", "authors": "Fliss AE, Benzeno S, Rao J, Caplan AJ", "reference": { "type": "PubMed", "id": "10822011", "url": "https://pubmed.ncbi.nlm.nih.gov/10822011" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10822011", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular identification of cytosolic prostaglandin E2 synthase that is functionally coupled with cyclooxygenase-1 in immediate prostaglandin E2 biosynthesis.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Tanioka T, Nakatani Y, Semmyo N, Murakami M, Kudo I", "reference": { "type": "PubMed", "id": "10922363", "url": "https://pubmed.ncbi.nlm.nih.gov/10922363" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83868-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "Ptges3", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10922363", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cyclooxygenases: structural, cellular, and molecular biology.", "journal": "Annual review of biochemistry", "date": "2000", "authors": "Smith WL, DeWitt DL, Garavito RM", "reference": { "type": "PubMed", "id": "10966456", "url": "https://pubmed.ncbi.nlm.nih.gov/10966456" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35355-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "Ptgs2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63921-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "Ptgs1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22437-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "Ptgs1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05769-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "Ptgs2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10966456", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pyrazole ligands: structure-affinity/activity relationships and estrogen receptor-alpha-selective agonists.", "journal": "Journal of medicinal chemistry", "date": "2000", "authors": "Stauffer SR, Coletta CJ, Tedesco R, Nishiguchi G, Carlson K, Sun J, Katzenellenbogen BS, Katzenellenbogen JA", "reference": { "type": "PubMed", "id": "11150164", "url": "https://pubmed.ncbi.nlm.nih.gov/11150164" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11150164", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular mechanisms of estrogen action: selective ligands and receptor pharmacology.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2000", "authors": "Katzenellenbogen BS, Choi I, Delage-Mourroux R, Ediger TR, Martini PG, Montano M, Sun J, Weis K, Katzenellenbogen JA", "reference": { "type": "PubMed", "id": "11162936", "url": "https://pubmed.ncbi.nlm.nih.gov/11162936" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11162936", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Estrogen receptor transcription and transactivation: Structure-function relationship in DNA- and ligand-binding domains of estrogen receptors.", "journal": "Breast cancer research : BCR", "date": "2000", "authors": "Ruff M, Gangloff M, Wurtz JM, Moras D", "reference": { "type": "PubMed", "id": "11250728", "url": "https://pubmed.ncbi.nlm.nih.gov/11250728" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11250728", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The hsp90 chaperone complex regulates intracellular localization of the dioxin receptor.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Kazlauskas A, Sundstrom S, Poellinger L, Pongratz I", "reference": { "type": "PubMed", "id": "11259606", "url": "https://pubmed.ncbi.nlm.nih.gov/11259606" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A9YTQ3-1", "protein_name": "Aryl hydrocarbon receptor repressor", "gene_name": "AHRR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35869-1", "protein_name": "Aryl hydrocarbon receptor", "gene_name": "AHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27540-1", "protein_name": "Aryl hydrocarbon receptor nuclear translocator", "gene_name": "ARNT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBZ2-1", "protein_name": "Aryl hydrocarbon receptor nuclear translocator 2", "gene_name": "ARNT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00170-1", "protein_name": "AH receptor-interacting protein", "gene_name": "AIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11259606", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stable association of hsp90 and p23, but Not hsp70, with active human telomerase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Forsythe HL, Jarvis JL, Turner JW, Elmore LW, Holt SE", "reference": { "type": "PubMed", "id": "11274138", "url": "https://pubmed.ncbi.nlm.nih.gov/11274138" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A9YTQ3-1", "protein_name": "Aryl hydrocarbon receptor repressor", "gene_name": "AHRR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35869-1", "protein_name": "Aryl hydrocarbon receptor", "gene_name": "AHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27540-1", "protein_name": "Aryl hydrocarbon receptor nuclear translocator", "gene_name": "ARNT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBZ2-1", "protein_name": "Aryl hydrocarbon receptor nuclear translocator 2", "gene_name": "ARNT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00170-1", "protein_name": "AH receptor-interacting protein", "gene_name": "AIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11274138", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Substrate binding is the rate-limiting step in thromboxane synthase catalysis.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wang LH, Tsai AL, Hsu PY", "reference": { "type": "PubMed", "id": "11297515", "url": "https://pubmed.ncbi.nlm.nih.gov/11297515" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11297515", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of genetic variants in the human thromboxane synthase gene (CYP5A1).", "journal": "Mutation research", "date": "2001", "authors": "Chevalier D, Lo-Guidice JM, Sergent E, Allorge D, Debuysere H, Ferrari N, Libersa C, Lhermitte M, Broly F", "reference": { "type": "PubMed", "id": "11465543", "url": "https://pubmed.ncbi.nlm.nih.gov/11465543" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11465543", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tissue-specific expression pattern of estrogen receptors (ER): quantification of ER alpha and ER beta mRNA with real-time RT-PCR.", "journal": "APMIS : acta pathologica, microbiologica, et immunologica Scandinavica", "date": "2001", "authors": "Pfaffl MW, Lange IG, Daxenberger A, Meyer HH", "reference": { "type": "PubMed", "id": "11478682", "url": "https://pubmed.ncbi.nlm.nih.gov/11478682" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11478682", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A review of the chemistry, biological action, and clinical applications of anabolic-androgenic steroids.", "journal": "Clinical therapeutics", "date": "2001", "authors": "Shahidi NT", "reference": { "type": "PubMed", "id": "11589254", "url": "https://pubmed.ncbi.nlm.nih.gov/11589254" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11589254", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mammalian class Sigma glutathione S-transferases: catalytic properties and tissue-specific expression of human and rat GSH-dependent prostaglandin D2 synthases.", "journal": "The Biochemical journal", "date": "2001", "authors": "Jowsey IR, Thomson AM, Flanagan JU, Murdock PR, Moore GB, Meyer DJ, Murphy GJ, Smith SA, Hayes JD", "reference": { "type": "PubMed", "id": "11672424", "url": "https://pubmed.ncbi.nlm.nih.gov/11672424" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O35543-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "Hpgds", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11672424", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clinical review 138: Anabolic-androgenic steroid therapy in the treatment of chronic diseases.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Basaria S, Wahlstrom JT, Dobs AS", "reference": { "type": "PubMed", "id": "11701661", "url": "https://pubmed.ncbi.nlm.nih.gov/11701661" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11701661", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A new first step in activation of steroid receptors: hormone-induced switching of FKBP51 and FKBP52 immunophilins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Davies TH, Ning YM, Sanchez ER", "reference": { "type": "PubMed", "id": "11751894", "url": "https://pubmed.ncbi.nlm.nih.gov/11751894" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q64378-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "Fkbp5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P07901-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "Hsp90aa1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30416-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "Fkbp4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06537-1", "protein_name": "Glucocorticoid receptor", "gene_name": "Nr3c1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11751894", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 61 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]