[ { "title": "Interaction with XIAP prevents full caspase-3/-7 activation in proliferating human T lymphocytes.", "journal": "European journal of immunology", "date": "2008", "authors": "Paulsen M, Ussat S, Jakob M, Scherer G, Lepenies I, Schutze S, Kabelitz D, Adam-Klages S", "reference": { "type": "PubMed", "id": "18521960", "url": "https://pubmed.ncbi.nlm.nih.gov/18521960" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07812-1", "protein_name": "Apoptosis regulator BAX", "gene_name": "BAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16611-1", "protein_name": "Bcl-2 homologous antagonist/killer", "gene_name": "BAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55210-1", "protein_name": "Caspase-7", "gene_name": "CASP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42574-1", "protein_name": "Caspase-3", "gene_name": "CASP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18521960", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mechanistic insight into SMAC peptide interference with XIAP-Bir2 inhibition of executioner caspases.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Abhari BA, Davoodi J", "reference": { "type": "PubMed", "id": "18619610", "url": "https://pubmed.ncbi.nlm.nih.gov/18619610" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55211-1", "protein_name": "Caspase-9", "gene_name": "CASP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P99999-1", "protein_name": "Cytochrome c", "gene_name": "CYCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07812-1", "protein_name": "Apoptosis regulator BAX", "gene_name": "BAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16611-1", "protein_name": "Bcl-2 homologous antagonist/killer", "gene_name": "BAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55210-1", "protein_name": "Caspase-7", "gene_name": "CASP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42574-1", "protein_name": "Caspase-3", "gene_name": "CASP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18619610", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structure of the BIR3 domain of cIAP1 in complex with the N-terminal peptides of SMAC and caspase-9.", "journal": "Acta Crystallogr. D", "date": "2009", "authors": "Kulathila Raviraj, Vash Brian, Sage David, Cornell-Kennon Susan, Wright Kirk, Koehn James, Stams Travis, Clark Kirk, Price Allen", "reference": { "type": "PubMed", "id": "19153467", "url": "https://pubmed.ncbi.nlm.nih.gov/19153467" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19153467", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Survivin monomer plays an essential role in apoptosis regulation.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Pavlyukov Marat S, Antipova Nadezhda V, Balashova Maria V, Vinogradova Tatjana V, Kopantzev Evgenij P, Shakhparonov Mihail I", "reference": { "type": "PubMed", "id": "21536684", "url": "https://pubmed.ncbi.nlm.nih.gov/21536684" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15392-1", "protein_name": "Baculoviral IAP repeat-containing protein 5", "gene_name": "BIRC5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21536684", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional mutation of SMAC/DIABLO, encoding a mitochondrial proapoptotic protein, causes human progressive hearing loss DFNA64.", "journal": "American journal of human genetics", "date": "2011", "authors": "Cheng J, Zhu Y, He S, Lu Y, Chen J, Han B, Petrillo M, Wrzeszczynski KO, Yang S, Dai P, Zhai S, Han D, Zhang MQ, Li W, Liu X, Li H, Chen ZY, Yuan H", "reference": { "type": "PubMed", "id": "21722859", "url": "https://pubmed.ncbi.nlm.nih.gov/21722859" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21722859", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanism of the interaction between the intrinsically disordered C-terminus of the pro-apoptotic ARTS protein and the Bir3 domain of XIAP.", "journal": "PloS one", "date": "2011", "authors": "Reingewertz TH, Shalev DE, Sukenik S, Blatt O, Rotem-Bamberger S, Lebendiker M, Larisch S, Friedler A", "reference": { "type": "PubMed", "id": "21949740", "url": "https://pubmed.ncbi.nlm.nih.gov/21949740" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07812-1", "protein_name": "Apoptosis regulator BAX", "gene_name": "BAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16611-1", "protein_name": "Bcl-2 homologous antagonist/killer", "gene_name": "BAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55210-1", "protein_name": "Caspase-7", "gene_name": "CASP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42574-1", "protein_name": "Caspase-3", "gene_name": "CASP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21949740", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of Smac by Akt promotes the caspase-3 activation during etoposide-induced apoptosis in HeLa cells.", "journal": "Molecular carcinogenesis", "date": "2015", "authors": "Jeong CH, Chun KS, Kundu J, Park B", "reference": { "type": "PubMed", "id": "24038446", "url": "https://pubmed.ncbi.nlm.nih.gov/24038446" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 67, "end_pos": 67, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NR28", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NR28" }, { "database": "PubMed", "id": "24038446", "url": "https://pubmed.ncbi.nlm.nih.gov/24038446" }, { "database": "PubMed", "id": "26458825", "url": "https://pubmed.ncbi.nlm.nih.gov/26458825" } ], "site_lbl": "Ser67", "uniprot_canonical_ac": "Q9NR28-1" } ], "record_id": "pubmed.24038446", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and biochemical basis for the inhibition of cell death by APIP, a methionine salvage enzyme.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Kang W, Hong SH, Lee HM, Kim NY, Lim YC, Le le TM, Lim B, Kim HC, Kim TY, Ashida H, Yokota A, Hah SS, Chun KH, Jung YK, Yang JK", "reference": { "type": "PubMed", "id": "24367089", "url": "https://pubmed.ncbi.nlm.nih.gov/24367089" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55211-1", "protein_name": "Caspase-9", "gene_name": "CASP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P99999-1", "protein_name": "Cytochrome c", "gene_name": "CYCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GX9-1", "protein_name": "Methylthioribulose-1-phosphate dehydratase", "gene_name": "APIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQS1-1", "protein_name": "Cell death regulator Aven", "gene_name": "AVEN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2G2-5", "protein_name": "Caspase recruitment domain-containing protein 8", "gene_name": "CARD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZF9-1", "protein_name": "Uveal autoantigen with coiled-coil domains and ankyrin repeats", "gene_name": "UACA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 115, "end_pos": 115, "sequence_org": "H", "sequence_mut": "A", "comment": "Almost complete loss of enzyme activity. Abolishes protection against pyroptosis. No effect on anti-apoptotic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96GX9", "url": "https://www.uniprot.org/uniprotkb/Q96GX9" }, { "database": "PubMed", "id": "24367089", "url": "https://pubmed.ncbi.nlm.nih.gov/24367089" } ], "uniprot_canonical_ac": "Q96GX9-1" }, { "start_pos": 139, "end_pos": 139, "sequence_org": "E", "sequence_mut": "A", "comment": "Almost complete loss of enzyme activity. Abolishes protection against pyroptosis. No effect on anti-apoptotic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96GX9", "url": "https://www.uniprot.org/uniprotkb/Q96GX9" }, { "database": "PubMed", "id": "24367089", "url": "https://pubmed.ncbi.nlm.nih.gov/24367089" } ], "uniprot_canonical_ac": "Q96GX9-1" }, { "start_pos": 96, "end_pos": 96, "sequence_org": "Q", "sequence_mut": "A", "comment": "Mildly reduced enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96GX9", "url": "https://www.uniprot.org/uniprotkb/Q96GX9" }, { "database": "PubMed", "id": "24367089", "url": "https://pubmed.ncbi.nlm.nih.gov/24367089" } ], "uniprot_canonical_ac": "Q96GX9-1" }, { "start_pos": 97, "end_pos": 97, "sequence_org": "C", "sequence_mut": "A", "comment": "Almost complete loss of enzyme activity. Abolishes protection against pyroptosis. No effect on anti-apoptotic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96GX9", "url": "https://www.uniprot.org/uniprotkb/Q96GX9" }, { "database": "PubMed", "id": "24367089", "url": "https://pubmed.ncbi.nlm.nih.gov/24367089" } ], "uniprot_canonical_ac": "Q96GX9-1" } ], "record_id": "pubmed.24367089", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "JNK1mediated phosphorylation of Smac/DIABLO at the serine 6 residue is functionally linked to its mitochondrial release during TNFalpha-induced apoptosis of HeLa cells.", "journal": "Molecular medicine reports", "date": "2014", "authors": "Park B", "reference": { "type": "PubMed", "id": "25310587", "url": "https://pubmed.ncbi.nlm.nih.gov/25310587" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NR28", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NR28" }, { "database": "PubMed", "id": "25310587", "url": "https://pubmed.ncbi.nlm.nih.gov/25310587" } ], "site_lbl": "Ser6", "uniprot_canonical_ac": "Q9NR28-1" } ], "record_id": "pubmed.25310587", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Akt is translocated to the mitochondria during etoposide-induced apoptosis of HeLa cells.", "journal": "Molecular medicine reports", "date": "2015", "authors": "Park B, Je YT, Chun KH", "reference": { "type": "PubMed", "id": "26458825", "url": "https://pubmed.ncbi.nlm.nih.gov/26458825" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 67, "end_pos": 67, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NR28", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NR28" }, { "database": "PubMed", "id": "24038446", "url": "https://pubmed.ncbi.nlm.nih.gov/24038446" }, { "database": "PubMed", "id": "26458825", "url": "https://pubmed.ncbi.nlm.nih.gov/26458825" } ], "site_lbl": "Ser67", "uniprot_canonical_ac": "Q9NR28-1" } ], "record_id": "pubmed.26458825", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PARL mediates Smac proteolytic maturation in mitochondria to promote apoptosis.", "journal": "Nature cell biology", "date": "2017", "authors": "Saita S, Nolte H, Fiedler KU, Kashkar H, Venne AS, Zahedi RP, Kruger M, Langer T", "reference": { "type": "PubMed", "id": "28288130", "url": "https://pubmed.ncbi.nlm.nih.gov/28288130" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H078-1", "protein_name": "Mitochondrial disaggregase", "gene_name": "CLPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H300-1", "protein_name": "Presenilin-associated rhomboid-like protein, mitochondrial", "gene_name": "PARL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6DKK2-1", "protein_name": "Tetratricopeptide repeat protein 19, mitochondrial", "gene_name": "TTC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 277, "end_pos": 277, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of cleavage of CLPB, DIABLO, STARD7 and TTC19.", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "28288130", "url": "https://pubmed.ncbi.nlm.nih.gov/28288130" }, { "database": "PubMed", "id": "29301859", "url": "https://pubmed.ncbi.nlm.nih.gov/29301859" } ], "uniprot_canonical_ac": "Q9H300-1" } ], "record_id": "pubmed.28288130", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structures of BIRC6-client complexes provide a mechanism of SMAC-mediated release of caspases.", "journal": "Science (New York, N.Y.)", "date": "2023-03-17", "authors": "Hunkeler Moritz, Jin Cyrus Y, Fischer Eric S", "reference": { "type": "PubMed", "id": "36758104", "url": "https://pubmed.ncbi.nlm.nih.gov/36758104" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55210-1", "protein_name": "Caspase-7", "gene_name": "CASP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42574-1", "protein_name": "Caspase-3", "gene_name": "CASP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43464-1", "protein_name": "Serine protease HTRA2, mitochondrial", "gene_name": "HTRA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR09-1", "protein_name": "Dual E2 ubiquitin-conjugating enzyme/E3 ubiquitin-protein ligase BIRC6", "gene_name": "BIRC6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 56, "end_pos": 56, "sequence_org": "A", "sequence_mut": "M", "comment": "Fails to inhibit BIRC6 activity. Fails to inhibit digestion of BIRC6 by CASP3, CASP7 or HTRA2 mutant 'A-306'.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" }, { "database": "PubMed", "id": "36758104", "url": "https://pubmed.ncbi.nlm.nih.gov/36758104" } ], "uniprot_canonical_ac": "Q9NR28-1" }, { "start_pos": 1616, "end_pos": 1666, "sequence_org": "ALQSLSHAMASAEQQLQVLQEKQQQLLKLQQQKAKLEAKLHQTTAAAAAAA", "sequence_mut": "", "comment": "Slightly impairs interaction with DIABLO/SMAC. Abolishes interaction with DIABLO/SMAC and impairs ubiquitination of DIABLO/SMAC; when associated with S-328 and S-331.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758104", "url": "https://pubmed.ncbi.nlm.nih.gov/36758104" } ], "uniprot_canonical_ac": "Q9NR09-1" }, { "start_pos": 328, "end_pos": 328, "sequence_org": "C", "sequence_mut": "S", "comment": "Impairs ubiquitination of CASP3, CASP7 and HTRA2 mutant 'A-306'; when associated with S-331. Abolishes interaction with DIABLO/SMAC and impairs ubiquitination of DIABLO/SMAC; when associated with S-331 and 1616-A--A-1666 del.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758104", "url": "https://pubmed.ncbi.nlm.nih.gov/36758104" } ], "uniprot_canonical_ac": "Q9NR09-1" }, { "start_pos": 331, "end_pos": 331, "sequence_org": "C", "sequence_mut": "S", "comment": "Impairs ubiquitination of CASP3, CASP7 and HTRA2 mutant 'A-306'; when associated with S-328. Abolishes interaction with DIABLO/SMAC and impairs ubiquitination of DIABLO/SMAC; when associated with S-328 and 1616-A--A-1666 del.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758104", "url": "https://pubmed.ncbi.nlm.nih.gov/36758104" } ], "uniprot_canonical_ac": "Q9NR09-1" } ], "record_id": "pubmed.36758104", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for regulation of apoptosis and autophagy by the BIRC6/SMAC complex.", "journal": "Science (New York, N.Y.)", "date": "2023-03-17", "authors": "Ehrmann Julian F, Grabarczyk Daniel B, Heinke Maria, Deszcz Luiza, Kurzbauer Robert, Hudecz Otto, Shulkina Alexandra, Gogova Rebeca, Meinhart Anton, Versteeg Gijs A, Clausen Tim", "reference": { "type": "PubMed", "id": "36758105", "url": "https://pubmed.ncbi.nlm.nih.gov/36758105" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55211-1", "protein_name": "Caspase-9", "gene_name": "CASP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZQ8-1", "protein_name": "Microtubule-associated protein 1 light chain 3 beta", "gene_name": "MAP1LC3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43464-1", "protein_name": "Serine protease HTRA2, mitochondrial", "gene_name": "HTRA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR09-1", "protein_name": "Dual E2 ubiquitin-conjugating enzyme/E3 ubiquitin-protein ligase BIRC6", "gene_name": "BIRC6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 2228, "end_pos": 2295, "sequence_org": "SRKIRKQLVHHKQQLNLLKAKQKALVEQMEKEKIQSNKGSSYKLLVEQAKLKQATSKHFKDLIRLRRT", "sequence_mut": "", "comment": "Impairs DIABLO/SMAC inhibition on the ubiquitination of MAP1LC3B by BIRC6. Enhances ubiquitination of DIABLO/SMAC. Severely impairs DIABLO/SMAC inhibition on the ubiquitination of MAP1LC3B by BIRC6; when associated with Q-342 and 3190-A--A-3193. Enhances ubiquitination of DIABLO/SMAC; when associated with Q-342 and 3190-A--A-3193.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758105", "url": "https://pubmed.ncbi.nlm.nih.gov/36758105" } ], "uniprot_canonical_ac": "Q9NR09-1" }, { "start_pos": 3190, "end_pos": 3193, "sequence_org": "RRAR", "sequence_mut": "AAAA", "comment": "No effect on DIABLO/SMAC inhibition on the ubiquitination of MAP1LC3B by BIRC6. No effect on ubiquitination of DIABLO/SMAC. Severely impairs DIABLO/SMAC inhibition on the ubiquitination of MAP1LC3B by BIRC6; when associated with Q-342 and 2228-S--T-2295 del. Enhances ubiquitination of DIABLO/SMAC; when associated with Q-342 and 2228-S--T-2295 del.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758105", "url": "https://pubmed.ncbi.nlm.nih.gov/36758105" } ], "uniprot_canonical_ac": "Q9NR09-1" }, { "start_pos": 342, "end_pos": 342, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolishes interaction with CASP3 and the caspase inhibition activity on CASP3. Impairs interaction with CASP7 and abolishes the caspase inhibition activity on CASP7. Abolishes interaction with CASP9. Abolishes interaction with monomeric DIABLO/SMAC 'D-81' mutant. Abolishes interaction with N-degron peptide from DIABLO/SMAC.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758106", "url": "https://pubmed.ncbi.nlm.nih.gov/36758106" }, { "database": "PubMed", "id": "36758105", "url": "https://pubmed.ncbi.nlm.nih.gov/36758105" } ], "uniprot_canonical_ac": "Q9NR09-1" }, { "start_pos": 342, "end_pos": 342, "sequence_org": "D", "sequence_mut": "Q", "comment": "Fails to ubiquitinate N-degron peptide from HTRA2. Impairs DIABLO/SMAC inhibition on the ubiquitination of MAP1LC3B by BIRC6. Enhances ubiquitination of DIABLO/SMAC. Impairs interaction with DIABLO/SMAC; when associated with H-351. Severely impairs DIABLO/SMAC inhibition on the ubiquitination of MAP1LC3B by BIRC6; when associated with 2228-S--T-2295 del and 3190-A--A-3193. Enhances ubiquitination of DIABLO/SMAC; when associated with 2228-S--T-2295 del and 3190-A--A-3193.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758105", "url": "https://pubmed.ncbi.nlm.nih.gov/36758105" } ], "uniprot_canonical_ac": "Q9NR09-1" }, { "start_pos": 351, "end_pos": 351, "sequence_org": "H", "sequence_mut": "D", "comment": "Impairs interaction with CASP3 and abolishes the caspase inhibition activity on CASP3. Impairs interaction with CASP7 but has little effect on the caspase inhibition activity on CASP7. Impairs interaction with CASP9. Impairs interaction with monomeric DIABLO/SMAC 'D-81' mutant. Impairs interaction with N-degron peptide from DIABLO/SMAC. Impairs interaction with DIABLO/SMAC; when associated with A-342.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758106", "url": "https://pubmed.ncbi.nlm.nih.gov/36758106" }, { "database": "PubMed", "id": "36758105", "url": "https://pubmed.ncbi.nlm.nih.gov/36758105" } ], "uniprot_canonical_ac": "Q9NR09-1" }, { "start_pos": 4094, "end_pos": 4145, "sequence_org": "VIQQVSAPVVTSTTQEKPKDSDQFEWVTIEQSGELVYEAPETVAAEPPPIKS", "sequence_mut": "", "comment": "Impairs MAP1LC3B ubiquitination without disrupting HTRA2 ubiquitination.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758105", "url": "https://pubmed.ncbi.nlm.nih.gov/36758105" } ], "uniprot_canonical_ac": "Q9NR09-1" }, { "start_pos": 4666, "end_pos": 4666, "sequence_org": "C", "sequence_mut": "A", "comment": "Catalytically inactive; fails to autoubiquitinate in the presence of UBA6.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758105", "url": "https://pubmed.ncbi.nlm.nih.gov/36758105" } ], "uniprot_canonical_ac": "Q9NR09-1" } ], "record_id": "pubmed.36758105", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for SMAC-mediated antagonism of caspase inhibition by the giant ubiquitin ligase BIRC6.", "journal": "Science (New York, N.Y.)", "date": "2023-03-17", "authors": "Dietz Larissa, Ellison Cara J, Riechmann Carlos, Cassidy C Keith, Felfoldi F Daniel, Pinto-Fern\u00e1ndez Ad\u00e1n, Kessler Benedikt M, Elliott Paul R", "reference": { "type": "PubMed", "id": "36758106", "url": "https://pubmed.ncbi.nlm.nih.gov/36758106" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55211-1", "protein_name": "Caspase-9", "gene_name": "CASP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55210-1", "protein_name": "Caspase-7", "gene_name": "CASP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42574-1", "protein_name": "Caspase-3", "gene_name": "CASP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR09-1", "protein_name": "Dual E2 ubiquitin-conjugating enzyme/E3 ubiquitin-protein ligase BIRC6", "gene_name": "BIRC6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 81, "end_pos": 81, "sequence_org": "V", "sequence_mut": "D", "comment": "Monomeric. Impairs interaction with BIRC6. Impairs ability to inhibit BIRC6 caspase ubiquitination.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" }, { "database": "PubMed", "id": "36758106", "url": "https://pubmed.ncbi.nlm.nih.gov/36758106" } ], "uniprot_canonical_ac": "Q9NR28-1" }, { "start_pos": 3189, "end_pos": 3193, "sequence_org": "HRRAR", "sequence_mut": "AAAAA", "comment": "Impairs interaction with monomeric DIABLO/SMAC 'D-81' mutant.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758106", "url": "https://pubmed.ncbi.nlm.nih.gov/36758106" } ], "uniprot_canonical_ac": "Q9NR09-1" }, { "start_pos": 3189, "end_pos": 3193, "sequence_org": "HRRAR", "sequence_mut": "DDDDD", "comment": "Impairs interaction with CASP7 and mildly impairs the caspase inhibition activity on CASP7. Impairs interaction with monomeric DIABLO/SMAC 'D-81' mutant. Impairs interaction with DIABLO/SMAC; when associated with A-342. Abolishes interaction with monomeric DIABLO/SMAC 'D-81' mutant; when associated with A-342.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758106", "url": "https://pubmed.ncbi.nlm.nih.gov/36758106" } ], "uniprot_canonical_ac": "Q9NR09-1" }, { "start_pos": 342, "end_pos": 342, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolishes interaction with CASP3 and the caspase inhibition activity on CASP3. Impairs interaction with CASP7 and abolishes the caspase inhibition activity on CASP7. Abolishes interaction with CASP9. Abolishes interaction with monomeric DIABLO/SMAC 'D-81' mutant. Abolishes interaction with N-degron peptide from DIABLO/SMAC.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758106", "url": "https://pubmed.ncbi.nlm.nih.gov/36758106" }, { "database": "PubMed", "id": "36758105", "url": "https://pubmed.ncbi.nlm.nih.gov/36758105" } ], "uniprot_canonical_ac": "Q9NR09-1" }, { "start_pos": 351, "end_pos": 351, "sequence_org": "H", "sequence_mut": "D", "comment": "Impairs interaction with CASP3 and abolishes the caspase inhibition activity on CASP3. Impairs interaction with CASP7 but has little effect on the caspase inhibition activity on CASP7. Impairs interaction with CASP9. Impairs interaction with monomeric DIABLO/SMAC 'D-81' mutant. Impairs interaction with N-degron peptide from DIABLO/SMAC. Impairs interaction with DIABLO/SMAC; when associated with A-342.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR09", "url": "https://www.uniprot.org/uniprotkb/Q9NR09" }, { "database": "PubMed", "id": "36758106", "url": "https://pubmed.ncbi.nlm.nih.gov/36758106" }, { "database": "PubMed", "id": "36758105", "url": "https://pubmed.ncbi.nlm.nih.gov/36758105" } ], "uniprot_canonical_ac": "Q9NR09-1" } ], "record_id": "pubmed.36758106", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AREL1 resists the apoptosis induced by TGF-\u03b2 by inhibiting SMAC in vascular endothelial cells.", "journal": "Journal of biochemical and molecular toxicology", "date": "2023-07-31", "authors": "Li Yun, Song Yunhong, Liang Yulian", "reference": { "type": "PubMed", "id": "37522329", "url": "https://pubmed.ncbi.nlm.nih.gov/37522329" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15033-1", "protein_name": "Apoptosis-resistant E3 ubiquitin protein ligase 1", "gene_name": "AREL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37522329", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "In vivo and in vitro studies on the role of regulating Smac expression in the occurrence and development of colon cancer.", "journal": "Cellular and molecular biology (Noisy-le-Grand, France)", "date": "2024-06-05", "authors": "Zhang Donglei, Yang Ning", "reference": { "type": "PubMed", "id": "38836659", "url": "https://pubmed.ncbi.nlm.nih.gov/38836659" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38836659", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "X-linked IAP is a direct inhibitor of cell-death proteases.", "journal": "Nature", "date": "1997", "authors": "Deveraux QL, Takahashi R, Salvesen GS, Reed JC", "reference": { "type": "PubMed", "id": "9230442", "url": "https://pubmed.ncbi.nlm.nih.gov/9230442" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NR28-1", "protein_name": "Diablo IAP-binding mitochondrial protein", "gene_name": "DIABLO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55211-1", "protein_name": "Caspase-9", "gene_name": "CASP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P99999-1", "protein_name": "Cytochrome c", "gene_name": "CYCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07812-1", "protein_name": "Apoptosis regulator BAX", "gene_name": "BAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16611-1", "protein_name": "Bcl-2 homologous antagonist/killer", "gene_name": "BAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55210-1", "protein_name": "Caspase-7", "gene_name": "CASP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42574-1", "protein_name": "Caspase-3", "gene_name": "CASP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NR28", "url": "https://www.uniprot.org/uniprotkb/Q9NR28" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9230442", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of ACP33 as a novel intracellular ligand of CD4.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Zeitlmann L, Sirim P, Kremmer E, Kolanus W", "reference": { "type": "PubMed", "id": "11113139", "url": "https://pubmed.ncbi.nlm.nih.gov/11113139" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZD8-1", "protein_name": "Maspardin", "gene_name": "SPG21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01730-1", "protein_name": "T-cell surface glycoprotein CD4", "gene_name": "CD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9CQC8-1", "protein_name": "Maspardin", "gene_name": "Spg21", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZD8", "url": "https://www.uniprot.org/uniprotkb/Q9NZD8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 109, "end_pos": 109, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes interaction with CD4.", "evidence": [ { "database": "UniProtKB", "id": "Q9NZD8", "url": "https://www.uniprot.org/uniprotkb/Q9NZD8" }, { "database": "PubMed", "id": "11113139", "url": "https://pubmed.ncbi.nlm.nih.gov/11113139" } ], "uniprot_canonical_ac": "Q9NZD8-1" }, { "start_pos": 457, "end_pos": 458, "sequence_org": "PI", "sequence_mut": "", "comment": "Abolished interaction with SPG21 and induced T-cell activation.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprotkb/P01730" }, { "database": "PubMed", "id": "11113139", "url": "https://pubmed.ncbi.nlm.nih.gov/11113139" } ], "uniprot_canonical_ac": "P01730-1" } ], "record_id": "pubmed.11113139", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Maspardin is mutated in Mast syndrome, a complicated form of hereditary spastic paraplegia associated with dementia.", "journal": "Am. J. Hum. Genet.", "date": "2003", "authors": "Simpson MA, Cross H, Proukakis C, Pryde A, Hershberger R, Chatonnet A, Patton MA, Crosby AH", "reference": { "type": "PubMed", "id": "14564668", "url": "https://pubmed.ncbi.nlm.nih.gov/14564668" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZD8-1", "protein_name": "Maspardin", "gene_name": "SPG21", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZD8", "url": "https://www.uniprot.org/uniprotkb/Q9NZD8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14564668", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of the SPG21 protein ACP33/maspardin with the aldehyde dehydrogenase ALDH16A1.", "journal": "Neurogenetics", "date": "2009", "authors": "Hanna MC, Blackstone C", "reference": { "type": "PubMed", "id": "19184135", "url": "https://pubmed.ncbi.nlm.nih.gov/19184135" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZD8-1", "protein_name": "Maspardin", "gene_name": "SPG21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZ83-1", "protein_name": "Aldehyde dehydrogenase family 16 member A1", "gene_name": "ALDH16A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZD8", "url": "https://www.uniprot.org/uniprotkb/Q9NZD8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19184135", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SPG21, a potential oncogene targeted by miR-128-3p, amplifies HBx-induced carcinogenesis and chemoresistance via activation of TRPM7-mediated JNK pathway in hepatocellular carcinoma.", "journal": "Cellular oncology (Dordrecht, Netherlands)", "date": "2024-10", "authors": "Zhou Ping, Yao Wei, Liu Lijuan, Yan Qiujin, Chen Xiaobei, Wei Xiaocui, Ding Shuang, Lv Zhao, Zhu Fan", "reference": { "type": "PubMed", "id": "38753154", "url": "https://pubmed.ncbi.nlm.nih.gov/38753154" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZD8-1", "protein_name": "Maspardin", "gene_name": "SPG21", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZD8", "url": "https://www.uniprot.org/uniprotkb/Q9NZD8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38753154", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of telomere-binding activity of replication factor C large subunit p140.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Uchiumi F, Watanabe M, Tanuma Si", "reference": { "type": "PubMed", "id": "10329413", "url": "https://pubmed.ncbi.nlm.nih.gov/10329413" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCU8-1", "protein_name": "DNA polymerase delta subunit 4", "gene_name": "POLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28340-1", "protein_name": "DNA polymerase delta catalytic subunit", "gene_name": "POLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15054-1", "protein_name": "DNA polymerase delta subunit 3", "gene_name": "POLD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49005-1", "protein_name": "DNA polymerase delta subunit 2", "gene_name": "POLD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG13-1", "protein_name": "Chromosome transmission fidelity protein 8 homolog", "gene_name": "CHTF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVB6-1", "protein_name": "Chromosome transmission fidelity protein 18 homolog", "gene_name": "CHTF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVC3-1", "protein_name": "Sister chromatid cohesion protein DCC1", "gene_name": "DSCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10329413", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of hCTF18, hCTF8, and hDCC1. Human homologs of a Saccharomyces cerevisiae complex involved in sister chromatid cohesion establishment.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Merkle CJ, Karnitz LM, Henry-Sanchez JT, Chen J", "reference": { "type": "PubMed", "id": "12766176", "url": "https://pubmed.ncbi.nlm.nih.gov/12766176" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCU8-1", "protein_name": "DNA polymerase delta subunit 4", "gene_name": "POLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28340-1", "protein_name": "DNA polymerase delta catalytic subunit", "gene_name": "POLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15054-1", "protein_name": "DNA polymerase delta subunit 3", "gene_name": "POLD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49005-1", "protein_name": "DNA polymerase delta subunit 2", "gene_name": "POLD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG13-1", "protein_name": "Chromosome transmission fidelity protein 8 homolog", "gene_name": "CHTF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVB6-1", "protein_name": "Chromosome transmission fidelity protein 18 homolog", "gene_name": "CHTF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVC3-1", "protein_name": "Sister chromatid cohesion protein DCC1", "gene_name": "DSCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12766176", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The alternative Ctf18-Dcc1-Ctf8-replication factor C complex required for sister chromatid cohesion loads proliferating cell nuclear antigen onto DNA.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Bermudez VP, Maniwa Y, Tappin I, Ozato K, Yokomori K, Hurwitz J", "reference": { "type": "PubMed", "id": "12930902", "url": "https://pubmed.ncbi.nlm.nih.gov/12930902" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCU8-1", "protein_name": "DNA polymerase delta subunit 4", "gene_name": "POLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28340-1", "protein_name": "DNA polymerase delta catalytic subunit", "gene_name": "POLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15054-1", "protein_name": "DNA polymerase delta subunit 3", "gene_name": "POLD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49005-1", "protein_name": "DNA polymerase delta subunit 2", "gene_name": "POLD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG13-1", "protein_name": "Chromosome transmission fidelity protein 8 homolog", "gene_name": "CHTF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVB6-1", "protein_name": "Chromosome transmission fidelity protein 18 homolog", "gene_name": "CHTF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVC3-1", "protein_name": "Sister chromatid cohesion protein DCC1", "gene_name": "DSCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12930902", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The reconstituted human Chl12-RFC complex functions as a second PCNA loader.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2004", "authors": "Shiomi Y, Shinozaki A, Sugimoto K, Usukura J, Obuse C, Tsurimoto T", "reference": { "type": "PubMed", "id": "15066120", "url": "https://pubmed.ncbi.nlm.nih.gov/15066120" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCU8-1", "protein_name": "DNA polymerase delta subunit 4", "gene_name": "POLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28340-1", "protein_name": "DNA polymerase delta catalytic subunit", "gene_name": "POLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15054-1", "protein_name": "DNA polymerase delta subunit 3", "gene_name": "POLD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49005-1", "protein_name": "DNA polymerase delta subunit 2", "gene_name": "POLD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG13-1", "protein_name": "Chromosome transmission fidelity protein 8 homolog", "gene_name": "CHTF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVB6-1", "protein_name": "Chromosome transmission fidelity protein 18 homolog", "gene_name": "CHTF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVC3-1", "protein_name": "Sister chromatid cohesion protein DCC1", "gene_name": "DSCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15066120", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alterations of DNA and chromatin structures at telomeres and genetic instability in mouse cells defective in DNA polymerase alpha.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Nakamura M, Nabetani A, Mizuno T, Hanaoka F, Ishikawa F", "reference": { "type": "PubMed", "id": "16314528", "url": "https://pubmed.ncbi.nlm.nih.gov/16314528" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NX24-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 2", "gene_name": "NHP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPE3-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 3", "gene_name": "NOP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ71-1", "protein_name": "Regulator of telomere elongation helicase 1", "gene_name": "RTEL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60832-1", "protein_name": "H/ACA ribonucleoprotein complex subunit DKC1", "gene_name": "DKC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY12-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 1", "gene_name": "GAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUR4-1", "protein_name": "Telomerase Cajal body protein 1", "gene_name": "WRAP53", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16314528", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanism of elongation of primed DNA by DNA polymerase delta, proliferating cell nuclear antigen, and activator 1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Lee SH, Hurwitz J", "reference": { "type": "PubMed", "id": "1974050", "url": "https://pubmed.ncbi.nlm.nih.gov/1974050" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCU8-1", "protein_name": "DNA polymerase delta subunit 4", "gene_name": "POLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28340-1", "protein_name": "DNA polymerase delta catalytic subunit", "gene_name": "POLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18858-1", "protein_name": "DNA ligase 1", "gene_name": "LIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15054-1", "protein_name": "DNA polymerase delta subunit 3", "gene_name": "POLD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49005-1", "protein_name": "DNA polymerase delta subunit 2", "gene_name": "POLD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG13-1", "protein_name": "Chromosome transmission fidelity protein 8 homolog", "gene_name": "CHTF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVB6-1", "protein_name": "Chromosome transmission fidelity protein 18 homolog", "gene_name": "CHTF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVC3-1", "protein_name": "Sister chromatid cohesion protein DCC1", "gene_name": "DSCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1974050", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 27 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway.", "journal": "Molecular cell", "date": "2009", "authors": "Miyake Y, Nakamura M, Nabetani A, Shimamura S, Tamura M, Yonehara S, Saito M, Ishikawa F", "reference": { "type": "PubMed", "id": "19854130", "url": "https://pubmed.ncbi.nlm.nih.gov/19854130" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NX24-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 2", "gene_name": "NHP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPE3-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 3", "gene_name": "NOP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SUQ9-1", "protein_name": "CST complex subunit CTC1", "gene_name": "Ctc1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ71-1", "protein_name": "Regulator of telomere elongation helicase 1", "gene_name": "RTEL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60832-1", "protein_name": "H/ACA ribonucleoprotein complex subunit DKC1", "gene_name": "DKC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY12-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 1", "gene_name": "GAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8K2X3-1", "protein_name": "CST complex subunit STN1", "gene_name": "Stn1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BUR4-1", "protein_name": "Telomerase Cajal body protein 1", "gene_name": "WRAP53", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D7K2-1", "protein_name": "CST complex subunit TEN1", "gene_name": "Ten1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19854130", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Conserved telomere maintenance component 1 interacts with STN1 and maintains chromosome ends in higher eukaryotes.", "journal": "Molecular cell", "date": "2009", "authors": "Surovtseva YV, Churikov D, Boltz KA, Song X, Lamb JC, Warrington R, Leehy K, Heacock M, Price CM, Shippen DE", "reference": { "type": "PubMed", "id": "19854131", "url": "https://pubmed.ncbi.nlm.nih.gov/19854131" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "D0EL35-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LMK5-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19854131", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular steps of G-overhang generation at human telomeres and its function in chromosome end protection.", "journal": "The EMBO journal", "date": "2010", "authors": "Dai X, Huang C, Bhusari A, Sampathi S, Schubert K, Chai W", "reference": { "type": "PubMed", "id": "20639858", "url": "https://pubmed.ncbi.nlm.nih.gov/20639858" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NX24-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 2", "gene_name": "NHP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPE3-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 3", "gene_name": "NOP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ71-1", "protein_name": "Regulator of telomere elongation helicase 1", "gene_name": "RTEL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60832-1", "protein_name": "H/ACA ribonucleoprotein complex subunit DKC1", "gene_name": "DKC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY12-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 1", "gene_name": "GAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUR4-1", "protein_name": "Telomerase Cajal body protein 1", "gene_name": "WRAP53", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20639858", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in CTC1, encoding conserved telomere maintenance component 1, cause Coats plus.", "journal": "Nature genetics", "date": "2012", "authors": "Anderson BH, Kasher PR, Mayer J, Szynkiewicz M, Jenkinson EM, Bhaskar SS, Urquhart JE, Daly SB, Dickerson JE, O'Sullivan J, Leibundgut EO, Muter J, Abdel-Salem GM, Babul-Hirji R, Baxter P, Berger A, Bonafe L, Brunstom-Hernandez JE, Buckard JA, Chitayat D, Chong WK, Cordelli DM, Ferreira P, Fluss J, Forrest EH, Franzoni E, Garone C, Hammans SR, Houge G, Hughes I, Jacquemont S, Jeannet PY, Jefferson RJ, Kumar R, Kutschke G, Lundberg S, Lourenco CM, Mehta R, Naidu S, Nischal KK, Nunes L, Ounap K, Philippart M, Prabhakar P, Risen SR, Schiffmann R, Soh C, Stephenson JB, Stewart H, Stone J, Tolmie JL, van der Knaap MS, Vieira JP, Vilain CN, Wakeling EL, Wermenbol V, Whitney A, Lovell SC, Meyer S, Livingston JH, Baerlocher GM, Black GC, Rice GI, Crow YJ", "reference": { "type": "PubMed", "id": "22267198", "url": "https://pubmed.ncbi.nlm.nih.gov/22267198" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22267198", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in CTC1, encoding the CTS telomere maintenance complex component 1, cause cerebroretinal microangiopathy with calcifications and cysts.", "journal": "American journal of human genetics", "date": "2012", "authors": "Polvi A, Linnankivi T, Kivela T, Herva R, Keating JP, Makitie O, Pareyson D, Vainionpaa L, Lahtinen J, Hovatta I, Pihko H, Lehesjoki AE", "reference": { "type": "PubMed", "id": "22387016", "url": "https://pubmed.ncbi.nlm.nih.gov/22387016" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22387016", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human CST complex is a terminator of telomerase activity.", "journal": "Nature", "date": "2012", "authors": "Chen LY, Redon S, Lingner J", "reference": { "type": "PubMed", "id": "22763445", "url": "https://pubmed.ncbi.nlm.nih.gov/22763445" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22763445", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human CST promotes telomere duplex replication and general replication restart after fork stalling.", "journal": "The EMBO journal", "date": "2012-08-29", "authors": "Stewart Jason A, Wang Feng, Chaiken Mary F, Kasbek Christopher, Chastain Paul D, Wright Woodring E, Price Carolyn M", "reference": { "type": "PubMed", "id": "22863775", "url": "https://pubmed.ncbi.nlm.nih.gov/22863775" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22863775", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CDK1 differentially regulates G-overhang generation at leading- and lagging-strand telomeres in telomerase-negative cells in G2 phase.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Dai X, Huang C, Chai W", "reference": { "type": "PubMed", "id": "22871736", "url": "https://pubmed.ncbi.nlm.nih.gov/22871736" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NX24-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 2", "gene_name": "NHP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPE3-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 3", "gene_name": "NOP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ71-1", "protein_name": "Regulator of telomere elongation helicase 1", "gene_name": "RTEL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60832-1", "protein_name": "H/ACA ribonucleoprotein complex subunit DKC1", "gene_name": "DKC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY12-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 1", "gene_name": "GAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUR4-1", "protein_name": "Telomerase Cajal body protein 1", "gene_name": "WRAP53", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22871736", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA polymerase delta stalls on telomeric lagging strand templates independently from G-quadruplex formation.", "journal": "Nucleic acids research", "date": "2013", "authors": "Lormand JD, Buncher N, Murphy CT, Kaur P, Lee MY, Burgers P, Wang H, Kunkel TA, Opresko PL", "reference": { "type": "PubMed", "id": "24038470", "url": "https://pubmed.ncbi.nlm.nih.gov/24038470" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCU8-1", "protein_name": "DNA polymerase delta subunit 4", "gene_name": "POLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28340-1", "protein_name": "DNA polymerase delta catalytic subunit", "gene_name": "POLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18858-1", "protein_name": "DNA ligase 1", "gene_name": "LIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54132-1", "protein_name": "RecQ-like DNA helicase BLM", "gene_name": "BLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14191-1", "protein_name": "Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN", "gene_name": "WRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15054-1", "protein_name": "DNA polymerase delta subunit 3", "gene_name": "POLD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49005-1", "protein_name": "DNA polymerase delta subunit 2", "gene_name": "POLD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG13-1", "protein_name": "Chromosome transmission fidelity protein 8 homolog", "gene_name": "CHTF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVB6-1", "protein_name": "Chromosome transmission fidelity protein 18 homolog", "gene_name": "CHTF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVC3-1", "protein_name": "Sister chromatid cohesion protein DCC1", "gene_name": "DSCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24038470", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 29 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RTEL1 is a replisome-associated helicase that promotes telomere and genome-wide replication.", "journal": "Science (New York, N.Y.)", "date": "2013", "authors": "Vannier JB, Sandhu S, Petalcorin MI, Wu X, Nabi Z, Ding H, Boulton SJ", "reference": { "type": "PubMed", "id": "24115439", "url": "https://pubmed.ncbi.nlm.nih.gov/24115439" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17918-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "Pcna", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9HCU8-1", "protein_name": "DNA polymerase delta subunit 4", "gene_name": "POLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28340-1", "protein_name": "DNA polymerase delta catalytic subunit", "gene_name": "POLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VGM9-1", "protein_name": "Regulator of telomere elongation helicase 1", "gene_name": "Rtel1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15054-1", "protein_name": "DNA polymerase delta subunit 3", "gene_name": "POLD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49005-1", "protein_name": "DNA polymerase delta subunit 2", "gene_name": "POLD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG13-1", "protein_name": "Chromosome transmission fidelity protein 8 homolog", "gene_name": "CHTF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVB6-1", "protein_name": "Chromosome transmission fidelity protein 18 homolog", "gene_name": "CHTF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVC3-1", "protein_name": "Sister chromatid cohesion protein DCC1", "gene_name": "DSCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1160, "end_pos": 1160, "sequence_org": "Q", "sequence_mut": "A", "comment": "Abolishes interaction with PCNA.", "evidence": [ { "database": "UniProtKB", "id": "Q0VGM9", "url": "https://www.uniprot.org/uniprotkb/Q0VGM9" }, { "database": "PubMed", "id": "24115439", "url": "https://pubmed.ncbi.nlm.nih.gov/24115439" } ], "uniprot_canonical_ac": "Q0VGM9-1" }, { "start_pos": 1163, "end_pos": 1163, "sequence_org": "I", "sequence_mut": "A", "comment": "Abolishes interaction with PCNA.", "evidence": [ { "database": "UniProtKB", "id": "Q0VGM9", "url": "https://www.uniprot.org/uniprotkb/Q0VGM9" }, { "database": "PubMed", "id": "24115439", "url": "https://pubmed.ncbi.nlm.nih.gov/24115439" } ], "uniprot_canonical_ac": "Q0VGM9-1" }, { "start_pos": 1166, "end_pos": 1166, "sequence_org": "F", "sequence_mut": "A", "comment": "Abolishes interaction with PCNA.", "evidence": [ { "database": "UniProtKB", "id": "Q0VGM9", "url": "https://www.uniprot.org/uniprotkb/Q0VGM9" }, { "database": "PubMed", "id": "24115439", "url": "https://pubmed.ncbi.nlm.nih.gov/24115439" } ], "uniprot_canonical_ac": "Q0VGM9-1" }, { "start_pos": 1167, "end_pos": 1167, "sequence_org": "F", "sequence_mut": "A", "comment": "Abolishes interaction with PCNA.", "evidence": [ { "database": "UniProtKB", "id": "Q0VGM9", "url": "https://www.uniprot.org/uniprotkb/Q0VGM9" }, { "database": "PubMed", "id": "24115439", "url": "https://pubmed.ncbi.nlm.nih.gov/24115439" } ], "uniprot_canonical_ac": "Q0VGM9-1" }, { "start_pos": 48, "end_pos": 48, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes G4-DNA unwinding activity.", "evidence": [ { "database": "UniProtKB", "id": "Q0VGM9", "url": "https://www.uniprot.org/uniprotkb/Q0VGM9" }, { "database": "PubMed", "id": "24115439", "url": "https://pubmed.ncbi.nlm.nih.gov/24115439" } ], "uniprot_canonical_ac": "Q0VGM9-1" } ], "record_id": "pubmed.24115439", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human CST abundance determines recovery from diverse forms of DNA damage and replication stress.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2014", "authors": "Wang Feng, Stewart Jason, Price Carolyn M", "reference": { "type": "PubMed", "id": "25483097", "url": "https://pubmed.ncbi.nlm.nih.gov/25483097" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25483097", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CTC1-mediated C-strand fill-in is an essential step in telomere length maintenance.", "journal": "Nucleic acids research", "date": "2017", "authors": "Feng X, Hsu SJ, Kasbek C, Chaiken M, Price CM", "reference": { "type": "PubMed", "id": "28334750", "url": "https://pubmed.ncbi.nlm.nih.gov/28334750" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NX24-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 2", "gene_name": "NHP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPE3-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 3", "gene_name": "NOP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ71-1", "protein_name": "Regulator of telomere elongation helicase 1", "gene_name": "RTEL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60832-1", "protein_name": "H/ACA ribonucleoprotein complex subunit DKC1", "gene_name": "DKC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY12-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 1", "gene_name": "GAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUR4-1", "protein_name": "Telomerase Cajal body protein 1", "gene_name": "WRAP53", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28334750", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CTC1-STN1 coordinates G- and C-strand synthesis to regulate telomere length.", "journal": "Aging cell", "date": "2018", "authors": "Gu P, Jia S, Takasugi T, Smith E, Nandakumar J, Hendrickson E, Chang S", "reference": { "type": "PubMed", "id": "29774655", "url": "https://pubmed.ncbi.nlm.nih.gov/29774655" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NX24-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 2", "gene_name": "NHP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPE3-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 3", "gene_name": "NOP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ71-1", "protein_name": "Regulator of telomere elongation helicase 1", "gene_name": "RTEL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60832-1", "protein_name": "H/ACA ribonucleoprotein complex subunit DKC1", "gene_name": "DKC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY12-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 1", "gene_name": "GAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUR4-1", "protein_name": "Telomerase Cajal body protein 1", "gene_name": "WRAP53", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29774655", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CTC1-STN1 terminates telomerase while STN1-TEN1 enables C-strand synthesis during telomere replication in colon cancer cells.", "journal": "Nature communications", "date": "2018", "authors": "Feng X, Hsu SJ, Bhattacharjee A, Wang Y, Diao J, Price CM", "reference": { "type": "PubMed", "id": "30026550", "url": "https://pubmed.ncbi.nlm.nih.gov/30026550" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NX24-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 2", "gene_name": "NHP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPE3-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 3", "gene_name": "NOP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ71-1", "protein_name": "Regulator of telomere elongation helicase 1", "gene_name": "RTEL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60832-1", "protein_name": "H/ACA ribonucleoprotein complex subunit DKC1", "gene_name": "DKC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY12-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 1", "gene_name": "GAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUR4-1", "protein_name": "Telomerase Cajal body protein 1", "gene_name": "WRAP53", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30026550", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CTC1 OB-B interaction with TPP1 terminates telomerase and prevents telomere overextension.", "journal": "Nucleic acids research", "date": "2023-04-06", "authors": "Wang Huan, Ma Tengfei, Zhang Xiaotong, Chen Wei, Lan Yina, Kuang Guotao, Hsu Shih-Jui, He Zibin, Chen Yuxi, Stewart Jason, Bhattacharjee Anukana, Luo Zhenhua, Price Carolyn, Feng Xuyang", "reference": { "type": "PubMed", "id": "37021555", "url": "https://pubmed.ncbi.nlm.nih.gov/37021555" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37021555", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel mutation of CTC1 leads to telomere shortening in a chinese family with interstitial lung disease.", "journal": "Hereditas", "date": "2023-11-18", "authors": "Liu Lv, Luo Hua, Sheng Yue, Kang Xi, Peng Hong, Luo Hong, Fan Liang-Liang", "reference": { "type": "PubMed", "id": "37978541", "url": "https://pubmed.ncbi.nlm.nih.gov/37978541" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37978541", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CST-polymerase \u03b1-primase solves a second telomere end-replication problem.", "journal": "Nature", "date": "2024-03", "authors": "Takai Hiroyuki, Aria Valentina, Borges Pamela, Yeeles Joseph T P, de Lange Titia", "reference": { "type": "PubMed", "id": "38418884", "url": "https://pubmed.ncbi.nlm.nih.gov/38418884" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38418884", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA primase from KB cells. Characterization of a primase activity tightly associated with immunoaffinity-purified DNA polymerase-alpha.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Wang TS, Hu SZ, Korn D", "reference": { "type": "PubMed", "id": "6693436", "url": "https://pubmed.ncbi.nlm.nih.gov/6693436" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56282-1", "protein_name": "DNA polymerase epsilon subunit 2", "gene_name": "POLE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NX24-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 2", "gene_name": "NHP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPE3-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 3", "gene_name": "NOP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07864-1", "protein_name": "DNA polymerase epsilon catalytic subunit A", "gene_name": "POLE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR33-1", "protein_name": "DNA polymerase epsilon subunit 4", "gene_name": "POLE4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRF9-1", "protein_name": "DNA polymerase epsilon subunit 3", "gene_name": "POLE3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ71-1", "protein_name": "Regulator of telomere elongation helicase 1", "gene_name": "RTEL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60832-1", "protein_name": "H/ACA ribonucleoprotein complex subunit DKC1", "gene_name": "DKC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY12-1", "protein_name": "H/ACA ribonucleoprotein complex subunit 1", "gene_name": "GAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUR4-1", "protein_name": "Telomerase Cajal body protein 1", "gene_name": "WRAP53", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6693436", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Replication factor C recognizes 5'-phosphate ends of telomeres.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Uchiumi F, Ohta T, Tanuma S", "reference": { "type": "PubMed", "id": "8954124", "url": "https://pubmed.ncbi.nlm.nih.gov/8954124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCU8-1", "protein_name": "DNA polymerase delta subunit 4", "gene_name": "POLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28340-1", "protein_name": "DNA polymerase delta catalytic subunit", "gene_name": "POLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15054-1", "protein_name": "DNA polymerase delta subunit 3", "gene_name": "POLD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49005-1", "protein_name": "DNA polymerase delta subunit 2", "gene_name": "POLD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG13-1", "protein_name": "Chromosome transmission fidelity protein 8 homolog", "gene_name": "CHTF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVB6-1", "protein_name": "Chromosome transmission fidelity protein 18 homolog", "gene_name": "CHTF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVC3-1", "protein_name": "Sister chromatid cohesion protein DCC1", "gene_name": "DSCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8954124", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Replication factor C disengages from proliferating cell nuclear antigen (PCNA) upon sliding clamp formation, and PCNA itself tethers DNA polymerase delta to DNA.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Podust VN, Tiwari N, Stephan S, Fanning E", "reference": { "type": "PubMed", "id": "9822671", "url": "https://pubmed.ncbi.nlm.nih.gov/9822671" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2NKJ3-1", "protein_name": "CST complex subunit CTC1", "gene_name": "CTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCU8-1", "protein_name": "DNA polymerase delta subunit 4", "gene_name": "POLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28340-1", "protein_name": "DNA polymerase delta catalytic subunit", "gene_name": "POLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14181-1", "protein_name": "DNA polymerase alpha subunit B", "gene_name": "POLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49643-1", "protein_name": "DNA primase large subunit", "gene_name": "PRIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49642-1", "protein_name": "DNA primase small subunit", "gene_name": "PRIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15554-3", "protein_name": "Telomeric repeat-binding factor 2", "gene_name": "TERF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15054-1", "protein_name": "DNA polymerase delta subunit 3", "gene_name": "POLD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49005-1", "protein_name": "DNA polymerase delta subunit 2", "gene_name": "POLD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H668-1", "protein_name": "CST complex subunit STN1", "gene_name": "STN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB0-1", "protein_name": "Telomeric repeat-binding factor 2-interacting protein 1", "gene_name": "TERF2IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG13-1", "protein_name": "Chromosome transmission fidelity protein 8 homolog", "gene_name": "CHTF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVB6-1", "protein_name": "Chromosome transmission fidelity protein 18 homolog", "gene_name": "CHTF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVC3-1", "protein_name": "Sister chromatid cohesion protein DCC1", "gene_name": "DSCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV5-1", "protein_name": "CST complex subunit TEN1", "gene_name": "TEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54274-1", "protein_name": "Telomeric repeat-binding factor 1", "gene_name": "TERF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP0-3", "protein_name": "Adrenocortical dysplasia protein homolog", "gene_name": "ACD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSI4-1", "protein_name": "TERF1-interacting nuclear factor 2", "gene_name": "TINF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUX5-1", "protein_name": "Protection of telomeres protein 1", "gene_name": "POT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2NKJ3", "url": "https://www.uniprot.org/uniprotkb/Q2NKJ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9822671", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of Mrj, a DnaJ/Hsp40 family protein, as a keratin 8/18 filament regulatory protein.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Izawa I, Nishizawa M, Ohtakara K, Ohtsuka K, Inada H, Inagaki M", "reference": { "type": "PubMed", "id": "10954706", "url": "https://pubmed.ncbi.nlm.nih.gov/10954706" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05783-1", "protein_name": "Keratin, type I cytoskeletal 18", "gene_name": "KRT18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10954706", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 69 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemistry of gene silencing: the mechanism of NAD+-dependent deacetylation reactions.", "journal": "Biochemistry", "date": "2001", "authors": "Sauve AA, Celic I, Avalos J, Deng H, Boeke JD, Schramm VL", "reference": { "type": "PubMed", "id": "11747420", "url": "https://pubmed.ncbi.nlm.nih.gov/11747420" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11747420", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cofactor Tpr2 combines two TPR domains and a J domain to regulate the Hsp70/Hsp90 chaperone system.", "journal": "The EMBO journal", "date": "2003", "authors": "Brychzy A, Rein T, Winklhofer KF, Hartl FU, Young JC, Obermann WM", "reference": { "type": "PubMed", "id": "12853476", "url": "https://pubmed.ncbi.nlm.nih.gov/12853476" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 101, "end_pos": 101, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs interaction with HSP90AA1 and HSPA1A/B. Abolishes interaction with HSP90AA1 and HSPA1A/B; when associated with A-333 and A-409.", "evidence": [ { "database": "UniProtKB", "id": "Q99615", "url": "https://www.uniprot.org/uniprotkb/Q99615" }, { "database": "PubMed", "id": "12853476", "url": "https://pubmed.ncbi.nlm.nih.gov/12853476" } ], "uniprot_canonical_ac": "Q99615-1" }, { "start_pos": 333, "end_pos": 333, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs interaction with HSP90AA1 and HSPA1A/B. Abolishes interaction with HSP90AA1 and HSPA1A/B; when associated with A-101 and A-409.", "evidence": [ { "database": "UniProtKB", "id": "Q99615", "url": "https://www.uniprot.org/uniprotkb/Q99615" }, { "database": "PubMed", "id": "12853476", "url": "https://pubmed.ncbi.nlm.nih.gov/12853476" } ], "uniprot_canonical_ac": "Q99615-1" }, { "start_pos": 409, "end_pos": 409, "sequence_org": "H", "sequence_mut": "A", "comment": "Predominantly nuclear localization. Abolishes interaction with HSP90AA1 and HSPA1A/B; when associated with A-101 and A-333.", "evidence": [ { "database": "UniProtKB", "id": "Q99615", "url": "https://www.uniprot.org/uniprotkb/Q99615" }, { "database": "PubMed", "id": "12853476", "url": "https://pubmed.ncbi.nlm.nih.gov/12853476" }, { "database": "PubMed", "id": "11573955", "url": "https://pubmed.ncbi.nlm.nih.gov/11573955" } ], "uniprot_canonical_ac": "Q99615-1" } ], "record_id": "pubmed.12853476", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 69 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of molecular chaperone gene transcription involves the serine phosphorylation, 14-3-3 epsilon binding, and cytoplasmic sequestration of heat shock factor 1.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Wang X, Grammatikakis N, Siganou A, Calderwood SK", "reference": { "type": "PubMed", "id": "12917326", "url": "https://pubmed.ncbi.nlm.nih.gov/12917326" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 303, "end_pos": 303, "sequence_org": "S", "sequence_mut": "G", "comment": "Leads to constitutive transactivation activity at room temperature. Inhibits interaction with YWHAE and increases cytoplasmic localization; when associated with G-307.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8940068", "url": "https://pubmed.ncbi.nlm.nih.gov/8940068" }, { "database": "PubMed", "id": "12917326", "url": "https://pubmed.ncbi.nlm.nih.gov/12917326" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 307, "end_pos": 307, "sequence_org": "S", "sequence_mut": "G", "comment": "Leads to constitutive transactivation activity at room temperature. Inhibits interaction with YWHAE and increases cytoplasmic localization; when associated with G-303.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8940068", "url": "https://pubmed.ncbi.nlm.nih.gov/8940068" }, { "database": "PubMed", "id": "12917326", "url": "https://pubmed.ncbi.nlm.nih.gov/12917326" } ], "uniprot_canonical_ac": "Q00613-1" } ], "phosphorylation": [ { "start_pos": 303, "end_pos": 303, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by GSK3-beta", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "iPTMnet", "id": "Q00613", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q00613" }, { "database": "PubMed", "id": "12665592", "url": "https://pubmed.ncbi.nlm.nih.gov/12665592" }, { "database": "PubMed", "id": "18212344", "url": "https://pubmed.ncbi.nlm.nih.gov/18212344" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PRO", "id": "Q00613", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q00613" }, { "database": "PubMed", "id": "12917326", "url": "https://pubmed.ncbi.nlm.nih.gov/12917326" }, { "database": "PubMed", "id": "9121459", "url": "https://pubmed.ncbi.nlm.nih.gov/9121459" }, { "database": "PubMed", "id": "11162511", "url": "https://pubmed.ncbi.nlm.nih.gov/11162511" }, { "database": "PubMed", "id": "15760475", "url": "https://pubmed.ncbi.nlm.nih.gov/15760475" }, { "database": "PubMed", "id": "19945465", "url": "https://pubmed.ncbi.nlm.nih.gov/19945465" }, { "database": "PubMed", "id": "20926391", "url": "https://pubmed.ncbi.nlm.nih.gov/20926391" }, { "database": "PubMed", "id": "22768106", "url": "https://pubmed.ncbi.nlm.nih.gov/22768106" }, { "database": "PubMed", "id": "24412756", "url": "https://pubmed.ncbi.nlm.nih.gov/24412756" }, { "database": "PubMed", "id": "24589236", "url": "https://pubmed.ncbi.nlm.nih.gov/24589236" }, { "database": "PubMed", "id": "24954509", "url": "https://pubmed.ncbi.nlm.nih.gov/24954509" }, { "database": "PubMed", "id": "26754925", "url": "https://pubmed.ncbi.nlm.nih.gov/26754925" }, { "database": "PubMed", "id": "26785146", "url": "https://pubmed.ncbi.nlm.nih.gov/26785146" }, { "database": "PubMed", "id": "27354066", "url": "https://pubmed.ncbi.nlm.nih.gov/27354066" }, { "database": "PubMed", "id": "28383811", "url": "https://pubmed.ncbi.nlm.nih.gov/28383811" }, { "database": "PubMed", "id": "28415561", "url": "https://pubmed.ncbi.nlm.nih.gov/28415561" }, { "database": "PubMed", "id": "31054961", "url": "https://pubmed.ncbi.nlm.nih.gov/31054961" }, { "database": "PubMed", "id": "32457290", "url": "https://pubmed.ncbi.nlm.nih.gov/32457290" }, { "database": "PubMed", "id": "33493517", "url": "https://pubmed.ncbi.nlm.nih.gov/33493517" }, { "database": "PubMed", "id": "34239690", "url": "https://pubmed.ncbi.nlm.nih.gov/34239690" }, { "database": "PubMed", "id": "9660838", "url": "https://pubmed.ncbi.nlm.nih.gov/9660838" }, { "database": "PubMed", "id": "16371476", "url": "https://pubmed.ncbi.nlm.nih.gov/16371476" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "8940068", "url": "https://pubmed.ncbi.nlm.nih.gov/8940068" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" }, { "database": "PubMed", "id": "11447121", "url": "https://pubmed.ncbi.nlm.nih.gov/11447121" } ], "site_lbl": "Ser303", "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 307, "end_pos": 307, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK3", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "iPTMnet", "id": "Q00613", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q00613" }, { "database": "PubMed", "id": "18212344", "url": "https://pubmed.ncbi.nlm.nih.gov/18212344" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "8940068", "url": "https://pubmed.ncbi.nlm.nih.gov/8940068" }, { "database": "PRO", "id": "Q00613", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q00613" }, { "database": "PubMed", "id": "12917326", "url": "https://pubmed.ncbi.nlm.nih.gov/12917326" }, { "database": "PubMed", "id": "9121459", "url": "https://pubmed.ncbi.nlm.nih.gov/9121459" }, { "database": "PubMed", "id": "11162511", "url": "https://pubmed.ncbi.nlm.nih.gov/11162511" }, { "database": "PubMed", "id": "12646186", "url": "https://pubmed.ncbi.nlm.nih.gov/12646186" }, { "database": "PubMed", "id": "15760475", "url": "https://pubmed.ncbi.nlm.nih.gov/15760475" }, { "database": "PubMed", "id": "19945465", "url": "https://pubmed.ncbi.nlm.nih.gov/19945465" }, { "database": "PubMed", "id": "26754925", "url": "https://pubmed.ncbi.nlm.nih.gov/26754925" }, { "database": "PubMed", "id": "26785146", "url": "https://pubmed.ncbi.nlm.nih.gov/26785146" }, { "database": "PubMed", "id": "27354066", "url": "https://pubmed.ncbi.nlm.nih.gov/27354066" }, { "database": "PubMed", "id": "28383811", "url": "https://pubmed.ncbi.nlm.nih.gov/28383811" }, { "database": "PubMed", "id": "28415561", "url": "https://pubmed.ncbi.nlm.nih.gov/28415561" }, { "database": "PubMed", "id": "31054961", "url": "https://pubmed.ncbi.nlm.nih.gov/31054961" }, { "database": "PubMed", "id": "32457290", "url": "https://pubmed.ncbi.nlm.nih.gov/32457290" }, { "database": "PubMed", "id": "33493517", "url": "https://pubmed.ncbi.nlm.nih.gov/33493517" }, { "database": "PubMed", "id": "34239690", "url": "https://pubmed.ncbi.nlm.nih.gov/34239690" }, { "database": "PubMed", "id": "9660838", "url": "https://pubmed.ncbi.nlm.nih.gov/9660838" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" }, { "database": "PubMed", "id": "9535852", "url": "https://pubmed.ncbi.nlm.nih.gov/9535852" }, { "database": "PubMed", "id": "11447121", "url": "https://pubmed.ncbi.nlm.nih.gov/11447121" } ], "site_lbl": "Ser307", "uniprot_canonical_ac": "Q00613-1" } ], "record_id": "pubmed.12917326", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of two isoforms of a human DnaJ homologue, HSJ2.", "journal": "Molecular biology reports", "date": "2003", "authors": "Hanai R, Mashima K", "reference": { "type": "PubMed", "id": "12974469", "url": "https://pubmed.ncbi.nlm.nih.gov/12974469" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12974469", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interactions between extracellular signal-regulated protein kinase 1, 14-3-3epsilon, and heat shock factor 1 during stress.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Wang X, Grammatikakis N, Siganou A, Stevenson MA, Calderwood SK", "reference": { "type": "PubMed", "id": "15364926", "url": "https://pubmed.ncbi.nlm.nih.gov/15364926" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15364926", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human Mpp11 J protein: ribosome-tethered molecular chaperones are ubiquitous.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Hundley HA, Walter W, Bairstow S, Craig EA", "reference": { "type": "PubMed", "id": "15802566", "url": "https://pubmed.ncbi.nlm.nih.gov/15802566" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 512, "end_pos": 513, "sequence_org": "HQ", "sequence_mut": "AA", "comment": "Loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q99543", "url": "https://www.uniprot.org/uniprotkb/Q99543" }, { "database": "PubMed", "id": "15802566", "url": "https://pubmed.ncbi.nlm.nih.gov/15802566" } ], "uniprot_canonical_ac": "Q99543-1" } ], "record_id": "pubmed.15802566", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Intracellular localization and partial amino acid sequence of a stress-inducible 40-kDa protein in HeLa cells.", "journal": "Cell structure and function", "date": "1992", "authors": "Hattori H, Liu YC, Tohnai I, Ueda M, Kaneda T, Kobayashi T, Tanabe K, Ohtsuka K", "reference": { "type": "PubMed", "id": "1586970", "url": "https://pubmed.ncbi.nlm.nih.gov/1586970" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1586970", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Wang X, Khaleque MA, Zhao MJ, Zhong R, Gaestel M, Calderwood SK", "reference": { "type": "PubMed", "id": "16278218", "url": "https://pubmed.ncbi.nlm.nih.gov/16278218" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 120, "end_pos": 120, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on binding HSE nor on transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "16278218", "url": "https://pubmed.ncbi.nlm.nih.gov/16278218" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 121, "end_pos": 121, "sequence_org": "S", "sequence_mut": "A", "comment": "Increased binding HSE and transcriptional activity. Greatly reduced binding to HSP90AA1. No effect on MAPKAPK2 binding.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "16278218", "url": "https://pubmed.ncbi.nlm.nih.gov/16278218" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 121, "end_pos": 121, "sequence_org": "S", "sequence_mut": "D", "comment": "Some inhibition of binding HSE and transcriptional activity. No change in binding HSP90AA1. Inhibits MAPKAPK2 binding. Decreased HSF1-induced expression of HSPA1A mRNA in a IER5-dependent manner; when associated with D-307; D-314; D-323 and D-367.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "26754925", "url": "https://pubmed.ncbi.nlm.nih.gov/26754925" }, { "database": "PubMed", "id": "16278218", "url": "https://pubmed.ncbi.nlm.nih.gov/16278218" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 123, "end_pos": 123, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on binding HSE nor on transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "16278218", "url": "https://pubmed.ncbi.nlm.nih.gov/16278218" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 124, "end_pos": 124, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on binding HSE nor on transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "16278218", "url": "https://pubmed.ncbi.nlm.nih.gov/16278218" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 527, "end_pos": 527, "sequence_org": "T", "sequence_mut": "A", "comment": "No change in binding HSE nor on transcriptional activity. Decreased binding HSE; when associated with A-529.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "16278218", "url": "https://pubmed.ncbi.nlm.nih.gov/16278218" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 529, "end_pos": 529, "sequence_org": "S", "sequence_mut": "A", "comment": "No change in binding HSE nor on transcriptional activity. Decreased binding HSE; when associated with A-527.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "16278218", "url": "https://pubmed.ncbi.nlm.nih.gov/16278218" } ], "uniprot_canonical_ac": "Q00613-1" } ], "phosphorylation": [ { "start_pos": 121, "end_pos": 121, "kinase_uniprot_canonical_ac": "P49137-1", "kinase_gene_name": "MAPKAPK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q00613", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q00613" }, { "database": "PubMed", "id": "16278218", "url": "https://pubmed.ncbi.nlm.nih.gov/16278218" } ], "site_lbl": "Ser121", "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 121, "end_pos": 121, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPKAPK2", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "iPTMnet", "id": "Q00613", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q00613" }, { "database": "PubMed", "id": "16278218", "url": "https://pubmed.ncbi.nlm.nih.gov/16278218" }, { "database": "PRO", "id": "Q00613", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q00613" }, { "database": "PubMed", "id": "15760475", "url": "https://pubmed.ncbi.nlm.nih.gov/15760475" }, { "database": "PubMed", "id": "19936221", "url": "https://pubmed.ncbi.nlm.nih.gov/19936221" }, { "database": "PubMed", "id": "25425574", "url": "https://pubmed.ncbi.nlm.nih.gov/25425574" }, { "database": "PubMed", "id": "26754925", "url": "https://pubmed.ncbi.nlm.nih.gov/26754925" } ], "site_lbl": "Ser121", "uniprot_canonical_ac": "Q00613-1" } ], "record_id": "pubmed.16278218", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A human homologue of the Escherichia coli DnaJ heat-shock protein.", "journal": "Nucleic acids research", "date": "1991", "authors": "Raabe T, Manley JL", "reference": { "type": "PubMed", "id": "1754405", "url": "https://pubmed.ncbi.nlm.nih.gov/1754405" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1754405", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DBC1 is a negative regulator of SIRT1.", "journal": "Nature", "date": "2008", "authors": "Kim JE, Chen J, Lou Z", "reference": { "type": "PubMed", "id": "18235501", "url": "https://pubmed.ncbi.nlm.nih.gov/18235501" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 243, "end_pos": 264, "sequence_org": "LQRRYRSLLVPSDFLSVHLSWL", "sequence_mut": "", "comment": "Abolishes binding to SIRT1.", "evidence": [ { "database": "UniProtKB", "id": "Q8N163", "url": "https://www.uniprot.org/uniprotkb/Q8N163" }, { "database": "PubMed", "id": "18235501", "url": "https://pubmed.ncbi.nlm.nih.gov/18235501" } ], "uniprot_canonical_ac": "Q8N163-1" }, { "start_pos": 363, "end_pos": 363, "sequence_org": "H", "sequence_mut": "Y", "comment": "Loss of function; abolishes both protein deacetylase, delactylase and decrotonylase activities. Reduces the interaction with CCAR2 and APEX1. Increases acetylation of APEX1.", "evidence": [ { "database": "UniProtKB", "id": "Q96EB6", "url": "https://www.uniprot.org/uniprotkb/Q96EB6" }, { "database": "PubMed", "id": "17290224", "url": "https://pubmed.ncbi.nlm.nih.gov/17290224" }, { "database": "PubMed", "id": "12006491", "url": "https://pubmed.ncbi.nlm.nih.gov/12006491" }, { "database": "PubMed", "id": "18004385", "url": "https://pubmed.ncbi.nlm.nih.gov/18004385" }, { "database": "PubMed", "id": "18235501", "url": "https://pubmed.ncbi.nlm.nih.gov/18235501" }, { "database": "PubMed", "id": "25406032", "url": "https://pubmed.ncbi.nlm.nih.gov/25406032" }, { "database": "PubMed", "id": "18485871", "url": "https://pubmed.ncbi.nlm.nih.gov/18485871" }, { "database": "PubMed", "id": "19934257", "url": "https://pubmed.ncbi.nlm.nih.gov/19934257" }, { "database": "PubMed", "id": "12535671", "url": "https://pubmed.ncbi.nlm.nih.gov/12535671" }, { "database": "PubMed", "id": "32034146", "url": "https://pubmed.ncbi.nlm.nih.gov/32034146" }, { "database": "PubMed", "id": "11672523", "url": "https://pubmed.ncbi.nlm.nih.gov/11672523" }, { "database": "PubMed", "id": "28497810", "url": "https://pubmed.ncbi.nlm.nih.gov/28497810" }, { "database": "PubMed", "id": "32538779", "url": "https://pubmed.ncbi.nlm.nih.gov/32538779" }, { "database": "PubMed", "id": "38512451", "url": "https://pubmed.ncbi.nlm.nih.gov/38512451" } ], "uniprot_canonical_ac": "Q96EB6-1" } ], "record_id": "pubmed.18235501", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Negative regulation of the deacetylase SIRT1 by DBC1.", "journal": "Nature", "date": "2008", "authors": "Zhao W, Kruse JP, Tang Y, Jung SY, Qin J, Gu W", "reference": { "type": "PubMed", "id": "18235502", "url": "https://pubmed.ncbi.nlm.nih.gov/18235502" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18235502", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the Hsp110:Hsc70 nucleotide exchange machine.", "journal": "Molecular cell", "date": "2008", "authors": "Schuermann JP, Jiang J, Cuellar J, Llorca O, Wang L, Gimenez LE, Jin S, Taylor AB, Demeler B, Morano KA, Hart PJ, Valpuesta JM, Lafer EM, Sousa R", "reference": { "type": "PubMed", "id": "18550409", "url": "https://pubmed.ncbi.nlm.nih.gov/18550409" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19120-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18550409", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 69 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Guidelines for the nomenclature of the human heat shock proteins.", "journal": "Cell Stress Chaperones", "date": "2009", "authors": "Kampinga Harm H, Hageman Jurre, Vos Michel J, Kubota Hiroshi, Tanguay Robert M, Bruford Elspeth A, Cheetham Michael E, Chen Bin, Hightower Lawrence E", "reference": { "type": "PubMed", "id": "18663603", "url": "https://pubmed.ncbi.nlm.nih.gov/18663603" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ4-1", "protein_name": "Sacsin", "gene_name": "SACS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14976-1", "protein_name": "Cyclin-G-associated kinase", "gene_name": "GAK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4L1-1", "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12931-1", "protein_name": "Heat shock protein 75 kDa, mitochondrial", "gene_name": "TRAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14568-1", "protein_name": "Heat shock protein HSP 90-alpha A2", "gene_name": "HSP90AA2P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14625-1", "protein_name": "Endoplasmin", "gene_name": "HSP90B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGP8-1", "protein_name": "Translocation protein SEC63 homolog", "gene_name": "SEC63", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18663603", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Substrate specificity of SIRT1-catalyzed lysine Nepsilon-deacetylation reaction probed with the side chain modified Nepsilon-acetyl-lysine analogs.", "journal": "Bioorganic chemistry", "date": "2010", "authors": "Jamonnak N, Hirsch BM, Pang Y, Zheng W", "reference": { "type": "PubMed", "id": "19914676", "url": "https://pubmed.ncbi.nlm.nih.gov/19914676" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19914676", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structures of the ATPase domains of four human Hsp70 isoforms: HSPA1L/Hsp70-hom, HSPA2/Hsp70-2, HSPA6/Hsp70B', and HSPA5/BiP/GRP78.", "journal": "PloS one", "date": "2010", "authors": "Wisniewska M, Karlberg T, Lehtio L, Johansson I, Kotenyova T, Moche M, Schuler H", "reference": { "type": "PubMed", "id": "20072699", "url": "https://pubmed.ncbi.nlm.nih.gov/20072699" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 229, "end_pos": 229, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34932", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34932" }, { "database": "PubMed", "id": "20072699", "url": "https://pubmed.ncbi.nlm.nih.gov/20072699" } ], "site_lbl": "Thr229", "uniprot_canonical_ac": "P34932-1" } ], "record_id": "pubmed.20072699", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 60 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of SIRT1 activity by genotoxic stress.", "journal": "Genes & development", "date": "2012", "authors": "Yuan J, Luo K, Liu T, Lou Z", "reference": { "type": "PubMed", "id": "22465953", "url": "https://pubmed.ncbi.nlm.nih.gov/22465953" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60477-1", "protein_name": "BMP/retinoic acid-inducible neural-specific protein 1", "gene_name": "BRINP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 454, "end_pos": 454, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by ATM, ATR and CK2", "evidence": [ { "database": "UniProtKB", "id": "Q8N163", "url": "https://www.uniprot.org/uniprotkb/Q8N163" }, { "database": "PRO", "id": "Q8N163", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q8N163" }, { "database": "iPTMnet", "id": "Q8N163", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N163" }, { "database": "PubMed", "id": "22465953", "url": "https://pubmed.ncbi.nlm.nih.gov/22465953" }, { "database": "PubMed", "id": "22735644", "url": "https://pubmed.ncbi.nlm.nih.gov/22735644" }, { "database": "PubMed", "id": "24129246", "url": "https://pubmed.ncbi.nlm.nih.gov/24129246" }, { "database": "PubMed", "id": "25361978", "url": "https://pubmed.ncbi.nlm.nih.gov/25361978" }, { "database": "PubMed", "id": "26194823", "url": "https://pubmed.ncbi.nlm.nih.gov/26194823" }, { "database": "PubMed", "id": "27503537", "url": "https://pubmed.ncbi.nlm.nih.gov/27503537" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24962073", "url": "https://pubmed.ncbi.nlm.nih.gov/24962073" } ], "site_lbl": "Thr454", "uniprot_canonical_ac": "Q8N163-1" } ], "record_id": "pubmed.22465953", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 69 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hikeshi, a nuclear import carrier for Hsp70s, protects cells from heat shock-induced nuclear damage.", "journal": "Cell", "date": "2012", "authors": "Kose S, Furuta M, Imamoto N", "reference": { "type": "PubMed", "id": "22541429", "url": "https://pubmed.ncbi.nlm.nih.gov/22541429" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22541429", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DBC1 phosphorylation by ATM/ATR inhibits SIRT1 deacetylase in response to DNA damage.", "journal": "Journal of molecular cell biology", "date": "2012", "authors": "Zannini L, Buscemi G, Kim JE, Fontanella E, Delia D", "reference": { "type": "PubMed", "id": "22735644", "url": "https://pubmed.ncbi.nlm.nih.gov/22735644" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 454, "end_pos": 454, "sequence_org": "T", "sequence_mut": "A", "comment": "Significantly reduces association with SIRT1. Decreases sumoylation and the interaction of the sumoylated form with SIRT1. Inhibits CCAR2-PSIA3 interaction. Increases CCAR2-SENP1 interaction. Down-regulation of the signals related with the epithelial-mesenchymal transition of gastric cancer cells.", "evidence": [ { "database": "UniProtKB", "id": "Q8N163", "url": "https://www.uniprot.org/uniprotkb/Q8N163" }, { "database": "PubMed", "id": "22735644", "url": "https://pubmed.ncbi.nlm.nih.gov/22735644" }, { "database": "PubMed", "id": "25406032", "url": "https://pubmed.ncbi.nlm.nih.gov/25406032" }, { "database": "PubMed", "id": "24962073", "url": "https://pubmed.ncbi.nlm.nih.gov/24962073" } ], "uniprot_canonical_ac": "Q8N163-1" }, { "start_pos": 454, "end_pos": 454, "sequence_org": "T", "sequence_mut": "D", "comment": "Significantly increases association with SIRT1 and induces p53 acetylation and apoptosis. Increases sumoylation and the interaction of the sumoylated form with SIRT1. Promotes CCAR2-PSIA3 interaction. Decreases CCAR2-SENP1 interaction.", "evidence": [ { "database": "UniProtKB", "id": "Q8N163", "url": "https://www.uniprot.org/uniprotkb/Q8N163" }, { "database": "PubMed", "id": "22735644", "url": "https://pubmed.ncbi.nlm.nih.gov/22735644" }, { "database": "PubMed", "id": "25406032", "url": "https://pubmed.ncbi.nlm.nih.gov/25406032" } ], "uniprot_canonical_ac": "Q8N163-1" } ], "phosphorylation": [ { "start_pos": 454, "end_pos": 454, "kinase_uniprot_canonical_ac": "Q13315-1", "kinase_gene_name": "ATM", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8N163", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N163" }, { "database": "PubMed", "id": "22735644", "url": "https://pubmed.ncbi.nlm.nih.gov/22735644" } ], "site_lbl": "Thr454", "uniprot_canonical_ac": "Q8N163-1" }, { "start_pos": 454, "end_pos": 454, "kinase_uniprot_canonical_ac": "Q13535-1", "kinase_gene_name": "ATR", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8N163", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N163" }, { "database": "PubMed", "id": "22735644", "url": "https://pubmed.ncbi.nlm.nih.gov/22735644" } ], "site_lbl": "Thr454", "uniprot_canonical_ac": "Q8N163-1" }, { "start_pos": 454, "end_pos": 454, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by ATM, ATR and CK2", "evidence": [ { "database": "UniProtKB", "id": "Q8N163", "url": "https://www.uniprot.org/uniprotkb/Q8N163" }, { "database": "PRO", "id": "Q8N163", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q8N163" }, { "database": "iPTMnet", "id": "Q8N163", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N163" }, { "database": "PubMed", "id": "22465953", "url": "https://pubmed.ncbi.nlm.nih.gov/22465953" }, { "database": "PubMed", "id": "22735644", "url": "https://pubmed.ncbi.nlm.nih.gov/22735644" }, { "database": "PubMed", "id": "24129246", "url": "https://pubmed.ncbi.nlm.nih.gov/24129246" }, { "database": "PubMed", "id": "25361978", "url": "https://pubmed.ncbi.nlm.nih.gov/25361978" }, { "database": "PubMed", "id": "26194823", "url": "https://pubmed.ncbi.nlm.nih.gov/26194823" }, { "database": "PubMed", "id": "27503537", "url": "https://pubmed.ncbi.nlm.nih.gov/27503537" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24962073", "url": "https://pubmed.ncbi.nlm.nih.gov/24962073" } ], "site_lbl": "Thr454", "uniprot_canonical_ac": "Q8N163-1" } ], "record_id": "pubmed.22735644", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RPA assists HSF1 access to nucleosomal DNA by recruiting histone chaperone FACT.", "journal": "Molecular cell", "date": "2012", "authors": "Fujimoto M, Takaki E, Takii R, Tan K, Prakasam R, Hayashida N, Iemura S, Natsume T, Nakai A", "reference": { "type": "PubMed", "id": "22940245", "url": "https://pubmed.ncbi.nlm.nih.gov/22940245" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22940245", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The SIRT1 modulators AROS and DBC1 regulate HSF1 activity and the heat shock response.", "journal": "PloS one", "date": "2013", "authors": "Raynes R, Pombier KM, Nguyen K, Brunquell J, Mendez JE, Westerheide SD", "reference": { "type": "PubMed", "id": "23349863", "url": "https://pubmed.ncbi.nlm.nih.gov/23349863" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60477-1", "protein_name": "BMP/retinoic acid-inducible neural-specific protein 1", "gene_name": "BRINP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23349863", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 69 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Anchoring of both PKA-RIIalpha and 14-3-3theta regulates retinoic acid induced 16 mediated phosphorylation of heat shock protein 70.", "journal": "Oncotarget", "date": "2015", "authors": "Ding CL, Xu G, Tang HL, Zhu SY, Zhao LJ, Ren H, Zhao P, Qi ZT, Wang W", "reference": { "type": "PubMed", "id": "25900241", "url": "https://pubmed.ncbi.nlm.nih.gov/25900241" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86V87-1", "protein_name": "FHF complex subunit HOOK-interacting protein 2B", "gene_name": "FHIP2B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 408, "end_pos": 408, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34932", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34932" }, { "database": "PubMed", "id": "25900241", "url": "https://pubmed.ncbi.nlm.nih.gov/25900241" } ], "site_lbl": "Ser408", "uniprot_canonical_ac": "P34932-1" }, { "start_pos": 325, "end_pos": 325, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q86V87", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86V87" }, { "database": "PubMed", "id": "25900241", "url": "https://pubmed.ncbi.nlm.nih.gov/25900241" } ], "site_lbl": "Ser325", "uniprot_canonical_ac": "Q86V87-1" }, { "start_pos": 486, "end_pos": 486, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q86V87", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86V87" }, { "database": "PubMed", "id": "25900241", "url": "https://pubmed.ncbi.nlm.nih.gov/25900241" } ], "site_lbl": "Ser486", "uniprot_canonical_ac": "Q86V87-1" } ], "record_id": "pubmed.25900241", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A new look at Hsp70 activity in phosphatidylserine-enriched membranes: chaperone-induced quasi-interdigitated lipid phase.", "journal": "Scientific reports", "date": "2023-11-06", "authors": "Tagaeva Ruslana, Efimova Svetlana, Ischenko Alexander, Zhakhov Alexander, Shevtsov Maxim, Ostroumova Olga", "reference": { "type": "PubMed", "id": "37932471", "url": "https://pubmed.ncbi.nlm.nih.gov/37932471" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37932471", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[The Protective Action of Hsp70 and Hydrogen Sulfide Donors in THP-1 Macrophages in the Lipopolysaccharide-Induced Inflammatory Response by Modulating Endocytosis].", "journal": "Molekuliarnaia biologiia", "date": "2023", "authors": "Yurinskaya M M, Garbuz D G, Evgen'ev M B, Vinokurov M G", "reference": { "type": "PubMed", "id": "38062957", "url": "https://pubmed.ncbi.nlm.nih.gov/38062957" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38062957", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HSP70 binds to specific non-coding RNA and regulates human RNA polymerase III.", "journal": "Molecular cell", "date": "2024-02-15", "authors": "Leone Sergio, Srivastava Avinash, Herrero-Ruiz Andr\u00e9s, Hummel Barbara, Tittel Lena, Campalastri Roberto, Aprile-Garcia Fernando, Tan Jun Hao, Rawat Prashant, Andersson Patrik, Willis Anne E, Sawarkar Ritwick", "reference": { "type": "PubMed", "id": "38266641", "url": "https://pubmed.ncbi.nlm.nih.gov/38266641" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38266641", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamically changed HSP70 after reperfusion following cerebral infarction in human and rats: correlation with p38 MAPK.", "journal": "Neuroreport", "date": "2024-05-08", "authors": "Tu Zhilan, Jin Pengpeng, Wang Qinghua, Feng Yanlin, Chu Xinjuan, Fu Lin, Hou Shuangxing, Li Weiwei", "reference": { "type": "PubMed", "id": "38597327", "url": "https://pubmed.ncbi.nlm.nih.gov/38597327" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O88600-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "Hspa4", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38597327", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hip, a novel cochaperone involved in the eukaryotic Hsc70/Hsp40 reaction cycle.", "journal": "Cell", "date": "1995", "authors": "Hohfeld J, Minami Y, Hartl FU", "reference": { "type": "PubMed", "id": "7585962", "url": "https://pubmed.ncbi.nlm.nih.gov/7585962" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50503-1", "protein_name": "Hsc70-interacting protein", "gene_name": "Slc25a17; St13", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7585962", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 69 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of a novel human hsp70 from a B cell line and its assignment to chromosome 5.", "journal": "J. Immunol.", "date": "1993", "authors": "Fathallah DM, Cherif D, Dellagi K, Arnaout MA", "reference": { "type": "PubMed", "id": "8335910", "url": "https://pubmed.ncbi.nlm.nih.gov/8335910" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8335910", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of human p48, a transient component of progesterone receptor complexes and an Hsp70-binding protein.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1996", "authors": "Prapapanich V, Chen S, Nair SC, Rimerman RA, Smith DF", "reference": { "type": "PubMed", "id": "8721986", "url": "https://pubmed.ncbi.nlm.nih.gov/8721986" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8721986", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Repression of human heat shock factor 1 activity at control temperature by phosphorylation.", "journal": "Genes & development", "date": "1996", "authors": "Knauf U, Newton EM, Kyriakis J, Kingston RE", "reference": { "type": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 296, "end_pos": 296, "sequence_org": "R", "sequence_mut": "A", "comment": "No effect neither on repression of transcriptional activity at control temperature nor on transcriptional activation upon heat shock.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 297, "end_pos": 297, "sequence_org": "V", "sequence_mut": "A", "comment": "Slight effect on derepression of transcriptional activity at control temperature and on transcriptional activation upon heat shock.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 298, "end_pos": 298, "sequence_org": "K", "sequence_mut": "A", "comment": "Induces derepression of transcriptional activity at control temperature.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "12665592", "url": "https://pubmed.ncbi.nlm.nih.gov/12665592" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 298, "end_pos": 298, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes sumoylation. No effect on phosphorylation of S-303 nor of S-307. No change in subcellular location to nuclear stress granules upon heat shock. Loss of colocalization with SUMO1 to nuclear stress granules upon heat shock. Does not change interaction with XRCC5 and XRCC6. No effect on binding to HSE nor on transactivation of HSP70. Increases transcriptional activity in a DAXX-dependent manner. No change in protein abundance.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "24581496", "url": "https://pubmed.ncbi.nlm.nih.gov/24581496" }, { "database": "PubMed", "id": "26359349", "url": "https://pubmed.ncbi.nlm.nih.gov/26359349" }, { "database": "PubMed", "id": "12665592", "url": "https://pubmed.ncbi.nlm.nih.gov/12665592" }, { "database": "PubMed", "id": "12646186", "url": "https://pubmed.ncbi.nlm.nih.gov/12646186" }, { "database": "PubMed", "id": "11514557", "url": "https://pubmed.ncbi.nlm.nih.gov/11514557" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" }, { "database": "PubMed", "id": "15016915", "url": "https://pubmed.ncbi.nlm.nih.gov/15016915" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 299, "end_pos": 299, "sequence_org": "E", "sequence_mut": "A", "comment": "No effect on repression of transcriptional activity at control temperature.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 300, "end_pos": 300, "sequence_org": "E", "sequence_mut": "A", "comment": "Induces derepression of transcriptional activity at control temperature.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 303, "end_pos": 303, "sequence_org": "S", "sequence_mut": "A", "comment": "No phosphorylation nor sumoylation. No change in nuclear stress granules subcellular location upon heat shock. Loss of colocalization with SUMO1 to nuclear stress granules upon heat shock. Slight decrease in transcriptional activity on heat treatment. No change in PLK1-induced phosphorylation in mitosis, induces derepression of transcription activation at control temperature, abolishes sumoylation and induces 2.5-fold increase in transcriptional activity on heat treatment; when associated with A-307.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" }, { "database": "PubMed", "id": "9535852", "url": "https://pubmed.ncbi.nlm.nih.gov/9535852" }, { "database": "PubMed", "id": "12665592", "url": "https://pubmed.ncbi.nlm.nih.gov/12665592" }, { "database": "PubMed", "id": "9121459", "url": "https://pubmed.ncbi.nlm.nih.gov/9121459" }, { "database": "PubMed", "id": "12646186", "url": "https://pubmed.ncbi.nlm.nih.gov/12646186" }, { "database": "PubMed", "id": "18794143", "url": "https://pubmed.ncbi.nlm.nih.gov/18794143" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 303, "end_pos": 303, "sequence_org": "S", "sequence_mut": "D", "comment": "Mimics phosphorylation. No effect on in vitro sumoylation. Greatly increased transcriptional activity on heat induction. 5-fold derepression of transcriptional activity at control temperature; when associated with D-307.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" }, { "database": "PubMed", "id": "9535852", "url": "https://pubmed.ncbi.nlm.nih.gov/9535852" }, { "database": "PubMed", "id": "12665592", "url": "https://pubmed.ncbi.nlm.nih.gov/12665592" }, { "database": "PubMed", "id": "9121459", "url": "https://pubmed.ncbi.nlm.nih.gov/9121459" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 307, "end_pos": 307, "sequence_org": "S", "sequence_mut": "A", "comment": "No phosphorylation. Does not reduce Ser-303 phosphorylation. 1.5% increase in transcriptional activity on heat-treatment. No change in PLK1-induced phosphorylation in mitosis, induces derepression of transcription activation at control temperature, abolishes sumoylation and induces 2.5-fold increase in transcriptional activity on heat treatment; when associated with A-303.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" }, { "database": "PubMed", "id": "9535852", "url": "https://pubmed.ncbi.nlm.nih.gov/9535852" }, { "database": "PubMed", "id": "12665592", "url": "https://pubmed.ncbi.nlm.nih.gov/12665592" }, { "database": "PubMed", "id": "9121459", "url": "https://pubmed.ncbi.nlm.nih.gov/9121459" }, { "database": "PubMed", "id": "12646186", "url": "https://pubmed.ncbi.nlm.nih.gov/12646186" }, { "database": "PubMed", "id": "18794143", "url": "https://pubmed.ncbi.nlm.nih.gov/18794143" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 307, "end_pos": 307, "sequence_org": "S", "sequence_mut": "D", "comment": "5-fold derepression of transcriptional activity at control temperature; when associated with D-303. Decreased HSF1-induced expression of HSPA1A mRNA in a IER5-dependent manner; when associated with D-121; D-314; D-323 and D-367.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" }, { "database": "PubMed", "id": "26754925", "url": "https://pubmed.ncbi.nlm.nih.gov/26754925" }, { "database": "PubMed", "id": "9121459", "url": "https://pubmed.ncbi.nlm.nih.gov/9121459" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 309, "end_pos": 309, "sequence_org": "R", "sequence_mut": "A", "comment": "No effect on repression of transcriptional activity at control temperature.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 311, "end_pos": 311, "sequence_org": "E", "sequence_mut": "A", "comment": "No effect neither on repression of transcriptional activity at control temperature nor on transcriptional activation upon heat shock.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" } ], "uniprot_canonical_ac": "Q00613-1" } ], "phosphorylation": [ { "start_pos": 303, "end_pos": 303, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by GSK3-beta", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "iPTMnet", "id": "Q00613", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q00613" }, { "database": "PubMed", "id": "12665592", "url": "https://pubmed.ncbi.nlm.nih.gov/12665592" }, { "database": "PubMed", "id": "18212344", "url": "https://pubmed.ncbi.nlm.nih.gov/18212344" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PRO", "id": "Q00613", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q00613" }, { "database": "PubMed", "id": "12917326", "url": "https://pubmed.ncbi.nlm.nih.gov/12917326" }, { "database": "PubMed", "id": "9121459", "url": "https://pubmed.ncbi.nlm.nih.gov/9121459" }, { "database": "PubMed", "id": "11162511", "url": "https://pubmed.ncbi.nlm.nih.gov/11162511" }, { "database": "PubMed", "id": "15760475", "url": "https://pubmed.ncbi.nlm.nih.gov/15760475" }, { "database": "PubMed", "id": "19945465", "url": "https://pubmed.ncbi.nlm.nih.gov/19945465" }, { "database": "PubMed", "id": "20926391", "url": "https://pubmed.ncbi.nlm.nih.gov/20926391" }, { "database": "PubMed", "id": "22768106", "url": "https://pubmed.ncbi.nlm.nih.gov/22768106" }, { "database": "PubMed", "id": "24412756", "url": "https://pubmed.ncbi.nlm.nih.gov/24412756" }, { "database": "PubMed", "id": "24589236", "url": "https://pubmed.ncbi.nlm.nih.gov/24589236" }, { "database": "PubMed", "id": "24954509", "url": "https://pubmed.ncbi.nlm.nih.gov/24954509" }, { "database": "PubMed", "id": "26754925", "url": "https://pubmed.ncbi.nlm.nih.gov/26754925" }, { "database": "PubMed", "id": "26785146", "url": "https://pubmed.ncbi.nlm.nih.gov/26785146" }, { "database": "PubMed", "id": "27354066", "url": "https://pubmed.ncbi.nlm.nih.gov/27354066" }, { "database": "PubMed", "id": "28383811", "url": "https://pubmed.ncbi.nlm.nih.gov/28383811" }, { "database": "PubMed", "id": "28415561", "url": "https://pubmed.ncbi.nlm.nih.gov/28415561" }, { "database": "PubMed", "id": "31054961", "url": "https://pubmed.ncbi.nlm.nih.gov/31054961" }, { "database": "PubMed", "id": "32457290", "url": "https://pubmed.ncbi.nlm.nih.gov/32457290" }, { "database": "PubMed", "id": "33493517", "url": "https://pubmed.ncbi.nlm.nih.gov/33493517" }, { "database": "PubMed", "id": "34239690", "url": "https://pubmed.ncbi.nlm.nih.gov/34239690" }, { "database": "PubMed", "id": "9660838", "url": "https://pubmed.ncbi.nlm.nih.gov/9660838" }, { "database": "PubMed", "id": "16371476", "url": "https://pubmed.ncbi.nlm.nih.gov/16371476" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "8940068", "url": "https://pubmed.ncbi.nlm.nih.gov/8940068" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" }, { "database": "PubMed", "id": "11447121", "url": "https://pubmed.ncbi.nlm.nih.gov/11447121" } ], "site_lbl": "Ser303", "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 307, "end_pos": 307, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK3", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "iPTMnet", "id": "Q00613", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q00613" }, { "database": "PubMed", "id": "18212344", "url": "https://pubmed.ncbi.nlm.nih.gov/18212344" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "8940068", "url": "https://pubmed.ncbi.nlm.nih.gov/8940068" }, { "database": "PRO", "id": "Q00613", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q00613" }, { "database": "PubMed", "id": "12917326", "url": "https://pubmed.ncbi.nlm.nih.gov/12917326" }, { "database": "PubMed", "id": "9121459", "url": "https://pubmed.ncbi.nlm.nih.gov/9121459" }, { "database": "PubMed", "id": "11162511", "url": "https://pubmed.ncbi.nlm.nih.gov/11162511" }, { "database": "PubMed", "id": "12646186", "url": "https://pubmed.ncbi.nlm.nih.gov/12646186" }, { "database": "PubMed", "id": "15760475", "url": "https://pubmed.ncbi.nlm.nih.gov/15760475" }, { "database": "PubMed", "id": "19945465", "url": "https://pubmed.ncbi.nlm.nih.gov/19945465" }, { "database": "PubMed", "id": "26754925", "url": "https://pubmed.ncbi.nlm.nih.gov/26754925" }, { "database": "PubMed", "id": "26785146", "url": "https://pubmed.ncbi.nlm.nih.gov/26785146" }, { "database": "PubMed", "id": "27354066", "url": "https://pubmed.ncbi.nlm.nih.gov/27354066" }, { "database": "PubMed", "id": "28383811", "url": "https://pubmed.ncbi.nlm.nih.gov/28383811" }, { "database": "PubMed", "id": "28415561", "url": "https://pubmed.ncbi.nlm.nih.gov/28415561" }, { "database": "PubMed", "id": "31054961", "url": "https://pubmed.ncbi.nlm.nih.gov/31054961" }, { "database": "PubMed", "id": "32457290", "url": "https://pubmed.ncbi.nlm.nih.gov/32457290" }, { "database": "PubMed", "id": "33493517", "url": "https://pubmed.ncbi.nlm.nih.gov/33493517" }, { "database": "PubMed", "id": "34239690", "url": "https://pubmed.ncbi.nlm.nih.gov/34239690" }, { "database": "PubMed", "id": "9660838", "url": "https://pubmed.ncbi.nlm.nih.gov/9660838" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" }, { "database": "PubMed", "id": "9535852", "url": "https://pubmed.ncbi.nlm.nih.gov/9535852" }, { "database": "PubMed", "id": "11447121", "url": "https://pubmed.ncbi.nlm.nih.gov/11447121" } ], "site_lbl": "Ser307", "uniprot_canonical_ac": "Q00613-1" } ], "record_id": "pubmed.8946918", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAG-1 modulates the chaperone activity of Hsp70/Hsc70.", "journal": "The EMBO journal", "date": "1997", "authors": "Takayama S, Bimston DN, Matsuzawa S, Freeman BC, Aime-Sempe C, Xie Z, Morimoto RI, Reed JC", "reference": { "type": "PubMed", "id": "9305631", "url": "https://pubmed.ncbi.nlm.nih.gov/9305631" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10415-1", "protein_name": "Apoptosis regulator Bcl-2", "gene_name": "BCL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9305631", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 69 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An evolutionarily conserved family of Hsp70/Hsc70 molecular chaperone regulators.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Takayama S, Xie Z, Reed JC", "reference": { "type": "PubMed", "id": "9873016", "url": "https://pubmed.ncbi.nlm.nih.gov/9873016" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P34932-1", "protein_name": "Heat shock 70 kDa protein 4", "gene_name": "HSPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11021-1", "protein_name": "Endoplasmic reticulum chaperone BiP", "gene_name": "HSPA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WX3-1", "protein_name": "Active regulator of SIRT1", "gene_name": "RPS19BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95429-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50502-1", "protein_name": "Hsc70-interacting protein", "gene_name": "ST13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95817-1", "protein_name": "BAG family molecular chaperone regulator 3", "gene_name": "BAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60739-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "Bag1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q99543-1", "protein_name": "DnaJ homolog subfamily C member 2", "gene_name": "DNAJC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17066-1", "protein_name": "Heat shock 70 kDa protein 6", "gene_name": "HSPA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92598-1", "protein_name": "Heat shock protein 105 kDa", "gene_name": "HSPH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MM6-1", "protein_name": "Heat shock 70 kDa protein 12B", "gene_name": "HSPA12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43301-1", "protein_name": "Heat shock 70 kDa protein 12A", "gene_name": "HSPA12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53FT3-1", "protein_name": "Protein Hikeshi", "gene_name": "HIKESHI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99615-1", "protein_name": "DnaJ homolog subfamily C member 7", "gene_name": "DNAJC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99933-1", "protein_name": "BAG family molecular chaperone regulator 1", "gene_name": "BAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N163-1", "protein_name": "Cell cycle and apoptosis regulator protein 2", "gene_name": "CCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49841-1", "protein_name": "Glycogen synthase kinase-3 beta", "gene_name": "GSK3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75190-1", "protein_name": "DnaJ homolog subfamily B member 6", "gene_name": "DNAJB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL15-1", "protein_name": "BAG family molecular chaperone regulator 5", "gene_name": "BAG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0VDF9-1", "protein_name": "Heat shock 70 kDa protein 14", "gene_name": "HSPA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48741-1", "protein_name": "Putative heat shock 70 kDa protein 7", "gene_name": "HSPA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95816-1", "protein_name": "BAG family molecular chaperone regulator 2", "gene_name": "BAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95757-1", "protein_name": "Heat shock 70 kDa protein 4L", "gene_name": "HSPA4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48723-1", "protein_name": "Heat shock 70 kDa protein 13", "gene_name": "HSPA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P34932", "url": "https://www.uniprot.org/uniprotkb/P34932" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9873016", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 69 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.", "journal": "Genomics", "date": "2006", "authors": "Tsang Hilda T H, Connell James W, Brown Stephanie E, Thompson Amanda, Reid Evan, Sanderson Christopher M", "reference": { "type": "PubMed", "id": "16730941", "url": "https://pubmed.ncbi.nlm.nih.gov/16730941" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WV92-1", "protein_name": "MIT domain-containing protein 1", "gene_name": "MITD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7LBR1-1", "protein_name": "Charged multivesicular body protein 1b", "gene_name": "CHMP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3E7-1", "protein_name": "Charged multivesicular body protein 3", "gene_name": "CHMP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43633-1", "protein_name": "Charged multivesicular body protein 2a", "gene_name": "CHMP2A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16730941", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Essential role of hIST1 in cytokinesis.", "journal": "Mol. Biol. Cell", "date": "2009", "authors": "Agromayor M, Carlton JG, Phelan JP, Matthews DR, Carlin LM, Ameer-Beg S, Bowers K, Martin-Serrano J", "reference": { "type": "PubMed", "id": "19129480", "url": "https://pubmed.ncbi.nlm.nih.gov/19129480" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WV92-1", "protein_name": "MIT domain-containing protein 1", "gene_name": "MITD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN37-1", "protein_name": "Vacuolar protein sorting-associated protein 4A", "gene_name": "VPS4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7LBR1-1", "protein_name": "Charged multivesicular body protein 1b", "gene_name": "CHMP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40818-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 8", "gene_name": "USP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HD42-1", "protein_name": "Charged multivesicular body protein 1a", "gene_name": "CHMP1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP79-1", "protein_name": "Vacuolar protein sorting-associated protein VTA1 homolog", "gene_name": "VTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53990-1", "protein_name": "IST1 homolog", "gene_name": "IST1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 64, "end_pos": 64, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes interaction with CHMP1B; diminishes interaction with IST1.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "16174732", "url": "https://pubmed.ncbi.nlm.nih.gov/16174732" }, { "database": "PubMed", "id": "18606141", "url": "https://pubmed.ncbi.nlm.nih.gov/18606141" }, { "database": "PubMed", "id": "17928862", "url": "https://pubmed.ncbi.nlm.nih.gov/17928862" }, { "database": "PubMed", "id": "19129480", "url": "https://pubmed.ncbi.nlm.nih.gov/19129480" }, { "database": "PubMed", "id": "19129479", "url": "https://pubmed.ncbi.nlm.nih.gov/19129479" } ], "uniprot_canonical_ac": "Q9UN37-1" }, { "start_pos": 64, "end_pos": 64, "sequence_org": "L", "sequence_mut": "D", "comment": "Abolishes interaction with CHMP1B; diminishes interaction with IST1.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "16174732", "url": "https://pubmed.ncbi.nlm.nih.gov/16174732" }, { "database": "PubMed", "id": "18606141", "url": "https://pubmed.ncbi.nlm.nih.gov/18606141" }, { "database": "PubMed", "id": "17928862", "url": "https://pubmed.ncbi.nlm.nih.gov/17928862" }, { "database": "PubMed", "id": "19129480", "url": "https://pubmed.ncbi.nlm.nih.gov/19129480" }, { "database": "PubMed", "id": "19129479", "url": "https://pubmed.ncbi.nlm.nih.gov/19129479" } ], "uniprot_canonical_ac": "Q9UN37-1" }, { "start_pos": 64, "end_pos": 64, "sequence_org": "L", "sequence_mut": "D", "comment": "Greatly diminishes localization to punctate class E compartments and partially restores HIV-1 release; when associated with Q-173.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "16174732", "url": "https://pubmed.ncbi.nlm.nih.gov/16174732" }, { "database": "PubMed", "id": "18606141", "url": "https://pubmed.ncbi.nlm.nih.gov/18606141" }, { "database": "PubMed", "id": "17928862", "url": "https://pubmed.ncbi.nlm.nih.gov/17928862" }, { "database": "PubMed", "id": "19129480", "url": "https://pubmed.ncbi.nlm.nih.gov/19129480" }, { "database": "PubMed", "id": "19129479", "url": "https://pubmed.ncbi.nlm.nih.gov/19129479" } ], "uniprot_canonical_ac": "Q9UN37-1" }, { "start_pos": 64, "end_pos": 64, "sequence_org": "L", "sequence_mut": "D", "comment": "Modestly reduces interaction with CHMP6.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "16174732", "url": "https://pubmed.ncbi.nlm.nih.gov/16174732" }, { "database": "PubMed", "id": "18606141", "url": "https://pubmed.ncbi.nlm.nih.gov/18606141" }, { "database": "PubMed", "id": "17928862", "url": "https://pubmed.ncbi.nlm.nih.gov/17928862" }, { "database": "PubMed", "id": "19129480", "url": "https://pubmed.ncbi.nlm.nih.gov/19129480" }, { "database": "PubMed", "id": "19129479", "url": "https://pubmed.ncbi.nlm.nih.gov/19129479" } ], "uniprot_canonical_ac": "Q9UN37-1" }, { "start_pos": 360, "end_pos": 361, "sequence_org": "LK", "sequence_mut": "AA", "comment": "Abolishes interaction with VTA1, MITD1 and USP8; diminishes interaction with VPS4A.", "evidence": [ { "database": "UniProtKB", "id": "P53990", "url": "https://www.uniprot.org/uniprotkb/P53990" }, { "database": "PubMed", "id": "19129480", "url": "https://pubmed.ncbi.nlm.nih.gov/19129480" } ], "uniprot_canonical_ac": "P53990-1" } ], "record_id": "pubmed.19129480", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MITD1 is recruited to midbodies by ESCRT-III and participates in cytokinesis.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Lee S, Chang J, Renvoise B, Tipirneni A, Yang S, Blackstone C", "reference": { "type": "PubMed", "id": "23015756", "url": "https://pubmed.ncbi.nlm.nih.gov/23015756" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WV92-1", "protein_name": "MIT domain-containing protein 1", "gene_name": "MITD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53990-1", "protein_name": "IST1 homolog", "gene_name": "IST1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23015756", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ESCRT-III binding protein MITD1 is involved in cytokinesis and has an unanticipated PLD fold that binds membranes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Hadders MA, Agromayor M, Obita T, Perisic O, Caballe A, Kloc M, Lamers MH, Williams RL, Martin-Serrano J", "reference": { "type": "PubMed", "id": "23045692", "url": "https://pubmed.ncbi.nlm.nih.gov/23045692" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WV92-1", "protein_name": "MIT domain-containing protein 1", "gene_name": "MITD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HD42-1", "protein_name": "Charged multivesicular body protein 1a", "gene_name": "CHMP1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 132, "end_pos": 132, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes homodimerization; when associated with A-221 and A-225.", "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" }, { "database": "PubMed", "id": "23045692", "url": "https://pubmed.ncbi.nlm.nih.gov/23045692" } ], "uniprot_canonical_ac": "Q8WV92-1" }, { "start_pos": 168, "end_pos": 168, "sequence_org": "R", "sequence_mut": "E", "comment": "Strongly reduces binding to membranes; when associated with E-221 and E-231.", "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" }, { "database": "PubMed", "id": "23045692", "url": "https://pubmed.ncbi.nlm.nih.gov/23045692" } ], "uniprot_canonical_ac": "Q8WV92-1" }, { "start_pos": 220, "end_pos": 220, "sequence_org": "R", "sequence_mut": "E", "comment": "Strongly reduces binding to membranes; when associated with E-168 and E-231.", "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" }, { "database": "PubMed", "id": "23045692", "url": "https://pubmed.ncbi.nlm.nih.gov/23045692" } ], "uniprot_canonical_ac": "Q8WV92-1" }, { "start_pos": 221, "end_pos": 221, "sequence_org": "F", "sequence_mut": "A", "comment": "Abolishes homodimerization; when associated with A-132 and A-225.", "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" }, { "database": "PubMed", "id": "23045692", "url": "https://pubmed.ncbi.nlm.nih.gov/23045692" } ], "uniprot_canonical_ac": "Q8WV92-1" }, { "start_pos": 225, "end_pos": 225, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes homodimerization; when associated with A-132 and A-221.", "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" }, { "database": "PubMed", "id": "23045692", "url": "https://pubmed.ncbi.nlm.nih.gov/23045692" } ], "uniprot_canonical_ac": "Q8WV92-1" }, { "start_pos": 231, "end_pos": 231, "sequence_org": "R", "sequence_mut": "E", "comment": "Strongly reduces binding to membranes; when associated with E-221 and E-220.", "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" }, { "database": "PubMed", "id": "23045692", "url": "https://pubmed.ncbi.nlm.nih.gov/23045692" } ], "uniprot_canonical_ac": "Q8WV92-1" }, { "start_pos": 69, "end_pos": 69, "sequence_org": "M", "sequence_mut": "D", "comment": "Abolishes interaction with CHMP1A, CHMP1B and CHMP2A.", "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" }, { "database": "PubMed", "id": "23045692", "url": "https://pubmed.ncbi.nlm.nih.gov/23045692" } ], "uniprot_canonical_ac": "Q8WV92-1" }, { "start_pos": 73, "end_pos": 73, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes interaction with CHMP1A, CHMP1B and CHMP2A. Abolishes location at the midbody.", "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" }, { "database": "PubMed", "id": "23045692", "url": "https://pubmed.ncbi.nlm.nih.gov/23045692" } ], "uniprot_canonical_ac": "Q8WV92-1" } ], "record_id": "pubmed.23045692", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evaluating the biological functions of the prognostic genes identified by the Pathology Atlas in bladder cancer.", "journal": "Oncology reports", "date": "2021", "authors": "Chen Y, Xu T, Xie F, Wang L, Liang Z, Li D, Liang Y, Zhao K, Qi X, Yang X, Jiao W", "reference": { "type": "PubMed", "id": "33200223", "url": "https://pubmed.ncbi.nlm.nih.gov/33200223" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WV92-1", "protein_name": "MIT domain-containing protein 1", "gene_name": "MITD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33200223", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prognostic Impact of MITD1 and Associates With Immune Infiltration in Kidney Renal Clear Cell Carcinoma.", "journal": "Technology in cancer research & treatment", "date": "2021", "authors": "Chen C, Sheng Y", "reference": { "type": "PubMed", "id": "34346239", "url": "https://pubmed.ncbi.nlm.nih.gov/34346239" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WV92-1", "protein_name": "MIT domain-containing protein 1", "gene_name": "MITD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34346239", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MITD1 Deficiency Suppresses Clear Cell Renal Cell Carcinoma Growth and Migration by Inducing Ferroptosis through the TAZ/SLC7A11 Pathway.", "journal": "Oxidative medicine and cellular longevity", "date": "2022", "authors": "Zhang Y, Li Y, Qiu Q, Chen Z, Du Y, Liu X", "reference": { "type": "PubMed", "id": "36046690", "url": "https://pubmed.ncbi.nlm.nih.gov/36046690" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WV92-1", "protein_name": "MIT domain-containing protein 1", "gene_name": "MITD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36046690", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pan-Cancer Analysis of the Prognostic and Immunotherapeutic Value of MITD1.", "journal": "Cells", "date": "2022-10-21", "authors": "Dong Shiqiang, Hou Dingkun, Peng Yun, Chen Xiaoxu, Li Hongzheng, Wang Haitao", "reference": { "type": "PubMed", "id": "36291174", "url": "https://pubmed.ncbi.nlm.nih.gov/36291174" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WV92-1", "protein_name": "MIT domain-containing protein 1", "gene_name": "MITD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36291174", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MITD1 deficiency leads to poor survival via tissue factor-mediated coagulation in bladder cancer.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2024-03-28", "authors": "Chen Yuanbin, Jiao Wei, Wang Yonghua, Liang Zhijuan, Wang Liping, Li Dan, Liang Ye, Niu Haitao", "reference": { "type": "PubMed", "id": "38554936", "url": "https://pubmed.ncbi.nlm.nih.gov/38554936" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WV92-1", "protein_name": "MIT domain-containing protein 1", "gene_name": "MITD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WV92", "url": "https://www.uniprot.org/uniprotkb/Q8WV92" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38554936", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A nucleolar protein RRS1 contributes to chromosome congression.", "journal": "FEBS letters", "date": "2009", "authors": "Gambe AE, Matsunaga S, Takata H, Ono-Maniwa R, Baba A, Uchiyama S, Fukui K", "reference": { "type": "PubMed", "id": "19465021", "url": "https://pubmed.ncbi.nlm.nih.gov/19465021" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15050-1", "protein_name": "Ribosome biogenesis regulatory protein homolog", "gene_name": "RRS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15050", "url": "https://www.uniprot.org/uniprotkb/Q15050" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19465021", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The 5S RNP couples p53 homeostasis to ribosome biogenesis and nucleolar stress.", "journal": "Cell reports", "date": "2013", "authors": "Sloan KE, Bohnsack MT, Watkins NJ", "reference": { "type": "PubMed", "id": "24120868", "url": "https://pubmed.ncbi.nlm.nih.gov/24120868" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15050-1", "protein_name": "Ribosome biogenesis regulatory protein homolog", "gene_name": "RRS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46087-1", "protein_name": "28S rRNA (cytosine(4447)-C(5))-methyltransferase", "gene_name": "NOP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7B2-1", "protein_name": "Ribosome production factor 2 homolog", "gene_name": "RPF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZM5-1", "protein_name": "Ribosome biogenesis protein NOP53", "gene_name": "NOP53", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14137-1", "protein_name": "Ribosome biogenesis protein BOP1", "gene_name": "BOP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46777-1", "protein_name": "Large ribosomal subunit protein uL18", "gene_name": "RPL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62913-1", "protein_name": "Large ribosomal subunit protein uL5", "gene_name": "RPL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NWT1-1", "protein_name": "p21-activated protein kinase-interacting protein 1", "gene_name": "PAK1IP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92664-1", "protein_name": "Transcription factor IIIA", "gene_name": "GTF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00987-1", "protein_name": "E3 ubiquitin-protein ligase Mdm2", "gene_name": "MDM2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15050", "url": "https://www.uniprot.org/uniprotkb/Q15050" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24120868", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic gain of RRS1 promotes hepatocellular carcinoma through reducing the RPL11-MDM2-p53 signaling.", "journal": "Science advances", "date": "2021", "authors": "Cao P, Yang A, Li P, Xia X, Han Y, Zhou G, Wang R, Yang F, Li Y, Zhang Y, Cui Y, Ji H, Lu L, He F, Zhou G", "reference": { "type": "PubMed", "id": "34433556", "url": "https://pubmed.ncbi.nlm.nih.gov/34433556" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15050-1", "protein_name": "Ribosome biogenesis regulatory protein homolog", "gene_name": "RRS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15050", "url": "https://www.uniprot.org/uniprotkb/Q15050" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34433556", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of nascent 5S RNPs at the crossroad between ribosome assembly and MDM2-p53 pathways.", "journal": "Nat. Struct. Mol. Biol.", "date": "2023", "authors": "Castillo Duque de Estrada Nestor Miguel, Thoms Matthias, Flemming Dirk, Hammaren Henrik M, Buschauer Robert, Ameismeier Michael, Ba\u00dfler Jochen, Beck Martin, Beckmann Roland, Hurt Ed", "reference": { "type": "PubMed", "id": "37291423", "url": "https://pubmed.ncbi.nlm.nih.gov/37291423" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15050-1", "protein_name": "Ribosome biogenesis regulatory protein homolog", "gene_name": "RRS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3E757-1", "protein_name": "Large ribosomal subunit protein uL5B", "gene_name": "RPL11B", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P26321-1", "protein_name": "Large ribosomal subunit protein uL18", "gene_name": "RPL5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9H7B2-1", "protein_name": "Ribosome production factor 2 homolog", "gene_name": "RPF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08746-1", "protein_name": "Regulator of ribosome biosynthesis", "gene_name": "RRS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46777-1", "protein_name": "Large ribosomal subunit protein uL18", "gene_name": "RPL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4Q2-1", "protein_name": "HEAT repeat-containing protein 3", "gene_name": "HEATR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62913-1", "protein_name": "Large ribosomal subunit protein uL5", "gene_name": "RPL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07395-1", "protein_name": "Synchronized import protein 1", "gene_name": "SYO1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36160-1", "protein_name": "Ribosome biogenesis protein RPF2", "gene_name": "RPF2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P0C0W9-1", "protein_name": "Large ribosomal subunit protein uL5A", "gene_name": "RPL11A", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q00987-1", "protein_name": "E3 ubiquitin-protein ligase Mdm2", "gene_name": "MDM2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15050", "url": "https://www.uniprot.org/uniprotkb/Q15050" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37291423", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic gain/methylation modification/hsa-miR-132-3p increases RRS1 overexpression in liver hepatocellular carcinoma.", "journal": "Cancer science", "date": "2023-11", "authors": "Zhang Xiaoxia, Cong Peilin, Tian Li, Zheng Yinggang, Zhang Hong, Liu Qiong, Wu Tingmei, Zhang Qian, Wu Huanghui, Huang Xinwei, Xiong Lize", "reference": { "type": "PubMed", "id": "37705317", "url": "https://pubmed.ncbi.nlm.nih.gov/37705317" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15050-1", "protein_name": "Ribosome biogenesis regulatory protein homolog", "gene_name": "RRS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15050", "url": "https://www.uniprot.org/uniprotkb/Q15050" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37705317", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Long noncoding RNA SNHG1 promotes breast cancer progression by regulating the miR-641/RRS1 axis.", "journal": "Scientific reports", "date": "2024-02-08", "authors": "Deng Lin, Wang Jun, Song Junying, Wu Qinglan, Gong Zunshuang, Song Jinlian, Hou Lin", "reference": { "type": "PubMed", "id": "38331968", "url": "https://pubmed.ncbi.nlm.nih.gov/38331968" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15050-1", "protein_name": "Ribosome biogenesis regulatory protein homolog", "gene_name": "RRS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15050", "url": "https://www.uniprot.org/uniprotkb/Q15050" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38331968", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of RRS1 in breast cancer cells metastasis and AEG-1/AKT/c-Myc signaling pathway.", "journal": "Neoplasma", "date": "2024-08", "authors": "He Jing, Liu Sijing, Luo Shajie, Fu Jiaojiao, Liao Zhengyue, Song Junying, Guo Jinlin, Hua Ya'nan", "reference": { "type": "PubMed", "id": "39267538", "url": "https://pubmed.ncbi.nlm.nih.gov/39267538" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15050-1", "protein_name": "Ribosome biogenesis regulatory protein homolog", "gene_name": "RRS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15050", "url": "https://www.uniprot.org/uniprotkb/Q15050" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39267538", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Extracellular signal-regulated kinase (ERK) interacts with signal transducer and activator of transcription (STAT) 5a.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1999", "authors": "Pircher TJ, Petersen H, Gustafsson JA, Haldosen LA", "reference": { "type": "PubMed", "id": "10194762", "url": "https://pubmed.ncbi.nlm.nih.gov/10194762" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42229-1", "protein_name": "Signal transducer and activator of transcription 5A", "gene_name": "STAT5A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P42229", "url": "https://www.uniprot.org/uniprotkb/P42229" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42229", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42229" }, { "database": "PubMed", "id": "10194762", "url": "https://pubmed.ncbi.nlm.nih.gov/10194762" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P42229-1" }, { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42229", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42229" }, { "database": "PubMed", "id": "10194762", "url": "https://pubmed.ncbi.nlm.nih.gov/10194762" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P42229-1" }, { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42229", "url": "https://www.uniprot.org/uniprotkb/P42229" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P42229", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42229" }, { "database": "PubMed", "id": "12091337", "url": "https://pubmed.ncbi.nlm.nih.gov/12091337" }, { "database": "PubMed", "id": "10194762", "url": "https://pubmed.ncbi.nlm.nih.gov/10194762" }, { "database": "PubMed", "id": "12529425", "url": "https://pubmed.ncbi.nlm.nih.gov/12529425" }, { "database": "PubMed", "id": "31932645", "url": "https://pubmed.ncbi.nlm.nih.gov/31932645" }, { "database": "PubMed", "id": "34188118", "url": "https://pubmed.ncbi.nlm.nih.gov/34188118" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P42229-1" } ], "record_id": "pubmed.10194762", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ErbB receptor-induced activation of stat transcription factors is mediated by Src tyrosine kinases.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Olayioye MA, Beuvink I, Horsch K, Daly JM, Hynes NE", "reference": { "type": "PubMed", "id": "10358079", "url": "https://pubmed.ncbi.nlm.nih.gov/10358079" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42229-1", "protein_name": "Signal transducer and activator of transcription 5A", "gene_name": "STAT5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15303-1", "protein_name": "Receptor tyrosine-protein kinase erbB-4", "gene_name": "ERBB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04626-1", "protein_name": "Receptor tyrosine-protein kinase erbB-2", "gene_name": "ERBB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P42229", "url": "https://www.uniprot.org/uniprotkb/P42229" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 694, "end_pos": 694, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK2", "evidence": [ { "database": "UniProtKB", "id": "P42229", "url": "https://www.uniprot.org/uniprotkb/P42229" }, { "database": "IntAct", "id": "P42229", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42229*" }, { "database": "iPTMnet", "id": "P42229", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42229" }, { "database": "PubMed", "id": "9837784", "url": "https://pubmed.ncbi.nlm.nih.gov/9837784" }, { "database": "PubMed", "id": "10358079", "url": "https://pubmed.ncbi.nlm.nih.gov/10358079" }, { "database": "PubMed", "id": "10508857", "url": "https://pubmed.ncbi.nlm.nih.gov/10508857" }, { "database": "PubMed", "id": "11046040", "url": "https://pubmed.ncbi.nlm.nih.gov/11046040" }, { "database": "PubMed", "id": "11641791", "url": "https://pubmed.ncbi.nlm.nih.gov/11641791" }, { "database": "PubMed", "id": "12089361", "url": "https://pubmed.ncbi.nlm.nih.gov/12089361" }, { "database": "PubMed", "id": "14597631", "url": "https://pubmed.ncbi.nlm.nih.gov/14597631" }, { "database": "PubMed", "id": "15534001", "url": "https://pubmed.ncbi.nlm.nih.gov/15534001" }, { "database": "PubMed", "id": "15536163", "url": "https://pubmed.ncbi.nlm.nih.gov/15536163" }, { "database": "PubMed", "id": "15863494", "url": "https://pubmed.ncbi.nlm.nih.gov/15863494" }, { "database": "PubMed", "id": "15939795", "url": "https://pubmed.ncbi.nlm.nih.gov/15939795" }, { "database": "PubMed", "id": "16139998", "url": "https://pubmed.ncbi.nlm.nih.gov/16139998" }, { "database": "PubMed", "id": "16765629", "url": "https://pubmed.ncbi.nlm.nih.gov/16765629" }, { "database": "PubMed", "id": "17190839", "url": "https://pubmed.ncbi.nlm.nih.gov/17190839" }, { "database": "PubMed", "id": "18063684", "url": "https://pubmed.ncbi.nlm.nih.gov/18063684" }, { "database": "PubMed", "id": "19949423", "url": "https://pubmed.ncbi.nlm.nih.gov/19949423" }, { "database": "PubMed", "id": "20498019", "url": "https://pubmed.ncbi.nlm.nih.gov/20498019" }, { "database": "PubMed", "id": "20667852", "url": "https://pubmed.ncbi.nlm.nih.gov/20667852" }, { "database": "PubMed", "id": "21625473", "url": "https://pubmed.ncbi.nlm.nih.gov/21625473" }, { "database": "PubMed", "id": "21716071", "url": "https://pubmed.ncbi.nlm.nih.gov/21716071" }, { "database": "PubMed", "id": "21772264", "url": "https://pubmed.ncbi.nlm.nih.gov/21772264" }, { "database": "PubMed", "id": "22271575", "url": "https://pubmed.ncbi.nlm.nih.gov/22271575" }, { "database": "PubMed", "id": "22926520", "url": "https://pubmed.ncbi.nlm.nih.gov/22926520" }, { "database": "PubMed", "id": "23332799", "url": "https://pubmed.ncbi.nlm.nih.gov/23332799" }, { "database": "PubMed", "id": "23353780", "url": "https://pubmed.ncbi.nlm.nih.gov/23353780" }, { "database": "PubMed", "id": "23383227", "url": "https://pubmed.ncbi.nlm.nih.gov/23383227" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23814025", "url": "https://pubmed.ncbi.nlm.nih.gov/23814025" }, { "database": "PubMed", "id": "24416160", "url": "https://pubmed.ncbi.nlm.nih.gov/24416160" }, { "database": "PubMed", "id": "24728078", "url": "https://pubmed.ncbi.nlm.nih.gov/24728078" }, { "database": "PubMed", "id": "24836440", "url": "https://pubmed.ncbi.nlm.nih.gov/24836440" }, { "database": "PubMed", "id": "25568664", "url": "https://pubmed.ncbi.nlm.nih.gov/25568664" }, { "database": "PubMed", "id": "25781955", "url": "https://pubmed.ncbi.nlm.nih.gov/25781955" }, { "database": "PubMed", "id": "25885255", "url": "https://pubmed.ncbi.nlm.nih.gov/25885255" }, { "database": "PubMed", "id": "26815406", "url": "https://pubmed.ncbi.nlm.nih.gov/26815406" }, { "database": "PubMed", "id": "26928938", "url": "https://pubmed.ncbi.nlm.nih.gov/26928938" }, { "database": "PubMed", "id": "27769062", "url": "https://pubmed.ncbi.nlm.nih.gov/27769062" }, { "database": "PubMed", "id": "28005077", "url": "https://pubmed.ncbi.nlm.nih.gov/28005077" }, { "database": "PubMed", "id": "28422713", "url": "https://pubmed.ncbi.nlm.nih.gov/28422713" }, { "database": "PubMed", "id": "28676702", "url": "https://pubmed.ncbi.nlm.nih.gov/28676702" }, { "database": "PubMed", "id": "28798028", "url": "https://pubmed.ncbi.nlm.nih.gov/28798028" }, { "database": "PubMed", "id": "30472492", "url": "https://pubmed.ncbi.nlm.nih.gov/30472492" }, { "database": "PubMed", "id": "31053703", "url": "https://pubmed.ncbi.nlm.nih.gov/31053703" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31371410", "url": "https://pubmed.ncbi.nlm.nih.gov/31371410" }, { "database": "PubMed", "id": "31817106", "url": "https://pubmed.ncbi.nlm.nih.gov/31817106" }, { "database": "PubMed", "id": "31932645", "url": "https://pubmed.ncbi.nlm.nih.gov/31932645" }, { "database": "PubMed", "id": "32041350", "url": "https://pubmed.ncbi.nlm.nih.gov/32041350" }, { "database": "PubMed", "id": "32633727", "url": "https://pubmed.ncbi.nlm.nih.gov/32633727" }, { "database": "PubMed", "id": "33669259", "url": "https://pubmed.ncbi.nlm.nih.gov/33669259" }, { "database": "PubMed", "id": "33763079", "url": "https://pubmed.ncbi.nlm.nih.gov/33763079" }, { "database": "PubMed", "id": "34188118", "url": "https://pubmed.ncbi.nlm.nih.gov/34188118" }, { "database": "PubMed", "id": "35751654", "url": "https://pubmed.ncbi.nlm.nih.gov/35751654" }, { "database": "PubMed", "id": "7744007", "url": "https://pubmed.ncbi.nlm.nih.gov/7744007" }, { "database": "PubMed", "id": "7925280", "url": "https://pubmed.ncbi.nlm.nih.gov/7925280" }, { "database": "PubMed", "id": "9343435", "url": "https://pubmed.ncbi.nlm.nih.gov/9343435" }, { "database": "PubMed", "id": "9813040", "url": "https://pubmed.ncbi.nlm.nih.gov/9813040" }, { "database": "PubMed", "id": "9880255", "url": "https://pubmed.ncbi.nlm.nih.gov/9880255" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "12529425", "url": "https://pubmed.ncbi.nlm.nih.gov/12529425" } ], "site_lbl": "Tyr694", "uniprot_canonical_ac": "P42229-1" } ], "record_id": "pubmed.10358079", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The multifaceted regulation of interleukin-15 expression and the role of this cytokine in NK cell differentiation and host response to intracellular pathogens.", "journal": "Annual review of immunology", "date": "1999", "authors": "Waldmann TA, Tagaya Y", "reference": { "type": "PubMed", "id": "10358752", "url": "https://pubmed.ncbi.nlm.nih.gov/10358752" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42229-1", "protein_name": "Signal transducer and activator of transcription 5A", "gene_name": "STAT5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51692-1", "protein_name": "Signal transducer and activator of transcription 5B", "gene_name": "STAT5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14784-1", "protein_name": "Interleukin-2 receptor subunit beta", "gene_name": "IL2RB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31785-1", "protein_name": "Cytokine receptor common subunit gamma", "gene_name": "IL2RG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52333-1", "protein_name": "Tyrosine-protein kinase JAK3", "gene_name": "JAK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07890-1", "protein_name": "Son of sevenless homolog 2", "gene_name": "SOS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40933-1", "protein_name": "Interleukin-15", "gene_name": "IL15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13261-1", "protein_name": "Interleukin-15 receptor subunit alpha", "gene_name": "IL15RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29353-1", "protein_name": "SHC-transforming protein 1", "gene_name": "SHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62993-1", "protein_name": "Growth factor receptor-bound protein 2", "gene_name": "GRB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC2-1", "protein_name": "GRB2-associated-binding protein 2", "gene_name": "GAB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P42229", "url": "https://www.uniprot.org/uniprotkb/P42229" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10358752", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "STAT5 as a molecular regulator of proliferation, differentiation and apoptosis in hematopoietic cells.", "journal": "The EMBO journal", "date": "1999", "authors": "Nosaka T, Kawashima T, Misawa K, Ikuta K, Mui AL, Kitamura T", "reference": { "type": "PubMed", "id": "10469654", "url": "https://pubmed.ncbi.nlm.nih.gov/10469654" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42229-1", "protein_name": "Signal transducer and activator of transcription 5A", "gene_name": "STAT5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01112-1", "protein_name": "GTPase HRas", "gene_name": "HRAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51692-1", "protein_name": "Signal transducer and activator of transcription 5B", "gene_name": "STAT5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92614-1", "protein_name": "Unconventional myosin-XVIIIa", "gene_name": "MYO18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01111-1", "protein_name": "GTPase NRas", "gene_name": "NRAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11309-1", "protein_name": "Serine/threonine-protein kinase pim-1", "gene_name": "PIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPH5-1", "protein_name": "NADPH oxidase 4", "gene_name": "NOX4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41212-1", "protein_name": "Transcription factor ETV6", "gene_name": "ETV6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBW7-1", "protein_name": "Zinc finger MYM-type protein 2", "gene_name": "ZMYM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15643-1", "protein_name": "Thyroid receptor-interacting protein 11", "gene_name": "TRIP11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC2-1", "protein_name": "GRB2-associated-binding protein 2", "gene_name": "GAB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P42229", "url": "https://www.uniprot.org/uniprotkb/P42229" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10469654", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heterodimerization of the alpha and beta chains of the interleukin-3 (IL-3) receptor is necessary and sufficient for IL-3-induced mitogenesis.", "journal": "Blood", "date": "1999", "authors": "Orban PC, Levings MK, Schrader JW", "reference": { "type": "PubMed", "id": "10477686", "url": "https://pubmed.ncbi.nlm.nih.gov/10477686" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42229-1", "protein_name": "Signal transducer and activator of transcription 5A", "gene_name": "STAT5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51692-1", "protein_name": "Signal transducer and activator of transcription 5B", "gene_name": "STAT5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01344-1", "protein_name": "Interleukin-5 receptor subunit alpha", "gene_name": "IL5RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08700-1", "protein_name": "Interleukin-3", "gene_name": "IL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26951-1", "protein_name": "Interleukin-3 receptor subunit alpha", "gene_name": "IL3RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05113-1", "protein_name": "Interleukin-5", "gene_name": "IL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26955-1", "protein_name": "Cytokine receptor common subunit beta", "gene_name": "Csf2rb", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04141-1", "protein_name": "Granulocyte-macrophage colony-stimulating factor", "gene_name": "CSF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32927-1", "protein_name": "Cytokine receptor common subunit beta", "gene_name": "CSF2RB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17612-1", "protein_name": "cAMP-dependent protein kinase catalytic subunit alpha", "gene_name": "PRKACA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26952-1", "protein_name": "Interleukin-3 receptor subunit alpha", "gene_name": "Il3ra", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P15509-1", "protein_name": "Granulocyte-macrophage colony-stimulating factor receptor subunit alpha", "gene_name": "CSF2RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42680-1", "protein_name": "Tyrosine-protein kinase Tec", "gene_name": "TEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29353-1", "protein_name": "SHC-transforming protein 1", "gene_name": "SHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63104-1", "protein_name": "14-3-3 protein zeta/delta", "gene_name": "YWHAZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P42229", "url": "https://www.uniprot.org/uniprotkb/P42229" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10477686", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]