[ { "title": "A FRET-based study reveals site-specific regulation of spindle position checkpoint proteins at yeast centrosomes.", "journal": "eLife", "date": "2016-05-09", "authors": "Gryaznova Yuliya, Koca Caydasi Ayse, Malengo Gabriele, Sourjik Victor, Pereira Gislene", "reference": { "type": "PubMed", "id": "27159239", "url": "https://pubmed.ncbi.nlm.nih.gov/27159239" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47113-1", "protein_name": "Mitotic check point protein BFA1", "gene_name": "BFA1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47113", "url": "https://www.uniprot.org/uniprotkb/P47113" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 180, "end_pos": 180, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47113", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47113" }, { "database": "PubMed", "id": "17967947", "url": "https://pubmed.ncbi.nlm.nih.gov/17967947" }, { "database": "PubMed", "id": "24850890", "url": "https://pubmed.ncbi.nlm.nih.gov/24850890" }, { "database": "PubMed", "id": "27159239", "url": "https://pubmed.ncbi.nlm.nih.gov/27159239" }, { "database": "SGD", "id": "S000003814", "url": "https://www.yeastgenome.org/locus/S000003814" }, { "database": "PubMed", "id": "22031224", "url": "https://pubmed.ncbi.nlm.nih.gov/22031224" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser180", "uniprot_canonical_ac": "P47113-1" } ], "record_id": "pubmed.27159239", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence for conformational changes in the yeast deoxyhypusine hydroxylase Lia1 upon iron displacement from its active site.", "journal": "Amino acids", "date": "2010-02", "authors": "Cano Veridiana S P, Medrano Francisco Javier, Park Myung Hee, Valentini Sandro R", "reference": { "type": "PubMed", "id": "19956996", "url": "https://pubmed.ncbi.nlm.nih.gov/19956996" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47120-1", "protein_name": "Deoxyhypusine hydroxylase", "gene_name": "LIA1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47120", "url": "https://www.uniprot.org/uniprotkb/P47120" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 112, "end_pos": 112, "sequence_org": "H", "sequence_mut": "A", "comment": "Abolishes both iron-binding and enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P47120", "url": "https://www.uniprot.org/uniprotkb/P47120" }, { "database": "PubMed", "id": "19956996", "url": "https://pubmed.ncbi.nlm.nih.gov/19956996" } ], "uniprot_canonical_ac": "P47120-1" }, { "start_pos": 113, "end_pos": 113, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes iron-binding, substrate-binding, and enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P47120", "url": "https://www.uniprot.org/uniprotkb/P47120" }, { "database": "PubMed", "id": "19956996", "url": "https://pubmed.ncbi.nlm.nih.gov/19956996" } ], "uniprot_canonical_ac": "P47120-1" }, { "start_pos": 116, "end_pos": 116, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes substrate-binding and enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P47120", "url": "https://www.uniprot.org/uniprotkb/P47120" }, { "database": "PubMed", "id": "19956996", "url": "https://pubmed.ncbi.nlm.nih.gov/19956996" } ], "uniprot_canonical_ac": "P47120-1" }, { "start_pos": 116, "end_pos": 116, "sequence_org": "E", "sequence_mut": "D", "comment": "Reduces enzyme activity by 97%.", "evidence": [ { "database": "UniProtKB", "id": "P47120", "url": "https://www.uniprot.org/uniprotkb/P47120" }, { "database": "PubMed", "id": "19956996", "url": "https://pubmed.ncbi.nlm.nih.gov/19956996" } ], "uniprot_canonical_ac": "P47120-1" }, { "start_pos": 237, "end_pos": 237, "sequence_org": "H", "sequence_mut": "A", "comment": "Abolishes both iron-binding and enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P47120", "url": "https://www.uniprot.org/uniprotkb/P47120" }, { "database": "PubMed", "id": "19956996", "url": "https://pubmed.ncbi.nlm.nih.gov/19956996" } ], "uniprot_canonical_ac": "P47120-1" }, { "start_pos": 238, "end_pos": 238, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes substrate-binding, enzyme activity, and impairs iron-binding.", "evidence": [ { "database": "UniProtKB", "id": "P47120", "url": "https://www.uniprot.org/uniprotkb/P47120" }, { "database": "PubMed", "id": "19956996", "url": "https://pubmed.ncbi.nlm.nih.gov/19956996" } ], "uniprot_canonical_ac": "P47120-1" }, { "start_pos": 270, "end_pos": 270, "sequence_org": "H", "sequence_mut": "A", "comment": "Abolishes iron-binding, substrate-binding, and enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P47120", "url": "https://www.uniprot.org/uniprotkb/P47120" }, { "database": "PubMed", "id": "19956996", "url": "https://pubmed.ncbi.nlm.nih.gov/19956996" } ], "uniprot_canonical_ac": "P47120-1" }, { "start_pos": 271, "end_pos": 271, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes iron-binding, substrate-binding, and enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P47120", "url": "https://www.uniprot.org/uniprotkb/P47120" }, { "database": "PubMed", "id": "19956996", "url": "https://pubmed.ncbi.nlm.nih.gov/19956996" } ], "uniprot_canonical_ac": "P47120-1" }, { "start_pos": 274, "end_pos": 274, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes substrate-binding.", "evidence": [ { "database": "UniProtKB", "id": "P47120", "url": "https://www.uniprot.org/uniprotkb/P47120" }, { "database": "PubMed", "id": "19956996", "url": "https://pubmed.ncbi.nlm.nih.gov/19956996" } ], "uniprot_canonical_ac": "P47120-1" }, { "start_pos": 79, "end_pos": 79, "sequence_org": "H", "sequence_mut": "A", "comment": "Abolishes both iron-binding and enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P47120", "url": "https://www.uniprot.org/uniprotkb/P47120" }, { "database": "PubMed", "id": "19956996", "url": "https://pubmed.ncbi.nlm.nih.gov/19956996" } ], "uniprot_canonical_ac": "P47120-1" }, { "start_pos": 80, "end_pos": 80, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes enzyme activity and impairs iron-binding.", "evidence": [ { "database": "UniProtKB", "id": "P47120", "url": "https://www.uniprot.org/uniprotkb/P47120" }, { "database": "PubMed", "id": "19956996", "url": "https://pubmed.ncbi.nlm.nih.gov/19956996" } ], "uniprot_canonical_ac": "P47120-1" } ], "record_id": "pubmed.19956996", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interplay between septin organization, cell cycle and cell shape in yeast.", "journal": "Journal of cell science", "date": "2005-04-15", "authors": "Gladfelter Amy S, Kozubowski Lukasz, Zyla Trevin R, Lew Daniel J", "reference": { "type": "PubMed", "id": "15784684", "url": "https://pubmed.ncbi.nlm.nih.gov/15784684" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47136-1", "protein_name": "Bud site selection protein 4", "gene_name": "BUD4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47136", "url": "https://www.uniprot.org/uniprotkb/P47136" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15784684", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The BUD4 protein of yeast, required for axial budding, is localized to the mother/BUD neck in a cell cycle-dependent manner.", "journal": "The Journal of cell biology", "date": "1996-07", "authors": "Sanders S L, Herskowitz I", "reference": { "type": "PubMed", "id": "8707826", "url": "https://pubmed.ncbi.nlm.nih.gov/8707826" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47136-1", "protein_name": "Bud site selection protein 4", "gene_name": "BUD4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47136", "url": "https://www.uniprot.org/uniprotkb/P47136" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8707826", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autophagosome requires specific early Sec proteins for its formation and NSF/SNARE for vacuolar fusion.", "journal": "Molecular biology of the cell", "date": "2001-11", "authors": "Ishihara N, Hamasaki M, Yokota S, Suzuki K, Kamada Y, Kihara A, Yoshimori T, Noda T, Ohsumi Y", "reference": { "type": "PubMed", "id": "11694599", "url": "https://pubmed.ncbi.nlm.nih.gov/11694599" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48415-1", "protein_name": "COPII coat assembly protein SEC16", "gene_name": "SEC16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P11655-1", "protein_name": "Guanine nucleotide-exchange factor SEC12", "gene_name": "SEC12", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48415", "url": "https://www.uniprot.org/uniprotkb/P48415" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11694599", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast SEC16 gene encodes a multidomain vesicle coat protein that interacts with Sec23p.", "journal": "The Journal of cell biology", "date": "1995-10", "authors": "Espenshade P, Gimeno R E, Holzmacher E, Teung P, Kaiser C A", "reference": { "type": "PubMed", "id": "7593161", "url": "https://pubmed.ncbi.nlm.nih.gov/7593161" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48415-1", "protein_name": "COPII coat assembly protein SEC16", "gene_name": "SEC16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P15303-1", "protein_name": "Protein transport protein SEC23", "gene_name": "SEC23", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48415", "url": "https://www.uniprot.org/uniprotkb/P48415" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 1059, "end_pos": 1059, "sequence_org": "L", "sequence_mut": "S", "comment": "In SEC16-4; ts accumulation of ER membranes.", "evidence": [ { "database": "UniProtKB", "id": "P48415", "url": "https://www.uniprot.org/uniprotkb/P48415" }, { "database": "PubMed", "id": "7593161", "url": "https://pubmed.ncbi.nlm.nih.gov/7593161" } ], "uniprot_canonical_ac": "P48415-1" }, { "start_pos": 1084, "end_pos": 1084, "sequence_org": "L", "sequence_mut": "P", "comment": "In SEC16-3; ts accumulation of ER membranes.", "evidence": [ { "database": "UniProtKB", "id": "P48415", "url": "https://www.uniprot.org/uniprotkb/P48415" }, { "database": "PubMed", "id": "7593161", "url": "https://pubmed.ncbi.nlm.nih.gov/7593161" } ], "uniprot_canonical_ac": "P48415-1" }, { "start_pos": 1089, "end_pos": 1089, "sequence_org": "L", "sequence_mut": "P", "comment": "In SEC16-2; ts accumulation of ER membranes.", "evidence": [ { "database": "UniProtKB", "id": "P48415", "url": "https://www.uniprot.org/uniprotkb/P48415" }, { "database": "PubMed", "id": "7593161", "url": "https://pubmed.ncbi.nlm.nih.gov/7593161" } ], "uniprot_canonical_ac": "P48415-1" }, { "start_pos": 1231, "end_pos": 1231, "sequence_org": "W", "sequence_mut": "R", "comment": "In SEC16-1; ts accumulation of ER membranes.", "evidence": [ { "database": "UniProtKB", "id": "P48415", "url": "https://www.uniprot.org/uniprotkb/P48415" }, { "database": "PubMed", "id": "7593161", "url": "https://pubmed.ncbi.nlm.nih.gov/7593161" } ], "uniprot_canonical_ac": "P48415-1" } ], "record_id": "pubmed.7593161", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SED4 encodes a yeast endoplasmic reticulum protein that binds Sec16p and participates in vesicle formation.", "journal": "The Journal of cell biology", "date": "1995-10", "authors": "Gimeno R E, Espenshade P, Kaiser C A", "reference": { "type": "PubMed", "id": "7593162", "url": "https://pubmed.ncbi.nlm.nih.gov/7593162" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48415-1", "protein_name": "COPII coat assembly protein SEC16", "gene_name": "SEC16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25365-1", "protein_name": "Putative guanine nucleotide-exchange factor SED4", "gene_name": "SED4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48415", "url": "https://www.uniprot.org/uniprotkb/P48415" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7593162", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of SEC12, SED4, truncated SEC16, and EKS1/HRD3 as multicopy suppressors of ts mutants of Sar1 GTPase.", "journal": "Journal of biochemistry", "date": "1999-01", "authors": "Saito Y, Yamanushi T, Oka T, Nakano A", "reference": { "type": "PubMed", "id": "9880808", "url": "https://pubmed.ncbi.nlm.nih.gov/9880808" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48415-1", "protein_name": "COPII coat assembly protein SEC16", "gene_name": "SEC16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25365-1", "protein_name": "Putative guanine nucleotide-exchange factor SED4", "gene_name": "SED4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48415", "url": "https://www.uniprot.org/uniprotkb/P48415" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9880808", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bul1, a new protein that binds to the Rsp5 ubiquitin ligase in Saccharomyces cerevisiae.", "journal": "Molecular and cellular biology", "date": "1996-07", "authors": "Yashiroda H, Oguchi T, Yasuda Y, Toh-E A, Kikuchi Y", "reference": { "type": "PubMed", "id": "8668140", "url": "https://pubmed.ncbi.nlm.nih.gov/8668140" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48524-1", "protein_name": "Ubiquitin ligase-binding protein BUL1", "gene_name": "BUL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39940-1", "protein_name": "E3 ubiquitin-protein ligase RSP5", "gene_name": "RSP5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48524", "url": "https://www.uniprot.org/uniprotkb/P48524" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8668140", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GNP1, the high-affinity glutamine permease of S. cerevisiae.", "journal": "Current genetics", "date": "1996-07-31", "authors": "Zhu X, Garrett J, Schreve J, Michaeli T", "reference": { "type": "PubMed", "id": "8660458", "url": "https://pubmed.ncbi.nlm.nih.gov/8660458" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48813-1", "protein_name": "High-affinity glutamine permease", "gene_name": "GNP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48813", "url": "https://www.uniprot.org/uniprotkb/P48813" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8660458", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Saccharomyces cerevisiae VMA10 is an intron-containing gene encoding a novel 13-kDa subunit of vacuolar H(+)-ATPase.", "journal": "The Journal of biological chemistry", "date": "1995-06-09", "authors": "Supekov\u00e1 L, Supek F, Nelson N", "reference": { "type": "PubMed", "id": "7775427", "url": "https://pubmed.ncbi.nlm.nih.gov/7775427" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48836-1", "protein_name": "V-type proton ATPase subunit G", "gene_name": "VMA10", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48836", "url": "https://www.uniprot.org/uniprotkb/P48836" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7775427", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel fluorescence-based genetic strategy identifies mutants of Saccharomyces cerevisiae defective for nuclear pore complex assembly.", "journal": "Molecular biology of the cell", "date": "1998-09", "authors": "Bucci M, Wente S R", "reference": { "type": "PubMed", "id": "9725905", "url": "https://pubmed.ncbi.nlm.nih.gov/9725905" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48837-1", "protein_name": "Nucleoporin NUP57", "gene_name": "NUP57", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48837", "url": "https://www.uniprot.org/uniprotkb/P48837" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9725905", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identifying Pex21p as a protein that specifically interacts with yeast seryl-tRNA synthetase.", "journal": "FEMS microbiology letters", "date": "2002-08-27", "authors": "Rocak Sanda, Landeka Irena, Weygand-Durasevic Ivana", "reference": { "type": "PubMed", "id": "12204379", "url": "https://pubmed.ncbi.nlm.nih.gov/12204379" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50091-1", "protein_name": "Peroxisomal protein PEX21", "gene_name": "PEX21", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P50091", "url": "https://www.uniprot.org/uniprotkb/P50091" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12204379", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peroxin Pex21p interacts with the C-terminal noncatalytic domain of yeast seryl-tRNA synthetase and forms a specific ternary complex with tRNA(Ser).", "journal": "The FEBS journal", "date": "2007-06", "authors": "Godinic Vlatka, Mocibob Marko, Rocak Sanda, Ibba Michael, Weygand-Durasevic Ivana", "reference": { "type": "PubMed", "id": "17451428", "url": "https://pubmed.ncbi.nlm.nih.gov/17451428" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50091-1", "protein_name": "Peroxisomal protein PEX21", "gene_name": "PEX21", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P50091", "url": "https://www.uniprot.org/uniprotkb/P50091" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17451428", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An essential role of Sam50 in the protein sorting and assembly machinery of the mitochondrial outer membrane.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Kozjak Vera, Wiedemann Nils, Milenkovic Dusanka, Lohaus Christiane, Meyer Helmut E, Guiard Bernard, Meisinger Chris, Pfanner Nikolaus", "reference": { "type": "PubMed", "id": "14570913", "url": "https://pubmed.ncbi.nlm.nih.gov/14570913" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50110-1", "protein_name": "Sorting assembly machinery 37 kDa subunit", "gene_name": "SAM37", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53969-1", "protein_name": "Sorting assembly machinery 50 kDa subunit", "gene_name": "SAM50", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P50110", "url": "https://www.uniprot.org/uniprotkb/P50110" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14570913", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Assembly of the TOB complex of mitochondria.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Habib Shukry J, Waizenegger Thomas, Lech Maciej, Neupert Walter, Rapaport Doron", "reference": { "type": "PubMed", "id": "15590639", "url": "https://pubmed.ncbi.nlm.nih.gov/15590639" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50110-1", "protein_name": "Sorting assembly machinery 37 kDa subunit", "gene_name": "SAM37", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53969-1", "protein_name": "Sorting assembly machinery 50 kDa subunit", "gene_name": "SAM50", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P50110", "url": "https://www.uniprot.org/uniprotkb/P50110" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15590639", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mas37p, a novel receptor subunit for protein import into mitochondria.", "journal": "J. Cell Biol.", "date": "1995", "authors": "Gratzer S, Lithgow T, Bauer R E, Lamping E, Paltauf F, Kohlwein S D, Haucke V, Junne T, Schatz G, Horst M", "reference": { "type": "PubMed", "id": "7698990", "url": "https://pubmed.ncbi.nlm.nih.gov/7698990" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50110-1", "protein_name": "Sorting assembly machinery 37 kDa subunit", "gene_name": "SAM37", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P50110", "url": "https://www.uniprot.org/uniprotkb/P50110" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7698990", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleocytoplasmic distribution of budding yeast protein kinase A regulatory subunit Bcy1 requires Zds1 and is regulated by Yak1-dependent phosphorylation of its targeting domain.", "journal": "Mol. Cell. Biol.", "date": "2001", "authors": "Griffioen G, Branduardi P, Ballarini A, Anghileri P, Norbeck J, Baroni M D, Ruis H", "reference": { "type": "PubMed", "id": "11134339", "url": "https://pubmed.ncbi.nlm.nih.gov/11134339" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50111-1", "protein_name": "Protein ZDS1", "gene_name": "ZDS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07278-1", "protein_name": "cAMP-dependent protein kinase regulatory subunit", "gene_name": "BCY1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P50111", "url": "https://www.uniprot.org/uniprotkb/P50111" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 68, "end_pos": 68, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P07278", "url": "https://www.uniprot.org/uniprotkb/P07278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "iPTMnet", "id": "P07278", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07278" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000001295", "url": "https://www.yeastgenome.org/locus/S000001295" }, { "database": "PubMed", "id": "11134339", "url": "https://pubmed.ncbi.nlm.nih.gov/11134339" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser68", "uniprot_canonical_ac": "P07278-1" }, { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P07278", "url": "https://www.uniprot.org/uniprotkb/P07278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "iPTMnet", "id": "P07278", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07278" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000001295", "url": "https://www.yeastgenome.org/locus/S000001295" }, { "database": "PubMed", "id": "11134339", "url": "https://pubmed.ncbi.nlm.nih.gov/11134339" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser70", "uniprot_canonical_ac": "P07278-1" } ], "record_id": "pubmed.11134339", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZDS1 and ZDS2, genes whose products may regulate Cdc42p in Saccharomyces cerevisiae.", "journal": "Mol. Cell. Biol.", "date": "1996", "authors": "Bi E, Pringle J R", "reference": { "type": "PubMed", "id": "8816439", "url": "https://pubmed.ncbi.nlm.nih.gov/8816439" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50111-1", "protein_name": "Protein ZDS1", "gene_name": "ZDS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P50111", "url": "https://www.uniprot.org/uniprotkb/P50111" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8816439", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multicopy suppressors of temperature-sensitive mutations of yeast mRNA capping enzyme.", "journal": "Gene Expr.", "date": "1996", "authors": "Schwer B, Shuman S", "reference": { "type": "PubMed", "id": "8836740", "url": "https://pubmed.ncbi.nlm.nih.gov/8836740" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50111-1", "protein_name": "Protein ZDS1", "gene_name": "ZDS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P50111", "url": "https://www.uniprot.org/uniprotkb/P50111" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8836740", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Saccharomyces cerevisiae SSD1 gene is involved in the tolerance to high concentration of Ca2+ with the participation of HST1/NRC1/BFR1.", "journal": "Gene", "date": "1996", "authors": "Tsuchiya E, Matsuzaki G, Kurano K, Fukuchi T, Tsukao A, Miyakawa T", "reference": { "type": "PubMed", "id": "8918228", "url": "https://pubmed.ncbi.nlm.nih.gov/8918228" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50111-1", "protein_name": "Protein ZDS1", "gene_name": "ZDS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P50111", "url": "https://www.uniprot.org/uniprotkb/P50111" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8918228", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The inositol polyphosphate 5-phosphatases and the apurinic/apyrimidinic base excision repair endonucleases share a common mechanism for catalysis.", "journal": "The Journal of biological chemistry", "date": "2000-11-24", "authors": "Whisstock J C, Romero S, Gurung R, Nandurkar H, Ooms L M, Bottomley S P, Mitchell C A", "reference": { "type": "PubMed", "id": "10962003", "url": "https://pubmed.ncbi.nlm.nih.gov/10962003" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50942-1", "protein_name": "Polyphosphatidylinositol phosphatase INP52", "gene_name": "INP52", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P50942", "url": "https://www.uniprot.org/uniprotkb/P50942" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 631, "end_pos": 631, "sequence_org": "E", "sequence_mut": "A", "comment": "Impairs completely enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P50942", "url": "https://www.uniprot.org/uniprotkb/P50942" }, { "database": "PubMed", "id": "10962003", "url": "https://pubmed.ncbi.nlm.nih.gov/10962003" } ], "uniprot_canonical_ac": "P50942-1" }, { "start_pos": 730, "end_pos": 730, "sequence_org": "H", "sequence_mut": "A", "comment": "Impairs completely enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P50942", "url": "https://www.uniprot.org/uniprotkb/P50942" }, { "database": "PubMed", "id": "10962003", "url": "https://pubmed.ncbi.nlm.nih.gov/10962003" } ], "uniprot_canonical_ac": "P50942-1" }, { "start_pos": 771, "end_pos": 771, "sequence_org": "D", "sequence_mut": "A", "comment": "Impairs completely enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P50942", "url": "https://www.uniprot.org/uniprotkb/P50942" }, { "database": "PubMed", "id": "10962003", "url": "https://pubmed.ncbi.nlm.nih.gov/10962003" } ], "uniprot_canonical_ac": "P50942-1" } ], "record_id": "pubmed.10962003", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The phosphoinositide phosphatase Sjl2 is recruited to cortical actin patches in the control of vesicle formation and fission during endocytosis.", "journal": "Molecular and cellular biology", "date": "2005-04", "authors": "Stefan Christopher J, Padilla Steven M, Audhya Anjon, Emr Scott D", "reference": { "type": "PubMed", "id": "15798181", "url": "https://pubmed.ncbi.nlm.nih.gov/15798181" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50942-1", "protein_name": "Polyphosphatidylinositol phosphatase INP52", "gene_name": "INP52", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P50942", "url": "https://www.uniprot.org/uniprotkb/P50942" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15798181", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sjl2p is specifically involved in early steps of endocytosis intimately linked to actin dynamics via the Ark1p/Prk1p kinases.", "journal": "FEBS letters", "date": "2006-01-23", "authors": "B\u00f6ttcher Claudia, Wicky Sidonie, Schwarz Heinz, Singer-Kr\u00fcger Birgit", "reference": { "type": "PubMed", "id": "16406366", "url": "https://pubmed.ncbi.nlm.nih.gov/16406366" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50942-1", "protein_name": "Polyphosphatidylinositol phosphatase INP52", "gene_name": "INP52", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P50942", "url": "https://www.uniprot.org/uniprotkb/P50942" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16406366", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutation of the Ser18 phosphorylation site on the sole Saccharomyces cerevisiae UCS protein, She4, can compromise high-temperature survival.", "journal": "Cell stress & chaperones", "date": "2017-01", "authors": "Gomez-Escalante Susana, Piper Peter W, Millson Stefan H", "reference": { "type": "PubMed", "id": "27888470", "url": "https://pubmed.ncbi.nlm.nih.gov/27888470" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51534-1", "protein_name": "SWI5-dependent HO expression protein 4", "gene_name": "SHE4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P51534", "url": "https://www.uniprot.org/uniprotkb/P51534" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 18, "end_pos": 18, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P51534", "url": "https://www.uniprot.org/uniprotkb/P51534" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P51534", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51534" }, { "database": "PubMed", "id": "27888470", "url": "https://pubmed.ncbi.nlm.nih.gov/27888470" }, { "database": "SGD", "id": "S000005561", "url": "https://www.yeastgenome.org/locus/S000005561" } ], "site_lbl": "Ser18", "uniprot_canonical_ac": "P51534-1" } ], "record_id": "pubmed.27888470", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mother cell-specific HO expression in budding yeast depends on the unconventional myosin myo4p and other cytoplasmic proteins.", "journal": "Cell", "date": "1996", "authors": "Jansen R P, Dowzer C, Michaelis C, Galova M, Nasmyth K", "reference": { "type": "PubMed", "id": "8625407", "url": "https://pubmed.ncbi.nlm.nih.gov/8625407" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51534-1", "protein_name": "SWI5-dependent HO expression protein 4", "gene_name": "SHE4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P51534", "url": "https://www.uniprot.org/uniprotkb/P51534" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8625407", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Requirement of Hos2 histone deacetylase for gene activity in yeast.", "journal": "Science (New York, N.Y.)", "date": "2002-11-15", "authors": "Wang Amy, Kurdistani Siavash K, Grunstein Michael", "reference": { "type": "PubMed", "id": "12434058", "url": "https://pubmed.ncbi.nlm.nih.gov/12434058" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53096-1", "protein_name": "Probable histone deacetylase HOS2", "gene_name": "HOS2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36124-1", "protein_name": "Histone reader SET3", "gene_name": "SET3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53096", "url": "https://www.uniprot.org/uniprotkb/P53096" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12434058", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sld3, which interacts with Cdc45 (Sld4), functions for chromosomal DNA replication in Saccharomyces cerevisiae.", "journal": "The EMBO journal", "date": "2001-04-17", "authors": "Kamimura Y, Tak Y S, Sugino A, Araki H", "reference": { "type": "PubMed", "id": "11296242", "url": "https://pubmed.ncbi.nlm.nih.gov/11296242" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53135-1", "protein_name": "DNA replication regulator SLD3", "gene_name": "SLD3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53135", "url": "https://www.uniprot.org/uniprotkb/P53135" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11296242", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CDK-dependent phosphorylation of Sld2 and Sld3 initiates DNA replication in budding yeast.", "journal": "Nature", "date": "2007-01-18", "authors": "Tanaka Seiji, Umemori Toshiko, Hirai Kazuyuki, Muramatsu Sachiko, Kamimura Yoichiro, Araki Hiroyuki", "reference": { "type": "PubMed", "id": "17167415", "url": "https://pubmed.ncbi.nlm.nih.gov/17167415" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53135-1", "protein_name": "DNA replication regulator SLD3", "gene_name": "SLD3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53135", "url": "https://www.uniprot.org/uniprotkb/P53135" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 600, "end_pos": 600, "kinase_uniprot_canonical_ac": "P00546-1", "kinase_gene_name": "CDC28", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "17167415", "url": "https://pubmed.ncbi.nlm.nih.gov/17167415" }, { "database": "PubMed", "id": "17167417", "url": "https://pubmed.ncbi.nlm.nih.gov/17167417" } ], "site_lbl": "Thr600", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 600, "end_pos": 600, "kinase_uniprot_canonical_ac": "P30283-1", "kinase_gene_name": "CLB5", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "17167415", "url": "https://pubmed.ncbi.nlm.nih.gov/17167415" }, { "database": "PubMed", "id": "17167417", "url": "https://pubmed.ncbi.nlm.nih.gov/17167417" } ], "site_lbl": "Thr600", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 622, "end_pos": 622, "kinase_uniprot_canonical_ac": "P00546-1", "kinase_gene_name": "CDC28", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "17167415", "url": "https://pubmed.ncbi.nlm.nih.gov/17167415" }, { "database": "PubMed", "id": "17167417", "url": "https://pubmed.ncbi.nlm.nih.gov/17167417" } ], "site_lbl": "Ser622", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 622, "end_pos": 622, "kinase_uniprot_canonical_ac": "P30283-1", "kinase_gene_name": "CLB5", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "17167415", "url": "https://pubmed.ncbi.nlm.nih.gov/17167415" }, { "database": "PubMed", "id": "17167417", "url": "https://pubmed.ncbi.nlm.nih.gov/17167417" } ], "site_lbl": "Ser622", "uniprot_canonical_ac": "P53135-1" } ], "record_id": "pubmed.17167415", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Checkpoint-dependent inhibition of DNA replication initiation by Sld3 and Dbf4 phosphorylation.", "journal": "Nature", "date": "2010-09-23", "authors": "Zegerman Philip, Diffley John F X", "reference": { "type": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53135-1", "protein_name": "DNA replication regulator SLD3", "gene_name": "SLD3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32325-1", "protein_name": "DDK kinase regulatory subunit DBF4", "gene_name": "DBF4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53135", "url": "https://www.uniprot.org/uniprotkb/P53135" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 306, "end_pos": 306, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "SGD", "id": "S000003081", "url": "https://www.yeastgenome.org/locus/S000003081" }, { "database": "PubMed", "id": "30595439", "url": "https://pubmed.ncbi.nlm.nih.gov/30595439" } ], "site_lbl": "Ser306", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 310, "end_pos": 310, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "SGD", "id": "S000003081", "url": "https://www.yeastgenome.org/locus/S000003081" }, { "database": "PubMed", "id": "30595439", "url": "https://pubmed.ncbi.nlm.nih.gov/30595439" } ], "site_lbl": "Thr310", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 421, "end_pos": 421, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser421", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 434, "end_pos": 434, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser434", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 435, "end_pos": 435, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "SGD", "id": "S000003081", "url": "https://www.yeastgenome.org/locus/S000003081" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Thr435", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 438, "end_pos": 438, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser438", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 442, "end_pos": 442, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "SGD", "id": "S000003081", "url": "https://www.yeastgenome.org/locus/S000003081" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Thr442", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 445, "end_pos": 445, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Thr445", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 450, "end_pos": 450, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser450", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 451, "end_pos": 451, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr451", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 452, "end_pos": 452, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser452", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 456, "end_pos": 456, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser456", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 458, "end_pos": 458, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser458", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 459, "end_pos": 459, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser459", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 479, "end_pos": 479, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser479", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 482, "end_pos": 482, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "SGD", "id": "S000003081", "url": "https://www.yeastgenome.org/locus/S000003081" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser482", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 507, "end_pos": 507, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr507", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 509, "end_pos": 509, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser509", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 514, "end_pos": 514, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser514", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 519, "end_pos": 519, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Thr519", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 521, "end_pos": 521, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser521", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 524, "end_pos": 524, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Thr524", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 539, "end_pos": 539, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser539", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 540, "end_pos": 540, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Thr540", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 541, "end_pos": 541, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Thr541", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 546, "end_pos": 546, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser546", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 547, "end_pos": 547, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser547", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 548, "end_pos": 548, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Thr548", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 550, "end_pos": 550, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Thr550", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 556, "end_pos": 556, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser556", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 558, "end_pos": 558, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser558", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 559, "end_pos": 559, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Thr559", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 565, "end_pos": 565, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Thr565", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 569, "end_pos": 569, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser569", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 582, "end_pos": 582, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr582", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 607, "end_pos": 607, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr607", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 653, "end_pos": 653, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser653", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 654, "end_pos": 654, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser654", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 188, "end_pos": 188, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Thr188", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 192, "end_pos": 192, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser192", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 222, "end_pos": 222, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser222", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 224, "end_pos": 224, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Thr224", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "SGD", "id": "S000002459", "url": "https://www.yeastgenome.org/locus/S000002459" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser226", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 228, "end_pos": 228, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "SGD", "id": "S000002459", "url": "https://www.yeastgenome.org/locus/S000002459" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser228", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 318, "end_pos": 318, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser318", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 319, "end_pos": 319, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser319", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 328, "end_pos": 328, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser328", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 374, "end_pos": 374, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser374", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 375, "end_pos": 375, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Thr375", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 377, "end_pos": 377, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "SGD", "id": "S000002459", "url": "https://www.yeastgenome.org/locus/S000002459" }, { "database": "PubMed", "id": "21098477", "url": "https://pubmed.ncbi.nlm.nih.gov/21098477" } ], "site_lbl": "Ser377", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 521, "end_pos": 521, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser521", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 526, "end_pos": 526, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser526", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 528, "end_pos": 528, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" } ], "site_lbl": "Ser528", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 53, "end_pos": 53, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser53", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32325", "url": "https://www.uniprot.org/uniprotkb/P32325" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser59", "uniprot_canonical_ac": "P32325-1" } ], "record_id": "pubmed.20835227", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 57 }, { "field": "total_sites", "count": 56 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Damage-induced phosphorylation of Sld3 is important to block late origin firing.", "journal": "Nature", "date": "2010-09-23", "authors": "Lopez-Mosqueda Jaime, Maas Nancy L, Jonsson Zophonias O, Defazio-Eli Lisa G, Wohlschlegel James, Toczyski David P", "reference": { "type": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53135-1", "protein_name": "DNA replication regulator SLD3", "gene_name": "SLD3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32325-1", "protein_name": "DDK kinase regulatory subunit DBF4", "gene_name": "DBF4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53135", "url": "https://www.uniprot.org/uniprotkb/P53135" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 153, "end_pos": 153, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Tyr153", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 154, "end_pos": 154, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Tyr154", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 370, "end_pos": 370, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser370", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 373, "end_pos": 373, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr373", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 451, "end_pos": 451, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr451", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 456, "end_pos": 456, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser456", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 463, "end_pos": 463, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" }, { "database": "SGD", "id": "S000003081", "url": "https://www.yeastgenome.org/locus/S000003081" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser463", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" }, { "database": "SGD", "id": "S000003081", "url": "https://www.yeastgenome.org/locus/S000003081" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser466", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 493, "end_pos": 493, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" }, { "database": "SGD", "id": "S000003081", "url": "https://www.yeastgenome.org/locus/S000003081" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser493", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 495, "end_pos": 495, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr495", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 497, "end_pos": 497, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser497", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 505, "end_pos": 505, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser505", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 507, "end_pos": 507, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr507", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 521, "end_pos": 521, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser521", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 534, "end_pos": 534, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser534", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 582, "end_pos": 582, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr582", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 591, "end_pos": 591, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser591", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 607, "end_pos": 607, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr607", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 609, "end_pos": 609, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr609", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 618, "end_pos": 618, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" }, { "database": "SGD", "id": "S000003081", "url": "https://www.yeastgenome.org/locus/S000003081" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser618", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 631, "end_pos": 631, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr631", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 638, "end_pos": 638, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr638", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 639, "end_pos": 639, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser639", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 642, "end_pos": 642, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr642", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 646, "end_pos": 646, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr646", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 105, "end_pos": 105, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr105", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 114, "end_pos": 114, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr114", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 124, "end_pos": 124, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser124", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 131, "end_pos": 131, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr131", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Tyr139", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 16, "end_pos": 16, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr16", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr171", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 175, "end_pos": 175, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr175", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 18, "end_pos": 18, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr18", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 235, "end_pos": 235, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32325", "url": "https://www.uniprot.org/uniprotkb/P32325" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" }, { "database": "SGD", "id": "S000002459", "url": "https://www.yeastgenome.org/locus/S000002459" }, { "database": "PubMed", "id": "21098477", "url": "https://pubmed.ncbi.nlm.nih.gov/21098477" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser235", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser29", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr30", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 31, "end_pos": 31, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr31", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser356", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 40, "end_pos": 40, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser40", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" }, { "database": "SGD", "id": "S000002459", "url": "https://www.yeastgenome.org/locus/S000002459" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr473", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 50, "end_pos": 50, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr50", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 51, "end_pos": 51, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr51", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 53, "end_pos": 53, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser53", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32325", "url": "https://www.uniprot.org/uniprotkb/P32325" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser59", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr5", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 623, "end_pos": 623, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32325", "url": "https://www.uniprot.org/uniprotkb/P32325" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" }, { "database": "SGD", "id": "S000002459", "url": "https://www.yeastgenome.org/locus/S000002459" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser623", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 84, "end_pos": 84, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32325", "url": "https://www.uniprot.org/uniprotkb/P32325" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000002459", "url": "https://www.yeastgenome.org/locus/S000002459" }, { "database": "PubMed", "id": "21098477", "url": "https://pubmed.ncbi.nlm.nih.gov/21098477" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser84", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 92, "end_pos": 92, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Ser92", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" } ], "site_lbl": "Thr95", "uniprot_canonical_ac": "P32325-1" } ], "record_id": "pubmed.20865002", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 50 }, { "field": "total_sites", "count": 50 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Helicase Subunit Cdc45 Targets the Checkpoint Kinase Rad53 to Both Replication Initiation and Elongation Complexes after Fork Stalling.", "journal": "Molecular cell", "date": "2019-02-07", "authors": "Can Geylani, Kauerhof Anastasia Christine, Macak Dominik, Zegerman Philip", "reference": { "type": "PubMed", "id": "30595439", "url": "https://pubmed.ncbi.nlm.nih.gov/30595439" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53135-1", "protein_name": "DNA replication regulator SLD3", "gene_name": "SLD3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08032-1", "protein_name": "Cell division control protein 45", "gene_name": "CDC45", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53135", "url": "https://www.uniprot.org/uniprotkb/P53135" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 306, "end_pos": 306, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "SGD", "id": "S000003081", "url": "https://www.yeastgenome.org/locus/S000003081" }, { "database": "PubMed", "id": "30595439", "url": "https://pubmed.ncbi.nlm.nih.gov/30595439" } ], "site_lbl": "Ser306", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 310, "end_pos": 310, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53135" }, { "database": "PubMed", "id": "20835227", "url": "https://pubmed.ncbi.nlm.nih.gov/20835227" }, { "database": "SGD", "id": "S000003081", "url": "https://www.yeastgenome.org/locus/S000003081" }, { "database": "PubMed", "id": "30595439", "url": "https://pubmed.ncbi.nlm.nih.gov/30595439" } ], "site_lbl": "Thr310", "uniprot_canonical_ac": "P53135-1" }, { "start_pos": 189, "end_pos": 189, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08032", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08032" }, { "database": "PubMed", "id": "30595439", "url": "https://pubmed.ncbi.nlm.nih.gov/30595439" }, { "database": "SGD", "id": "S000004093", "url": "https://www.yeastgenome.org/locus/S000004093" } ], "site_lbl": "Thr189", "uniprot_canonical_ac": "Q08032-1" }, { "start_pos": 195, "end_pos": 195, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08032", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08032" }, { "database": "PubMed", "id": "30595439", "url": "https://pubmed.ncbi.nlm.nih.gov/30595439" }, { "database": "SGD", "id": "S000004093", "url": "https://www.yeastgenome.org/locus/S000004093" } ], "site_lbl": "Thr195", "uniprot_canonical_ac": "Q08032-1" } ], "record_id": "pubmed.30595439", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein kinase Ypk1 phosphorylates regulatory proteins Orm1 and Orm2 to control sphingolipid homeostasis in Saccharomyces cerevisiae.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011-11-29", "authors": "Roelants Fran\u00e7oise M, Breslow David K, Muir Alexander, Weissman Jonathan S, Thorner Jeremy", "reference": { "type": "PubMed", "id": "22080611", "url": "https://pubmed.ncbi.nlm.nih.gov/22080611" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53224-1", "protein_name": "Protein ORM1", "gene_name": "ORM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06144-1", "protein_name": "Protein ORM2", "gene_name": "ORM2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P12688-1", "protein_name": "Serine/threonine-protein kinase YPK1", "gene_name": "YPK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53224", "url": "https://www.uniprot.org/uniprotkb/P53224" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 51, "end_pos": 51, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003270", "url": "https://www.yeastgenome.org/locus/S000003270" }, { "database": "iPTMnet", "id": "P53224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53224" }, { "database": "PubMed", "id": "22080611", "url": "https://pubmed.ncbi.nlm.nih.gov/22080611" } ], "site_lbl": "Ser51", "uniprot_canonical_ac": "P53224-1" }, { "start_pos": 52, "end_pos": 52, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003270", "url": "https://www.yeastgenome.org/locus/S000003270" }, { "database": "iPTMnet", "id": "P53224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53224" }, { "database": "PubMed", "id": "22080611", "url": "https://pubmed.ncbi.nlm.nih.gov/22080611" } ], "site_lbl": "Ser52", "uniprot_canonical_ac": "P53224-1" }, { "start_pos": 53, "end_pos": 53, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003270", "url": "https://www.yeastgenome.org/locus/S000003270" }, { "database": "iPTMnet", "id": "P53224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53224" }, { "database": "PubMed", "id": "22080611", "url": "https://pubmed.ncbi.nlm.nih.gov/22080611" } ], "site_lbl": "Ser53", "uniprot_canonical_ac": "P53224-1" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06144", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06144" }, { "database": "PubMed", "id": "31368600", "url": "https://pubmed.ncbi.nlm.nih.gov/31368600" }, { "database": "PubMed", "id": "32611771", "url": "https://pubmed.ncbi.nlm.nih.gov/32611771" }, { "database": "SGD", "id": "S000004342", "url": "https://www.yeastgenome.org/locus/S000004342" }, { "database": "PubMed", "id": "22080611", "url": "https://pubmed.ncbi.nlm.nih.gov/22080611" }, { "database": "PubMed", "id": "31851579", "url": "https://pubmed.ncbi.nlm.nih.gov/31851579" } ], "site_lbl": "Ser46", "uniprot_canonical_ac": "Q06144-1" }, { "start_pos": 47, "end_pos": 47, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06144", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06144" }, { "database": "PubMed", "id": "31368600", "url": "https://pubmed.ncbi.nlm.nih.gov/31368600" }, { "database": "PubMed", "id": "32611771", "url": "https://pubmed.ncbi.nlm.nih.gov/32611771" }, { "database": "SGD", "id": "S000004342", "url": "https://www.yeastgenome.org/locus/S000004342" }, { "database": "PubMed", "id": "22080611", "url": "https://pubmed.ncbi.nlm.nih.gov/22080611" }, { "database": "PubMed", "id": "31851579", "url": "https://pubmed.ncbi.nlm.nih.gov/31851579" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser47", "uniprot_canonical_ac": "Q06144-1" }, { "start_pos": 48, "end_pos": 48, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06144", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06144" }, { "database": "PubMed", "id": "31368600", "url": "https://pubmed.ncbi.nlm.nih.gov/31368600" }, { "database": "PubMed", "id": "32611771", "url": "https://pubmed.ncbi.nlm.nih.gov/32611771" }, { "database": "SGD", "id": "S000004342", "url": "https://www.yeastgenome.org/locus/S000004342" }, { "database": "PubMed", "id": "22080611", "url": "https://pubmed.ncbi.nlm.nih.gov/22080611" }, { "database": "PubMed", "id": "31851579", "url": "https://pubmed.ncbi.nlm.nih.gov/31851579" } ], "site_lbl": "Ser48", "uniprot_canonical_ac": "Q06144-1" }, { "start_pos": 662, "end_pos": 662, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKH1", "evidence": [ { "database": "UniProtKB", "id": "P12688", "url": "https://www.uniprot.org/uniprotkb/P12688" }, { "database": "iPTMnet", "id": "P12688", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12688" }, { "database": "PubMed", "id": "10074427", "url": "https://pubmed.ncbi.nlm.nih.gov/10074427" }, { "database": "PubMed", "id": "15470109", "url": "https://pubmed.ncbi.nlm.nih.gov/15470109" }, { "database": "PubMed", "id": "7489717", "url": "https://pubmed.ncbi.nlm.nih.gov/7489717" }, { "database": "PubMed", "id": "11807089", "url": "https://pubmed.ncbi.nlm.nih.gov/11807089" }, { "database": "PubMed", "id": "22080611", "url": "https://pubmed.ncbi.nlm.nih.gov/22080611" }, { "database": "PubMed", "id": "26274562", "url": "https://pubmed.ncbi.nlm.nih.gov/26274562" }, { "database": "PubMed", "id": "28739659", "url": "https://pubmed.ncbi.nlm.nih.gov/28739659" }, { "database": "PubMed", "id": "29769614", "url": "https://pubmed.ncbi.nlm.nih.gov/29769614" }, { "database": "PubMed", "id": "30578283", "url": "https://pubmed.ncbi.nlm.nih.gov/30578283" }, { "database": "PubMed", "id": "32611771", "url": "https://pubmed.ncbi.nlm.nih.gov/32611771" }, { "database": "SGD", "id": "S000001609", "url": "https://www.yeastgenome.org/locus/S000001609" }, { "database": "PubMed", "id": "21841122", "url": "https://pubmed.ncbi.nlm.nih.gov/21841122" }, { "database": "PubMed", "id": "22307609", "url": "https://pubmed.ncbi.nlm.nih.gov/22307609" }, { "database": "PubMed", "id": "29986907", "url": "https://pubmed.ncbi.nlm.nih.gov/29986907" }, { "database": "PubMed", "id": "32614710", "url": "https://pubmed.ncbi.nlm.nih.gov/32614710" }, { "database": "PubMed", "id": "15840588", "url": "https://pubmed.ncbi.nlm.nih.gov/15840588" } ], "site_lbl": "Thr662", "uniprot_canonical_ac": "P12688-1" } ], "record_id": "pubmed.22080611", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Saccharomyces carlsbergensis contains two functional genes encoding the acyl-CoA binding protein, one similar to the ACB1 gene from S. cerevisiae and one identical to the ACB1 gene from S. monacensis.", "journal": "Yeast", "date": "1997", "authors": "B\u00f8rsting C, Hummel R, Schultz E R, Rose T M, Pedersen M B, Knudsen J, Kristiansen K", "reference": { "type": "PubMed", "id": "9434347", "url": "https://pubmed.ncbi.nlm.nih.gov/9434347" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53224-1", "protein_name": "Protein ORM1", "gene_name": "ORM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31787-1", "protein_name": "Acyl-CoA-binding protein", "gene_name": "ACB1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53224", "url": "https://www.uniprot.org/uniprotkb/P53224" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9434347", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of the cortical actin cytoskeleton in budding yeast by twinfilin, a ubiquitous actin monomer-sequestering protein.", "journal": "J. Cell Biol.", "date": "1998", "authors": "Goode B L, Drubin D G, Lappalainen P", "reference": { "type": "PubMed", "id": "9700161", "url": "https://pubmed.ncbi.nlm.nih.gov/9700161" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53250-1", "protein_name": "Twinfilin-1", "gene_name": "TWF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53250", "url": "https://www.uniprot.org/uniprotkb/P53250" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9700161", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The yeast model for Batten disease: a role for Btn2p in the trafficking of the Golgi-associated vesicular targeting protein, Yif1p.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2003", "authors": "Chattopadhyay Subrata, Roberts Paul M, Pearce David A", "reference": { "type": "PubMed", "id": "12615067", "url": "https://pubmed.ncbi.nlm.nih.gov/12615067" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53286-1", "protein_name": "Protein BTN2", "gene_name": "BTN2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53845-1", "protein_name": "Protein transport protein YIF1", "gene_name": "YIF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53286", "url": "https://www.uniprot.org/uniprotkb/P53286" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12615067", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleolar protein PinX1p regulates telomerase by sequestering its protein catalytic subunit in an inactive complex lacking telomerase RNA.", "journal": "Genes & development", "date": "2004-02-15", "authors": "Lin Jue, Blackburn Elizabeth H", "reference": { "type": "PubMed", "id": "14977919", "url": "https://pubmed.ncbi.nlm.nih.gov/14977919" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53335-1", "protein_name": "Protein PXR1", "gene_name": "PXR1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53335", "url": "https://www.uniprot.org/uniprotkb/P53335" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14977919", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "mRNA decapping is promoted by an RNA-binding channel in Dcp2.", "journal": "Mol. Cell", "date": "2008", "authors": "Deshmukh Mandar V, Jones Brittnee N, Quang-Dang Duc-Uy, Flinders Jeremy, Floor Stephen N, Kim Candice, Jemielity Jacek, Kalek Marcin, Darzynkiewicz Edward, Gross John D", "reference": { "type": "PubMed", "id": "18280238", "url": "https://pubmed.ncbi.nlm.nih.gov/18280238" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53550-1", "protein_name": "m7GpppN-mRNA hydrolase", "gene_name": "DCP2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53550", "url": "https://www.uniprot.org/uniprotkb/P53550" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18280238", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dcp2 phosphorylation by Ste20 modulates stress granule assembly and mRNA decay in Saccharomyces cerevisiae.", "journal": "The Journal of cell biology", "date": "2010-05-31", "authors": "Yoon Je-Hyun, Choi Eui-Ju, Parker Roy", "reference": { "type": "PubMed", "id": "20513766", "url": "https://pubmed.ncbi.nlm.nih.gov/20513766" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53550-1", "protein_name": "m7GpppN-mRNA hydrolase", "gene_name": "DCP2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53550", "url": "https://www.uniprot.org/uniprotkb/P53550" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 137, "end_pos": 137, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53550", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53550" }, { "database": "PubMed", "id": "20513766", "url": "https://pubmed.ncbi.nlm.nih.gov/20513766" }, { "database": "SGD", "id": "S000005062", "url": "https://www.yeastgenome.org/locus/S000005062" } ], "site_lbl": "Ser137", "uniprot_canonical_ac": "P53550-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53550", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53550" }, { "database": "PubMed", "id": "20513766", "url": "https://pubmed.ncbi.nlm.nih.gov/20513766" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P53550-1" } ], "record_id": "pubmed.20513766", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Trm112 is required for Bud23-mediated methylation of the 18S rRNA at position G1575.", "journal": "Molecular and cellular biology", "date": "2012-06", "authors": "Figaro Sabine, Wacheul Ludivine, Schillewaert St\u00e9phanie, Graille Marc, Huvelle Emmeline, Mongeard R\u00e9mi, Zorbas Christiane, Lafontaine Denis L J, Heurgu\u00e9-Hamard Val\u00e9rie", "reference": { "type": "PubMed", "id": "22493060", "url": "https://pubmed.ncbi.nlm.nih.gov/22493060" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53738-1", "protein_name": "Multifunctional methyltransferase subunit TRM112", "gene_name": "TRM112", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25627-1", "protein_name": "18S rRNA (guanine(1575)-N(7))-methyltransferase", "gene_name": "BUD23", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53738", "url": "https://www.uniprot.org/uniprotkb/P53738" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.22493060", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis for bre5 cofactor recognition by the ubp3 deubiquitylating enzyme.", "journal": "J. Mol. Biol.", "date": "2007", "authors": "Li Keqin, Ossareh-Nazari Batool, Liu Xin, Dargemont Catherine, Marmorstein Ronen", "reference": { "type": "PubMed", "id": "17632125", "url": "https://pubmed.ncbi.nlm.nih.gov/17632125" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53741-1", "protein_name": "UBP3-associated protein BRE5", "gene_name": "BRE5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01477-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 3", "gene_name": "UBP3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53741", "url": "https://www.uniprot.org/uniprotkb/P53741" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17632125", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cdc48 and Ufd3, new partners of the ubiquitin protease Ubp3, are required for ribophagy.", "journal": "EMBO reports", "date": "2010-07", "authors": "Ossareh-Nazari Batool, Bonizec M\u00e9lanie, Cohen Mickael, Dokudovskaya Svetlana, Delalande Fran\u00e7ois, Schaeffer Christine, Van Dorsselaer Alain, Dargemont Catherine", "reference": { "type": "PubMed", "id": "20508643", "url": "https://pubmed.ncbi.nlm.nih.gov/20508643" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53741-1", "protein_name": "UBP3-associated protein BRE5", "gene_name": "BRE5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01477-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 3", "gene_name": "UBP3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25694-1", "protein_name": "AAA family ATPase involved in ubiquitin-mediated protein degradation CDC48", "gene_name": "CDC48", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36037-1", "protein_name": "Protein DOA1", "gene_name": "DOA1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53741", "url": "https://www.uniprot.org/uniprotkb/P53741" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 147, "end_pos": 515, "sequence_org": "PYVLTDASLSQSNEENSVSAVEEDKIRHESGVEKEKEKEKSPEISKPKAKKETVKDTTAPTESSTQEKPIVDHSQPRAIPVTKESKIHTETVPSSTKGNHKQDEVSTEELGNVTKLNEKSHKAEKKAAPIKTKEGSVEAINAVNNSSLPNGKEVSDEKPVPGGVKEAETEIKPIEPQVSDAKESGNNASTPSSSPEPVANPPKMTWASKLMNENSDRISKNNTTVEYIRPETLPKKPTERKFEMGNRRDNASANSKNKKKPVFSTVNKDGFYPIYIRGTNGLREEKLRSALEKEFGKVMRITAADNFAVVDFETQKSQIDALEKKKKSIDGIEVCLERKTVKKPTSNNPPGIFTNGTRSHRKQPLKRKD", "sequence_mut": "", "comment": "Loss of interaction with CDC48.", "evidence": [ { "database": "UniProtKB", "id": "P53741", "url": "https://www.uniprot.org/uniprotkb/P53741" }, { "database": "PubMed", "id": "20508643", "url": "https://pubmed.ncbi.nlm.nih.gov/20508643" } ], "uniprot_canonical_ac": "P53741-1" }, { "start_pos": 2, "end_pos": 146, "sequence_org": "GVTVQDICFAFLQNYYERMRTDPSKLAYFYASTAELTHTNYQSKSTNEKDDVLPTVKVTGRENINKFFSRNDAKVRSLKLKLDTIDFQYTGHLHKSILIMATGEMFWTGTPVYKFCQTFILLPSSNGSTFDITNDIIRFISNSFK", "sequence_mut": "", "comment": "No defect in the interaction with CDC48.", "evidence": [ { "database": "UniProtKB", "id": "P53741", "url": "https://www.uniprot.org/uniprotkb/P53741" }, { "database": "PubMed", "id": "20508643", "url": "https://pubmed.ncbi.nlm.nih.gov/20508643" } ], "uniprot_canonical_ac": "P53741-1" } ], "record_id": "pubmed.20508643", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Esf2p, a U3-associated factor required for small-subunit processome assembly and compaction.", "journal": "Molecular and cellular biology", "date": "2005-07", "authors": "Hoang Tran, Peng Wen-Tao, Vanrobays Emmanuel, Krogan Nevan, Hiley Shawna, Beyer Ann L, Osheim Yvonne N, Greenblatt Jack, Hughes Timothy R, Lafontaine Denis L J", "reference": { "type": "PubMed", "id": "15964808", "url": "https://pubmed.ncbi.nlm.nih.gov/15964808" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53743-1", "protein_name": "Pre-rRNA-processing protein ESF2", "gene_name": "ESF2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53743", "url": "https://www.uniprot.org/uniprotkb/P53743" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15964808", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of the genes for two topoisomerase I-interacting proteins from Saccharomyces cerevisiae.", "journal": "Yeast", "date": "1999", "authors": "Park H, Sternglanz R", "reference": { "type": "PubMed", "id": "10028183", "url": "https://pubmed.ncbi.nlm.nih.gov/10028183" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53840-1", "protein_name": "Topoisomerase 1-associated factor 1", "gene_name": "TOF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02208-1", "protein_name": "Topoisomerase 1-associated factor 2", "gene_name": "TOF2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53840", "url": "https://www.uniprot.org/uniprotkb/P53840" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10028183", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tof1p regulates DNA damage responses during S phase in Saccharomyces cerevisiae.", "journal": "Genetics", "date": "2001-02", "authors": "Foss E J", "reference": { "type": "PubMed", "id": "11156979", "url": "https://pubmed.ncbi.nlm.nih.gov/11156979" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53840-1", "protein_name": "Topoisomerase 1-associated factor 1", "gene_name": "TOF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53840", "url": "https://www.uniprot.org/uniprotkb/P53840" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11156979", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mrc1 and Tof1 promote replication fork progression and recovery independently of Rad53.", "journal": "Molecular cell", "date": "2005-09-02", "authors": "Tourri\u00e8re H\u00e9l\u00e8ne, Versini Gwenna\u00eblle, Cord\u00f3n-Preciado Violeta, Alabert Constance, Pasero Philippe", "reference": { "type": "PubMed", "id": "16137625", "url": "https://pubmed.ncbi.nlm.nih.gov/16137625" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53840-1", "protein_name": "Topoisomerase 1-associated factor 1", "gene_name": "TOF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53840", "url": "https://www.uniprot.org/uniprotkb/P53840" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16137625", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of a spliceosome turnover pathway suppresses splicing defects.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006-09-12", "authors": "Pandit Shatakshi, Lynn Bert, Rymond Brian C", "reference": { "type": "PubMed", "id": "16945917", "url": "https://pubmed.ncbi.nlm.nih.gov/16945917" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53866-1", "protein_name": "Protein SQS1", "gene_name": "SQS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53866", "url": "https://www.uniprot.org/uniprotkb/P53866" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16945917", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphoregulation of Cbk1 is critical for RAM network control of transcription and morphogenesis.", "journal": "The Journal of cell biology", "date": "2006-12-04", "authors": "Jansen Jaclyn M, Barry Margaret F, Yoo Charles K, Weiss Eric L", "reference": { "type": "PubMed", "id": "17145962", "url": "https://pubmed.ncbi.nlm.nih.gov/17145962" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53894-1", "protein_name": "Serine/threonine-protein kinase CBK1", "gene_name": "CBK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53894", "url": "https://www.uniprot.org/uniprotkb/P53894" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 570, "end_pos": 570, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53894", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53894" }, { "database": "PubMed", "id": "17145962", "url": "https://pubmed.ncbi.nlm.nih.gov/17145962" }, { "database": "PubMed", "id": "19967545", "url": "https://pubmed.ncbi.nlm.nih.gov/19967545" }, { "database": "SGD", "id": "S000005105", "url": "https://www.yeastgenome.org/locus/S000005105" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser570", "uniprot_canonical_ac": "P53894-1" }, { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53894", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53894" }, { "database": "PubMed", "id": "17145962", "url": "https://pubmed.ncbi.nlm.nih.gov/17145962" }, { "database": "PubMed", "id": "19967545", "url": "https://pubmed.ncbi.nlm.nih.gov/19967545" }, { "database": "PubMed", "id": "21135117", "url": "https://pubmed.ncbi.nlm.nih.gov/21135117" }, { "database": "SGD", "id": "S000005105", "url": "https://www.yeastgenome.org/locus/S000005105" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr743", "uniprot_canonical_ac": "P53894-1" } ], "record_id": "pubmed.17145962", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the C-terminus of the conserved NDR kinase, Cbk1p of Saccharomyces cerevisiae, make the protein independent of upstream activators.", "journal": "Molecular genetics and genomics : MGG", "date": "2010-02", "authors": "Panozzo Cristina, Bourens Myriam, Nowacka Aleksandra, Herbert Christopher James", "reference": { "type": "PubMed", "id": "19967545", "url": "https://pubmed.ncbi.nlm.nih.gov/19967545" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53894-1", "protein_name": "Serine/threonine-protein kinase CBK1", "gene_name": "CBK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53894", "url": "https://www.uniprot.org/uniprotkb/P53894" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 570, "end_pos": 570, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53894", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53894" }, { "database": "PubMed", "id": "17145962", "url": "https://pubmed.ncbi.nlm.nih.gov/17145962" }, { "database": "PubMed", "id": "19967545", "url": "https://pubmed.ncbi.nlm.nih.gov/19967545" }, { "database": "SGD", "id": "S000005105", "url": "https://www.yeastgenome.org/locus/S000005105" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser570", "uniprot_canonical_ac": "P53894-1" }, { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53894", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53894" }, { "database": "PubMed", "id": "17145962", "url": "https://pubmed.ncbi.nlm.nih.gov/17145962" }, { "database": "PubMed", "id": "19967545", "url": "https://pubmed.ncbi.nlm.nih.gov/19967545" }, { "database": "PubMed", "id": "21135117", "url": "https://pubmed.ncbi.nlm.nih.gov/21135117" }, { "database": "SGD", "id": "S000005105", "url": "https://www.yeastgenome.org/locus/S000005105" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr743", "uniprot_canonical_ac": "P53894-1" } ], "record_id": "pubmed.19967545", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitotic exit control of the Saccharomyces cerevisiae Ndr/LATS kinase Cbk1 regulates daughter cell separation after cytokinesis.", "journal": "Molecular and cellular biology", "date": "2011-02", "authors": "Brace Jennifer, Hsu Jonathan, Weiss Eric L", "reference": { "type": "PubMed", "id": "21135117", "url": "https://pubmed.ncbi.nlm.nih.gov/21135117" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53894-1", "protein_name": "Serine/threonine-protein kinase CBK1", "gene_name": "CBK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53894", "url": "https://www.uniprot.org/uniprotkb/P53894" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53894", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53894" }, { "database": "PubMed", "id": "17145962", "url": "https://pubmed.ncbi.nlm.nih.gov/17145962" }, { "database": "PubMed", "id": "19967545", "url": "https://pubmed.ncbi.nlm.nih.gov/19967545" }, { "database": "PubMed", "id": "21135117", "url": "https://pubmed.ncbi.nlm.nih.gov/21135117" }, { "database": "SGD", "id": "S000005105", "url": "https://www.yeastgenome.org/locus/S000005105" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr743", "uniprot_canonical_ac": "P53894-1" } ], "record_id": "pubmed.21135117", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Saccharomyces cerevisiae actin patch protein App1p is a phosphatidate phosphatase enzyme.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Chae M, Han GS, Carman GM", "reference": { "type": "PubMed", "id": "23071111", "url": "https://pubmed.ncbi.nlm.nih.gov/23071111" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53933-1", "protein_name": "Phosphatidate phosphatase APP1", "gene_name": "APP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53933", "url": "https://www.uniprot.org/uniprotkb/P53933" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 281, "end_pos": 281, "sequence_org": "D", "sequence_mut": "E", "comment": "Abolishes PAP activity.", "evidence": [ { "database": "UniProtKB", "id": "P53933", "url": "https://www.uniprot.org/uniprotkb/P53933" }, { "database": "PubMed", "id": "23071111", "url": "https://pubmed.ncbi.nlm.nih.gov/23071111" } ], "uniprot_canonical_ac": "P53933-1" } ], "record_id": "pubmed.23071111", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the yeast actin patch protein App1p phosphatidate phosphatase.", "journal": "The Journal of biological chemistry", "date": "2013-03-01", "authors": "Chae Minjung, Carman George M", "reference": { "type": "PubMed", "id": "23335564", "url": "https://pubmed.ncbi.nlm.nih.gov/23335564" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53933-1", "protein_name": "Phosphatidate phosphatase APP1", "gene_name": "APP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53933", "url": "https://www.uniprot.org/uniprotkb/P53933" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.23335564", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nis1 encoded by YNL078W: a new neck protein of Saccharomyces cerevisiae.", "journal": "Genes Genet. Syst.", "date": "2001", "authors": "Iwase M, Toh-e A", "reference": { "type": "PubMed", "id": "11817649", "url": "https://pubmed.ncbi.nlm.nih.gov/11817649" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53939-1", "protein_name": "Protein NIS1", "gene_name": "NIS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53939", "url": "https://www.uniprot.org/uniprotkb/P53939" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11817649", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sumoylation of the budding yeast kinetochore protein Ndc10 is required for Ndc10 spindle localization and regulation of anaphase spindle elongation.", "journal": "J. Cell Biol.", "date": "2006", "authors": "Montpetit Ben, Hazbun Tony R, Fields Stanley, Hieter Philip", "reference": { "type": "PubMed", "id": "16923829", "url": "https://pubmed.ncbi.nlm.nih.gov/16923829" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53939-1", "protein_name": "Protein NIS1", "gene_name": "NIS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53939", "url": "https://www.uniprot.org/uniprotkb/P53939" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16923829", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biochemical characterization, membrane association and identification of amino acids essential for the function of Alg11 from Saccharomyces cerevisiae, an alpha1,2-mannosyltransferase catalysing two sequential glycosylation steps in the formation of the lipid-linked core oligosaccharide.", "journal": "The Biochemical journal", "date": "2010-02-09", "authors": "Absmanner Birgit, Schmeiser Verena, K\u00e4mpf Michael, Lehle Ludwig", "reference": { "type": "PubMed", "id": "19929855", "url": "https://pubmed.ncbi.nlm.nih.gov/19929855" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P53954-1", "protein_name": "GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase", "gene_name": "ALG11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P53954", "url": "https://www.uniprot.org/uniprotkb/P53954" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 319, "end_pos": 319, "sequence_org": "K", "sequence_mut": "A", "comment": "Almost no activity.", "evidence": [ { "database": "UniProtKB", "id": "P53954", "url": "https://www.uniprot.org/uniprotkb/P53954" }, { "database": "PubMed", "id": "19929855", "url": "https://pubmed.ncbi.nlm.nih.gov/19929855" } ], "uniprot_canonical_ac": "P53954-1" }, { "start_pos": 405, "end_pos": 405, "sequence_org": "E", "sequence_mut": "A", "comment": "Almost no activity.", "evidence": [ { "database": "UniProtKB", "id": "P53954", "url": "https://www.uniprot.org/uniprotkb/P53954" }, { "database": "PubMed", "id": "19929855", "url": "https://pubmed.ncbi.nlm.nih.gov/19929855" }, { "database": "PubMed", "id": "16878994", "url": "https://pubmed.ncbi.nlm.nih.gov/16878994" } ], "uniprot_canonical_ac": "P53954-1" }, { "start_pos": 406, "end_pos": 406, "sequence_org": "H", "sequence_mut": "A", "comment": "Almost no activity.", "evidence": [ { "database": "UniProtKB", "id": "P53954", "url": "https://www.uniprot.org/uniprotkb/P53954" }, { "database": "PubMed", "id": "19929855", "url": "https://pubmed.ncbi.nlm.nih.gov/19929855" } ], "uniprot_canonical_ac": "P53954-1" }, { "start_pos": 407, "end_pos": 407, "sequence_org": "F", "sequence_mut": "A", "comment": "Impaired activity.", "evidence": [ { "database": "UniProtKB", "id": "P53954", "url": "https://www.uniprot.org/uniprotkb/P53954" }, { "database": "PubMed", "id": "19929855", "url": "https://pubmed.ncbi.nlm.nih.gov/19929855" } ], "uniprot_canonical_ac": "P53954-1" }, { "start_pos": 413, "end_pos": 413, "sequence_org": "E", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P53954", "url": "https://www.uniprot.org/uniprotkb/P53954" }, { "database": "PubMed", "id": "19929855", "url": "https://pubmed.ncbi.nlm.nih.gov/19929855" }, { "database": "PubMed", "id": "16878994", "url": "https://pubmed.ncbi.nlm.nih.gov/16878994" } ], "uniprot_canonical_ac": "P53954-1" }, { "start_pos": 84, "end_pos": 84, "sequence_org": "G", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P53954", "url": "https://www.uniprot.org/uniprotkb/P53954" }, { "database": "PubMed", "id": "19929855", "url": "https://pubmed.ncbi.nlm.nih.gov/19929855" } ], "uniprot_canonical_ac": "P53954-1" }, { "start_pos": 84, "end_pos": 84, "sequence_org": "G", "sequence_mut": "P", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P53954", "url": "https://www.uniprot.org/uniprotkb/P53954" }, { "database": "PubMed", "id": "19929855", "url": "https://pubmed.ncbi.nlm.nih.gov/19929855" } ], "uniprot_canonical_ac": "P53954-1" }, { "start_pos": 85, "end_pos": 85, "sequence_org": "G", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P53954", "url": "https://www.uniprot.org/uniprotkb/P53954" }, { "database": "PubMed", "id": "19929855", "url": "https://pubmed.ncbi.nlm.nih.gov/19929855" } ], "uniprot_canonical_ac": "P53954-1" }, { "start_pos": 85, "end_pos": 85, "sequence_org": "G", "sequence_mut": "P", "comment": "No activity.", "evidence": [ { "database": "UniProtKB", "id": "P53954", "url": "https://www.uniprot.org/uniprotkb/P53954" }, { "database": "PubMed", "id": "19929855", "url": "https://pubmed.ncbi.nlm.nih.gov/19929855" } ], "uniprot_canonical_ac": "P53954-1" }, { "start_pos": 87, "end_pos": 87, "sequence_org": "G", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P53954", "url": "https://www.uniprot.org/uniprotkb/P53954" }, { "database": "PubMed", "id": "19929855", "url": "https://pubmed.ncbi.nlm.nih.gov/19929855" } ], "uniprot_canonical_ac": "P53954-1" }, { "start_pos": 87, "end_pos": 87, "sequence_org": "G", "sequence_mut": "P", "comment": "No activity.", "evidence": [ { "database": "UniProtKB", "id": "P53954", "url": "https://www.uniprot.org/uniprotkb/P53954" }, { "database": "PubMed", "id": "19929855", "url": "https://pubmed.ncbi.nlm.nih.gov/19929855" } ], "uniprot_canonical_ac": "P53954-1" } ], "record_id": "pubmed.19929855", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast SUB1 is a suppressor of TFIIB mutations and has homology to the human co-activator PC4.", "journal": "EMBO J.", "date": "1996", "authors": "Knaus R, Pollock R, Guarente L", "reference": { "type": "PubMed", "id": "8617240", "url": "https://pubmed.ncbi.nlm.nih.gov/8617240" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P54000-1", "protein_name": "RNA polymerase II transcriptional coactivator SUB1", "gene_name": "SUB1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P54000", "url": "https://www.uniprot.org/uniprotkb/P54000" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8617240", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tom5 functionally links mitochondrial preprotein receptors to the general import pore.", "journal": "Nature", "date": "1997-07-10", "authors": "Dietmeier K, H\u00f6nlinger A, B\u00f6mer U, Dekker P J, Eckerskorn C, Lottspeich F, K\u00fcbrich M, Pfanner N", "reference": { "type": "PubMed", "id": "9217162", "url": "https://pubmed.ncbi.nlm.nih.gov/9217162" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P80967-1", "protein_name": "Mitochondrial import receptor subunit TOM5", "gene_name": "TOM5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P80967", "url": "https://www.uniprot.org/uniprotkb/P80967" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9217162", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic analysis of the Saccharomyces cerevisiae RHO3 gene, encoding a rho-type small GTPase, provides evidence for a role in bud formation.", "journal": "Genetics", "date": "1996-02", "authors": "Imai J, Toh-e A, Matsui Y", "reference": { "type": "PubMed", "id": "8852836", "url": "https://pubmed.ncbi.nlm.nih.gov/8852836" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00245-1", "protein_name": "GTP-binding protein RHO3", "gene_name": "RHO3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q00245", "url": "https://www.uniprot.org/uniprotkb/Q00245" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8852836", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CTF4 (CHL15) mutants exhibit defective DNA metabolism in the yeast Saccharomyces cerevisiae.", "journal": "Mol. Cell. Biol.", "date": "1992", "authors": "Kouprina N, Kroll E, Bannikov V, Bliskovsky V, Gizatullin R, Kirillov A, Shestopalov B, Zakharyev V, Hieter P, Spencer F", "reference": { "type": "PubMed", "id": "1341195", "url": "https://pubmed.ncbi.nlm.nih.gov/1341195" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01454-1", "protein_name": "DNA polymerase alpha-binding protein", "gene_name": "CTF4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q01454", "url": "https://www.uniprot.org/uniprotkb/Q01454" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1341195", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence that POB1, a Saccharomyces cerevisiae protein that binds to DNA polymerase alpha, acts in DNA metabolism in vivo.", "journal": "Mol. Cell. Biol.", "date": "1992", "authors": "Miles J, Formosa T", "reference": { "type": "PubMed", "id": "1448101", "url": "https://pubmed.ncbi.nlm.nih.gov/1448101" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01454-1", "protein_name": "DNA polymerase alpha-binding protein", "gene_name": "CTF4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q01454", "url": "https://www.uniprot.org/uniprotkb/Q01454" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1448101", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CHL15 -- a new gene controlling the replication of chromosomes in Saccharomycetes yeast: cloning, physical mapping, sequencing, and sequence analysis.", "journal": "Mol. Biol. (Mosk.)", "date": "1993", "authors": "Kuprina N Iu, Krol' E S, Koriabin M Iu, Shestopalov B V, Bliskovski\u012d V V, Bannikov V M, Gizatullin R Z, Kirillov A V, Kravtsov V Iu, Zakhar'ev V M", "reference": { "type": "PubMed", "id": "8316240", "url": "https://pubmed.ncbi.nlm.nih.gov/8316240" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01454-1", "protein_name": "DNA polymerase alpha-binding protein", "gene_name": "CTF4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q01454", "url": "https://www.uniprot.org/uniprotkb/Q01454" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8316240", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Control of Ubp3 ubiquitin protease activity by the Hog1 SAPK modulates transcription upon osmostress.", "journal": "The EMBO journal", "date": "2011-07-08", "authors": "Sol\u00e9 Carme, Nadal-Ribelles Mariona, Kraft Claudine, Peter Matthias, Posas Francesc, de Nadal Eul\u00e0lia", "reference": { "type": "PubMed", "id": "21743437", "url": "https://pubmed.ncbi.nlm.nih.gov/21743437" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01477-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 3", "gene_name": "UBP3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q01477", "url": "https://www.uniprot.org/uniprotkb/Q01477" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 695, "end_pos": 695, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q01477", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01477" }, { "database": "PubMed", "id": "21743437", "url": "https://pubmed.ncbi.nlm.nih.gov/21743437" } ], "site_lbl": "Ser695", "uniprot_canonical_ac": "Q01477-1" } ], "record_id": "pubmed.21743437", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A deubiquitinating enzyme interacts with SIR4 and regulates silencing in S. cerevisiae.", "journal": "Cell", "date": "1996-08-23", "authors": "Moazed D, Johnson D", "reference": { "type": "PubMed", "id": "8752220", "url": "https://pubmed.ncbi.nlm.nih.gov/8752220" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01477-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 3", "gene_name": "UBP3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q01477", "url": "https://www.uniprot.org/uniprotkb/Q01477" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8752220", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The crystal structure of the C-terminal domain of Vps28 reveals a conserved surface required for Vps20 recruitment.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2006-08", "authors": "Pineda-Molina Estela, Belrhali Hassan, Piefer Andrew J, Akula Indira, Bates Paul, Weissenhorn Winfried", "reference": { "type": "PubMed", "id": "16749904", "url": "https://pubmed.ncbi.nlm.nih.gov/16749904" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02767-1", "protein_name": "Vacuolar protein sorting-associated protein 28", "gene_name": "VPS28", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02767", "url": "https://www.uniprot.org/uniprotkb/Q02767" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 228, "end_pos": 231, "sequence_org": "FDLE", "sequence_mut": "ASLA", "comment": "Abolishes interaction with VPS20.", "evidence": [ { "database": "UniProtKB", "id": "Q02767", "url": "https://www.uniprot.org/uniprotkb/Q02767" }, { "database": "PubMed", "id": "16749904", "url": "https://pubmed.ncbi.nlm.nih.gov/16749904" } ], "uniprot_canonical_ac": "Q02767-1" } ], "record_id": "pubmed.16749904", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multilamellar endosome-like compartment accumulates in the yeast vps28 vacuolar protein sorting mutant.", "journal": "Mol. Biol. Cell", "date": "1996", "authors": "Rieder S E, Banta L M, K\u00f6hrer K, McCaffery J M, Emr S D", "reference": { "type": "PubMed", "id": "8817003", "url": "https://pubmed.ncbi.nlm.nih.gov/8817003" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02767-1", "protein_name": "Vacuolar protein sorting-associated protein 28", "gene_name": "VPS28", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02767", "url": "https://www.uniprot.org/uniprotkb/Q02767" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8817003", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structure of Ski8p, a protein regulating mRNA degradation: Implications for WD protein structure.", "journal": "Protein Sci.", "date": "2004", "authors": "Madrona A Yarrow, Wilson David K", "reference": { "type": "PubMed", "id": "15152089", "url": "https://pubmed.ncbi.nlm.nih.gov/15152089" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02793-1", "protein_name": "Antiviral protein SKI8", "gene_name": "SKI8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02793", "url": "https://www.uniprot.org/uniprotkb/Q02793" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15152089", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of Ski8p, a WD-repeat protein with dual roles in mRNA metabolism and meiotic recombination.", "journal": "Protein Sci.", "date": "2004", "authors": "Cheng Zhihong, Liu Yuying, Wang Chernhoe, Parker Roy, Song Haiwei", "reference": { "type": "PubMed", "id": "15340168", "url": "https://pubmed.ncbi.nlm.nih.gov/15340168" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02793-1", "protein_name": "Antiviral protein SKI8", "gene_name": "SKI8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02793", "url": "https://www.uniprot.org/uniprotkb/Q02793" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15340168", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Both conserved and non-conserved regions of Spo11 are essential for meiotic recombination initiation in yeast.", "journal": "Molecular genetics and genomics : MGG", "date": "2006-10", "authors": "Nag Dilip K, Pata Janice D, Sironi Manuela, Flood David R, Hart Ashley M", "reference": { "type": "PubMed", "id": "16816949", "url": "https://pubmed.ncbi.nlm.nih.gov/16816949" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02793-1", "protein_name": "Antiviral protein SKI8", "gene_name": "SKI8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02793", "url": "https://www.uniprot.org/uniprotkb/Q02793" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16816949", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gene disruption indicates that the only essential function of the SKI8 chromosomal gene is to protect Saccharomyces cerevisiae from viral cytopathology.", "journal": "Virology", "date": "1987-03", "authors": "Sommer S S, Wickner R B", "reference": { "type": "PubMed", "id": "3029964", "url": "https://pubmed.ncbi.nlm.nih.gov/3029964" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02793-1", "protein_name": "Antiviral protein SKI8", "gene_name": "SKI8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02793", "url": "https://www.uniprot.org/uniprotkb/Q02793" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.3029964", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A yeast antiviral protein, SKI8, shares a repeated amino acid sequence pattern with beta-subunits of G proteins and several other proteins.", "journal": "Yeast", "date": "1993", "authors": "Matsumoto Y, Sarkar G, Sommer S S, Wickner R B", "reference": { "type": "PubMed", "id": "8442386", "url": "https://pubmed.ncbi.nlm.nih.gov/8442386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02793-1", "protein_name": "Antiviral protein SKI8", "gene_name": "SKI8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02793", "url": "https://www.uniprot.org/uniprotkb/Q02793" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8442386", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular and genetic analysis of REC103, an early meiotic recombination gene in yeast.", "journal": "Genetics", "date": "1997-08", "authors": "Gardiner J M, Bullard S A, Chrome C, Malone R E", "reference": { "type": "PubMed", "id": "9258672", "url": "https://pubmed.ncbi.nlm.nih.gov/9258672" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02793-1", "protein_name": "Antiviral protein SKI8", "gene_name": "SKI8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02793", "url": "https://www.uniprot.org/uniprotkb/Q02793" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9258672", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystallographic analysis of the specific yet versatile recognition of distinct nuclear localization signals by karyopherin alpha.", "journal": "Structure (London, England : 1993)", "date": "2000-03-15", "authors": "Conti E, Kuriyan J", "reference": { "type": "PubMed", "id": "10745017", "url": "https://pubmed.ncbi.nlm.nih.gov/10745017" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02821-1", "protein_name": "Importin subunit alpha", "gene_name": "SRP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10745017", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of SRP1, a suppressor of temperature-sensitive RNA polymerase I mutations, in Saccharomyces cerevisiae.", "journal": "Mol. Cell. Biol.", "date": "1992", "authors": "Yano R, Oakes M, Yamaghishi M, Dodd J A, Nomura M", "reference": { "type": "PubMed", "id": "1448093", "url": "https://pubmed.ncbi.nlm.nih.gov/1448093" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02821-1", "protein_name": "Importin subunit alpha", "gene_name": "SRP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1448093", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear import of yeast Gcn4p requires karyopherins Srp1p and Kap95p.", "journal": "Molecular genetics and genomics : MGG", "date": "2004-04", "authors": "Pries R, B\u00f6meke K, Draht O, K\u00fcnzler M, Braus G H", "reference": { "type": "PubMed", "id": "14648200", "url": "https://pubmed.ncbi.nlm.nih.gov/14648200" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02821-1", "protein_name": "Importin subunit alpha", "gene_name": "SRP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06142-1", "protein_name": "Importin subunit beta-1", "gene_name": "KAP95", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P03069-1", "protein_name": "General control transcription factor GCN4", "gene_name": "GCN4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14648200", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast Srp1, a nuclear protein related to Drosophila and mouse pendulin, is required for normal migration, division, and integrity of nuclei during mitosis.", "journal": "Mol. Gen. Genet.", "date": "1995", "authors": "Kussel P, Frasch M", "reference": { "type": "PubMed", "id": "7565597", "url": "https://pubmed.ncbi.nlm.nih.gov/7565597" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02821-1", "protein_name": "Importin subunit alpha", "gene_name": "SRP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P52293-1", "protein_name": "Importin subunit alpha-1", "gene_name": "Kpna2", "tax_name": "Mouse" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7565597", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a yeast karyopherin heterodimer that targets import substrate to mammalian nuclear pore complexes.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Enenkel C, Blobel G, Rexach M", "reference": { "type": "PubMed", "id": "7622450", "url": "https://pubmed.ncbi.nlm.nih.gov/7622450" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02821-1", "protein_name": "Importin subunit alpha", "gene_name": "SRP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06142-1", "protein_name": "Importin subunit beta-1", "gene_name": "KAP95", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7622450", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast Srp1p has homology to armadillo/plakoglobin/beta-catenin and participates in apparently multiple nuclear functions including the maintenance of the nucleolar structure.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Yano R, Oakes ML, Tabb MM, Nomura M", "reference": { "type": "PubMed", "id": "8041713", "url": "https://pubmed.ncbi.nlm.nih.gov/8041713" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02821-1", "protein_name": "Importin subunit alpha", "gene_name": "SRP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 116, "end_pos": 116, "sequence_org": "S", "sequence_mut": "F", "comment": "In SRP1-31; temperature-sensitive mutant; reduced growth rate and chromosome loss.", "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" }, { "database": "PubMed", "id": "8041713", "url": "https://pubmed.ncbi.nlm.nih.gov/8041713" } ], "uniprot_canonical_ac": "Q02821-1" }, { "start_pos": 145, "end_pos": 145, "sequence_org": "E", "sequence_mut": "K", "comment": "In SRP1-49; temperature-sensitive mutant; alteration in nucleolar and microtubule morphology.", "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" }, { "database": "PubMed", "id": "8041713", "url": "https://pubmed.ncbi.nlm.nih.gov/8041713" } ], "uniprot_canonical_ac": "Q02821-1" }, { "start_pos": 219, "end_pos": 219, "sequence_org": "P", "sequence_mut": "Q", "comment": "In SRP1-1; temperature-sensitive mutant.", "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" }, { "database": "PubMed", "id": "8041713", "url": "https://pubmed.ncbi.nlm.nih.gov/8041713" } ], "uniprot_canonical_ac": "Q02821-1" }, { "start_pos": 286, "end_pos": 286, "sequence_org": "D", "sequence_mut": "N", "comment": "In SRP1-3; temperature-sensitive mutant.", "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" }, { "database": "PubMed", "id": "8041713", "url": "https://pubmed.ncbi.nlm.nih.gov/8041713" } ], "uniprot_canonical_ac": "Q02821-1" }, { "start_pos": 360, "end_pos": 360, "sequence_org": "E", "sequence_mut": "K", "comment": "In SRP1-2; temperature-sensitive mutant.", "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" }, { "database": "PubMed", "id": "8041713", "url": "https://pubmed.ncbi.nlm.nih.gov/8041713" } ], "uniprot_canonical_ac": "Q02821-1" }, { "start_pos": 459, "end_pos": 459, "sequence_org": "G", "sequence_mut": "V", "comment": "In SRP1-54; temperature-sensitive mutant; reduced growth rate.", "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" }, { "database": "PubMed", "id": "8041713", "url": "https://pubmed.ncbi.nlm.nih.gov/8041713" } ], "uniprot_canonical_ac": "Q02821-1" } ], "record_id": "pubmed.8041713", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein import into nuclei: association and dissociation reactions involving transport substrate, transport factors, and nucleoporins.", "journal": "Cell", "date": "1995-12-01", "authors": "Rexach M, Blobel G", "reference": { "type": "PubMed", "id": "8521485", "url": "https://pubmed.ncbi.nlm.nih.gov/8521485" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02821-1", "protein_name": "Importin subunit alpha", "gene_name": "SRP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06142-1", "protein_name": "Importin subunit beta-1", "gene_name": "KAP95", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8521485", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of Srp1p, the yeast nuclear localization signal receptor, in vitro and in vivo.", "journal": "Biochimie", "date": "1997-05", "authors": "Azuma Y, Takio K, Tabb M M, Vu L, Nomura M", "reference": { "type": "PubMed", "id": "9258433", "url": "https://pubmed.ncbi.nlm.nih.gov/9258433" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02821-1", "protein_name": "Importin subunit alpha", "gene_name": "SRP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 67, "end_pos": 67, "kinase_uniprot_canonical_ac": "P15790-1", "kinase_gene_name": "CKA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02821", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02821" }, { "database": "PubMed", "id": "9258433", "url": "https://pubmed.ncbi.nlm.nih.gov/9258433" } ], "site_lbl": "Ser67", "uniprot_canonical_ac": "Q02821-1" }, { "start_pos": 67, "end_pos": 67, "kinase_uniprot_canonical_ac": "P19454-1", "kinase_gene_name": "CKA2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02821", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02821" }, { "database": "PubMed", "id": "9258433", "url": "https://pubmed.ncbi.nlm.nih.gov/9258433" } ], "site_lbl": "Ser67", "uniprot_canonical_ac": "Q02821-1" }, { "start_pos": 67, "end_pos": 67, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02821", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02821" }, { "database": "PubMed", "id": "9258433", "url": "https://pubmed.ncbi.nlm.nih.gov/9258433" }, { "database": "SGD", "id": "S000005133", "url": "https://www.yeastgenome.org/locus/S000005133" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser67", "uniprot_canonical_ac": "Q02821-1" } ], "record_id": "pubmed.9258433", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystallographic analysis of the recognition of a nuclear localization signal by the nuclear import factor karyopherin alpha.", "journal": "Cell", "date": "1998", "authors": "Conti E, Uy M, Leighton L, Blobel G, Kuriyan J", "reference": { "type": "PubMed", "id": "9695948", "url": "https://pubmed.ncbi.nlm.nih.gov/9695948" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02821-1", "protein_name": "Importin subunit alpha", "gene_name": "SRP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02821", "url": "https://www.uniprot.org/uniprotkb/Q02821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9695948", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for histone H3K4me3 recognition by the N-terminal domain of the PHD finger protein Spp1.", "journal": "The Biochemical journal", "date": "2019-07-15", "authors": "He Chao, Liu Ning, Xie Dongya, Liu Yanhong, Xiao Yazhong, Li Fudong", "reference": { "type": "PubMed", "id": "31253666", "url": "https://pubmed.ncbi.nlm.nih.gov/31253666" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03012-1", "protein_name": "COMPASS component SPP1", "gene_name": "SPP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03012", "url": "https://www.uniprot.org/uniprotkb/Q03012" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.31253666", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two regulators of Ste12p inhibit pheromone-responsive transcription by separate mechanisms.", "journal": "Molecular and cellular biology", "date": "2000-06", "authors": "Olson K A, Nelson C, Tai G, Hung W, Yong C, Astell C, Sadowski I", "reference": { "type": "PubMed", "id": "10825185", "url": "https://pubmed.ncbi.nlm.nih.gov/10825185" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03063-1", "protein_name": "Down-regulator of invasive growth 1", "gene_name": "DIG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03373-1", "protein_name": "Down-regulator of invasive growth 2", "gene_name": "DIG2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03063", "url": "https://www.uniprot.org/uniprotkb/Q03063" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10825185", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rst1 and Rst2 are required for the a/alpha diploid cell type in yeast.", "journal": "Molecular microbiology", "date": "2002-11", "authors": "Gelli Angie", "reference": { "type": "PubMed", "id": "12410840", "url": "https://pubmed.ncbi.nlm.nih.gov/12410840" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03063-1", "protein_name": "Down-regulator of invasive growth 1", "gene_name": "DIG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03373-1", "protein_name": "Down-regulator of invasive growth 2", "gene_name": "DIG2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03063", "url": "https://www.uniprot.org/uniprotkb/Q03063" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12410840", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two novel targets of the MAP kinase Kss1 are negative regulators of invasive growth in the yeast Saccharomyces cerevisiae.", "journal": "Genes & development", "date": "1996-11-15", "authors": "Cook J G, Bardwell L, Kron S J, Thorner J", "reference": { "type": "PubMed", "id": "8918885", "url": "https://pubmed.ncbi.nlm.nih.gov/8918885" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03063-1", "protein_name": "Down-regulator of invasive growth 1", "gene_name": "DIG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03373-1", "protein_name": "Down-regulator of invasive growth 2", "gene_name": "DIG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P14681-1", "protein_name": "Mitogen-activated protein kinase KSS1", "gene_name": "KSS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03063", "url": "https://www.uniprot.org/uniprotkb/Q03063" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8918885", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of the mating pheromone and invasive growth responses in yeast by two MAP kinase substrates.", "journal": "Current biology : CB", "date": "1997-04-01", "authors": "Tedford K, Kim S, Sa D, Stevens K, Tyers M", "reference": { "type": "PubMed", "id": "9094309", "url": "https://pubmed.ncbi.nlm.nih.gov/9094309" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03063-1", "protein_name": "Down-regulator of invasive growth 1", "gene_name": "DIG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03373-1", "protein_name": "Down-regulator of invasive growth 2", "gene_name": "DIG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P16892-1", "protein_name": "Mitogen-activated protein kinase FUS3", "gene_name": "FUS3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03063", "url": "https://www.uniprot.org/uniprotkb/Q03063" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9094309", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Repression of yeast Ste12 transcription factor by direct binding of unphosphorylated Kss1 MAPK and its regulation by the Ste7 MEK.", "journal": "Genes & development", "date": "1998-09-15", "authors": "Bardwell L, Cook J G, Voora D, Baggott D M, Martinez A R, Thorner J", "reference": { "type": "PubMed", "id": "9744865", "url": "https://pubmed.ncbi.nlm.nih.gov/9744865" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03063-1", "protein_name": "Down-regulator of invasive growth 1", "gene_name": "DIG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03373-1", "protein_name": "Down-regulator of invasive growth 2", "gene_name": "DIG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P14681-1", "protein_name": "Mitogen-activated protein kinase KSS1", "gene_name": "KSS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03063", "url": "https://www.uniprot.org/uniprotkb/Q03063" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9744865", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential regulation of transcription: repression by unactivated mitogen-activated protein kinase Kss1 requires the Dig1 and Dig2 proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998-12-22", "authors": "Bardwell L, Cook J G, Zhu-Shimoni J X, Voora D, Thorner J", "reference": { "type": "PubMed", "id": "9860980", "url": "https://pubmed.ncbi.nlm.nih.gov/9860980" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03063-1", "protein_name": "Down-regulator of invasive growth 1", "gene_name": "DIG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03373-1", "protein_name": "Down-regulator of invasive growth 2", "gene_name": "DIG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P14681-1", "protein_name": "Mitogen-activated protein kinase KSS1", "gene_name": "KSS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03063", "url": "https://www.uniprot.org/uniprotkb/Q03063" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9860980", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The VPS16 gene product associates with a sedimentable protein complex and is essential for vacuolar protein sorting in yeast.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Horazdovsky B F, Emr S D", "reference": { "type": "PubMed", "id": "8444873", "url": "https://pubmed.ncbi.nlm.nih.gov/8444873" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03308-1", "protein_name": "Vacuolar protein sorting-associated protein 16", "gene_name": "VPS16", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03308", "url": "https://www.uniprot.org/uniprotkb/Q03308" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8444873", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Strategies to regulate transcription factor-mediated gene positioning and interchromosomal clustering at the nuclear periphery.", "journal": "The Journal of cell biology", "date": "2016-03-14", "authors": "Randise-Hinchliff Carlo, Coukos Robert, Sood Varun, Sumner Michael Chas, Zdraljevic Stefan, Meldi Sholl Lauren, Garvey Brickner Donna, Ahmed Sara, Watchmaker Lauren, Brickner Jason H", "reference": { "type": "PubMed", "id": "26953353", "url": "https://pubmed.ncbi.nlm.nih.gov/26953353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03373-1", "protein_name": "Down-regulator of invasive growth 2", "gene_name": "DIG2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03373", "url": "https://www.uniprot.org/uniprotkb/Q03373" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q03373", "url": "https://www.uniprot.org/uniprotkb/Q03373" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "iPTMnet", "id": "Q03373", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03373" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "26953353", "url": "https://pubmed.ncbi.nlm.nih.gov/26953353" }, { "database": "SGD", "id": "S000002888", "url": "https://www.yeastgenome.org/locus/S000002888" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser34", "uniprot_canonical_ac": "Q03373-1" } ], "record_id": "pubmed.26953353", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Accurate quantitation of protein expression and site-specific phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999-06-08", "authors": "Oda Y, Huang K, Cross F R, Cowburn D, Chait B T", "reference": { "type": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03497-1", "protein_name": "Serine/threonine-protein kinase STE20", "gene_name": "STE20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 418, "end_pos": 418, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" }, { "database": "PubMed", "id": "16428446", "url": "https://pubmed.ncbi.nlm.nih.gov/16428446" }, { "database": "iPTMnet", "id": "Q03497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03497" }, { "database": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "SGD", "id": "S000000999", "url": "https://www.yeastgenome.org/locus/S000000999" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser418", "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 502, "end_pos": 502, "kinase_uniprot_canonical_ac": "P00546-1", "kinase_gene_name": "CDC28", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03497" }, { "database": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" } ], "site_lbl": "Ser502", "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 502, "end_pos": 502, "kinase_uniprot_canonical_ac": "P24869-1", "kinase_gene_name": "CLB2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03497" }, { "database": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" } ], "site_lbl": "Ser502", "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 547, "end_pos": 547, "kinase_uniprot_canonical_ac": "P00546-1", "kinase_gene_name": "CDC28", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03497" }, { "database": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser547", "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 547, "end_pos": 547, "kinase_uniprot_canonical_ac": "P20438-1", "kinase_gene_name": "CLN2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03497" }, { "database": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser547", "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 547, "end_pos": 547, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" }, { "database": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000000999", "url": "https://www.yeastgenome.org/locus/S000000999" }, { "database": "iPTMnet", "id": "Q03497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03497" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser547", "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 562, "end_pos": 562, "kinase_uniprot_canonical_ac": "P00546-1", "kinase_gene_name": "CDC28", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03497" }, { "database": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser562", "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 562, "end_pos": 562, "kinase_uniprot_canonical_ac": "P20438-1", "kinase_gene_name": "CLN2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03497" }, { "database": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser562", "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 562, "end_pos": 562, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "SGD", "id": "S000000999", "url": "https://www.yeastgenome.org/locus/S000000999" }, { "database": "iPTMnet", "id": "Q03497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03497" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser562", "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 573, "end_pos": 573, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" }, { "database": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, { "database": "iPTMnet", "id": "Q03497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03497" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000000999", "url": "https://www.yeastgenome.org/locus/S000000999" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr573", "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 585, "end_pos": 585, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, { "database": "PubMed", "id": "16428446", "url": "https://pubmed.ncbi.nlm.nih.gov/16428446" }, { "database": "iPTMnet", "id": "Q03497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03497" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000000999", "url": "https://www.yeastgenome.org/locus/S000000999" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser585", "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 773, "end_pos": 773, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" }, { "database": "PubMed", "id": "10359756", "url": "https://pubmed.ncbi.nlm.nih.gov/10359756" }, { "database": "iPTMnet", "id": "Q03497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03497" } ], "site_lbl": "Thr773", "uniprot_canonical_ac": "Q03497-1" } ], "record_id": "pubmed.10359756", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PAK-family kinases regulate cell and actin polarization throughout the cell cycle of Saccharomyces cerevisiae.", "journal": "The Journal of cell biology", "date": "1999-11-15", "authors": "Holly S P, Blumer K J", "reference": { "type": "PubMed", "id": "10562285", "url": "https://pubmed.ncbi.nlm.nih.gov/10562285" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03497-1", "protein_name": "Serine/threonine-protein kinase STE20", "gene_name": "STE20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10562285", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast Cdc42 GTPase and Ste20 PAK-like kinase regulate Sho1-dependent activation of the Hog1 MAPK pathway.", "journal": "The EMBO journal", "date": "2000-09-01", "authors": "Raitt D C, Posas F, Saito H", "reference": { "type": "PubMed", "id": "10970855", "url": "https://pubmed.ncbi.nlm.nih.gov/10970855" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03497-1", "protein_name": "Serine/threonine-protein kinase STE20", "gene_name": "STE20", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P08018-1", "protein_name": "MAP kinase kinase PBS2", "gene_name": "PBS2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32485-1", "protein_name": "Mitogen-activated protein kinase HOG1", "gene_name": "HOG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40073-1", "protein_name": "High osmolarity signaling protein SHO1", "gene_name": "SHO1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10970855", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of Cdc42p in pheromone-stimulated signal transduction in Saccharomyces cerevisiae.", "journal": "Molecular and cellular biology", "date": "2000-10", "authors": "Moskow J J, Gladfelter A S, Lamson R E, Pryciak P M, Lew D J", "reference": { "type": "PubMed", "id": "11003652", "url": "https://pubmed.ncbi.nlm.nih.gov/11003652" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03497-1", "protein_name": "Serine/threonine-protein kinase STE20", "gene_name": "STE20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11003652", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Saccharomyces cerevisiae cdc42p GTPase is involved in preventing the recurrence of bud emergence during the cell cycle.", "journal": "Mol. Cell. Biol.", "date": "2000", "authors": "Richman T J, Johnson D I", "reference": { "type": "PubMed", "id": "11046150", "url": "https://pubmed.ncbi.nlm.nih.gov/11046150" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03497-1", "protein_name": "Serine/threonine-protein kinase STE20", "gene_name": "STE20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11046150", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cdc42 regulation of kinase activity and signaling by the yeast p21-activated kinase Ste20.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Lamson RE, Winters MJ, Pryciak PM", "reference": { "type": "PubMed", "id": "11940652", "url": "https://pubmed.ncbi.nlm.nih.gov/11940652" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03497-1", "protein_name": "Serine/threonine-protein kinase STE20", "gene_name": "STE20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 338, "end_pos": 338, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces interaction with CDC42.", "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" }, { "database": "PubMed", "id": "11940652", "url": "https://pubmed.ncbi.nlm.nih.gov/11940652" } ], "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 345, "end_pos": 345, "sequence_org": "H", "sequence_mut": "A", "comment": "Reduces interaction with CDC42.", "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" }, { "database": "PubMed", "id": "12586692", "url": "https://pubmed.ncbi.nlm.nih.gov/12586692" }, { "database": "PubMed", "id": "11940652", "url": "https://pubmed.ncbi.nlm.nih.gov/11940652" } ], "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 345, "end_pos": 345, "sequence_org": "H", "sequence_mut": "D", "comment": "Reduces interaction with CDC42.", "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" }, { "database": "PubMed", "id": "12586692", "url": "https://pubmed.ncbi.nlm.nih.gov/12586692" }, { "database": "PubMed", "id": "11940652", "url": "https://pubmed.ncbi.nlm.nih.gov/11940652" } ], "uniprot_canonical_ac": "Q03497-1" } ], "record_id": "pubmed.11940652", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GTPase-activating proteins for Cdc42.", "journal": "Eukaryot. Cell", "date": "2002", "authors": "Smith Gregory R, Givan Scott A, Cullen Paul, Sprague George F", "reference": { "type": "PubMed", "id": "12455995", "url": "https://pubmed.ncbi.nlm.nih.gov/12455995" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03497-1", "protein_name": "Serine/threonine-protein kinase STE20", "gene_name": "STE20", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06407-1", "protein_name": "Rho-type GTPase-activating protein 2", "gene_name": "RGA2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12455995", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic analysis of the interface between Cdc42p and the CRIB domain of Ste20p in Saccharomyces cerevisiae.", "journal": "Genetics", "date": "2003-01", "authors": "Ash Jos\u00e9e, Wu Cunle, Larocque Robert, Jamal Maleek, Stevens Willem, Osborne Mike, Thomas David Y, Whiteway Malcolm", "reference": { "type": "PubMed", "id": "12586692", "url": "https://pubmed.ncbi.nlm.nih.gov/12586692" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03497-1", "protein_name": "Serine/threonine-protein kinase STE20", "gene_name": "STE20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 345, "end_pos": 345, "sequence_org": "H", "sequence_mut": "A", "comment": "Reduces interaction with CDC42.", "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" }, { "database": "PubMed", "id": "12586692", "url": "https://pubmed.ncbi.nlm.nih.gov/12586692" }, { "database": "PubMed", "id": "11940652", "url": "https://pubmed.ncbi.nlm.nih.gov/11940652" } ], "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 345, "end_pos": 345, "sequence_org": "H", "sequence_mut": "D", "comment": "Reduces interaction with CDC42.", "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" }, { "database": "PubMed", "id": "12586692", "url": "https://pubmed.ncbi.nlm.nih.gov/12586692" }, { "database": "PubMed", "id": "11940652", "url": "https://pubmed.ncbi.nlm.nih.gov/11940652" } ], "uniprot_canonical_ac": "Q03497-1" }, { "start_pos": 348, "end_pos": 348, "sequence_org": "H", "sequence_mut": "D", "comment": "Reduces interaction with CDC42.", "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" }, { "database": "PubMed", "id": "12586692", "url": "https://pubmed.ncbi.nlm.nih.gov/12586692" } ], "uniprot_canonical_ac": "Q03497-1" } ], "record_id": "pubmed.12586692", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of p21-activated kinase specificity determinants in budding yeast: a single amino acid substitution imparts Ste20 specificity to Cla4.", "journal": "Molecular and cellular biology", "date": "2003-03", "authors": "Keniry Megan E, Sprague George F", "reference": { "type": "PubMed", "id": "12588977", "url": "https://pubmed.ncbi.nlm.nih.gov/12588977" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03497-1", "protein_name": "Serine/threonine-protein kinase STE20", "gene_name": "STE20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12588977", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Synthetic lethal analysis implicates Ste20p, a p21-activated potein kinase, in polarisome activation.", "journal": "Molecular biology of the cell", "date": "2003-04", "authors": "Goehring April S, Mitchell David A, Tong Amy Hin Yan, Keniry Megan E, Boone Charles, Sprague George F", "reference": { "type": "PubMed", "id": "12686605", "url": "https://pubmed.ncbi.nlm.nih.gov/12686605" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03497-1", "protein_name": "Serine/threonine-protein kinase STE20", "gene_name": "STE20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12686605", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The protein kinase homologue Ste20p is required to link the yeast pheromone response G-protein beta gamma subunits to downstream signalling components.", "journal": "The EMBO journal", "date": "1992-12", "authors": "Leberer E, Dignard D, Harcus D, Thomas D Y, Whiteway M", "reference": { "type": "PubMed", "id": "1464311", "url": "https://pubmed.ncbi.nlm.nih.gov/1464311" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03497-1", "protein_name": "Serine/threonine-protein kinase STE20", "gene_name": "STE20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03497", "url": "https://www.uniprot.org/uniprotkb/Q03497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1464311", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]