[ { "title": "Incomplete penetrance of familial retinoblastoma linked to germ-line mutations that result in partial loss of RB function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Otterson GA, Chen Wd, Coxon AB, Khleif SN, Kaye FJ", "reference": { "type": "PubMed", "id": "9342358", "url": "https://pubmed.ncbi.nlm.nih.gov/9342358" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9342358", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional inactivation of the retinoblastoma protein requires sequential modification by at least two distinct cyclin-cdk complexes.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Lundberg AS, Weinberg RA", "reference": { "type": "PubMed", "id": "9447971", "url": "https://pubmed.ncbi.nlm.nih.gov/9447971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30304-1", "protein_name": "M-phase inducer phosphatase 1", "gene_name": "CDC25A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9447971", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 47 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a substrate-targeting domain in cyclin E necessary for phosphorylation of the retinoblastoma protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Kelly BL, Wolfe KG, Roberts JM", "reference": { "type": "PubMed", "id": "9482921", "url": "https://pubmed.ncbi.nlm.nih.gov/9482921" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y243-1", "protein_name": "RAC-gamma serine/threonine-protein kinase", "gene_name": "AKT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30291-1", "protein_name": "Wee1-like protein kinase", "gene_name": "WEE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31751-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "AKT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDN4-1", "protein_name": "CDK5 and ABL1 enzyme substrate 1", "gene_name": "CABLES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30304-1", "protein_name": "M-phase inducer phosphatase 1", "gene_name": "CDC25A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9482921", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the retinoblastoma tumour-suppressor pocket domain bound to a peptide from HPV E7.", "journal": "Nature", "date": "1998", "authors": "Lee J O, Russo A A, Pavletich N P", "reference": { "type": "PubMed", "id": "9495340", "url": "https://pubmed.ncbi.nlm.nih.gov/9495340" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9495340", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A requirement for cyclin D3-cyclin-dependent kinase (cdk)-4 assembly in the cyclic adenosine monophosphate-dependent proliferation of thyrocytes.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Depoortere F, Van Keymeulen A, Lukas J, Costagliola S, Bartkova J, Dumont JE, Bartek J, Roger PP, Dremier S", "reference": { "type": "PubMed", "id": "9508775", "url": "https://pubmed.ncbi.nlm.nih.gov/9508775" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9508775", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cdc6 is regulated by E2F and is essential for DNA replication in mammalian cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Yan Z, DeGregori J, Shohet R, Leone G, Stillman B, Nevins JR, Williams RS", "reference": { "type": "PubMed", "id": "9520412", "url": "https://pubmed.ncbi.nlm.nih.gov/9520412" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11388-1", "protein_name": "DNA topoisomerase 2-alpha", "gene_name": "TOP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H211-1", "protein_name": "DNA replication factor Cdt1", "gene_name": "CDT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78396-1", "protein_name": "Cyclin-A1", "gene_name": "CCNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75419-1", "protein_name": "Cell division control protein 45 homolog", "gene_name": "CDC45", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04183-1", "protein_name": "Thymidine kinase, cytosolic", "gene_name": "TK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00374-1", "protein_name": "Dihydrofolate reductase", "gene_name": "DHFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKT4-1", "protein_name": "F-box only protein 5", "gene_name": "FBXO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99741-1", "protein_name": "DNA replication factor CDC6", "gene_name": "CDC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04818-1", "protein_name": "Thymidylate synthase", "gene_name": "TYMS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30304-1", "protein_name": "M-phase inducer phosphatase 1", "gene_name": "CDC25A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9520412", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 41 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytoplasmic displacement of cyclin E-cdk2 inhibitors p21Cip1 and p27Kip1 in anchorage-independent cells.", "journal": "Oncogene", "date": "1998", "authors": "Orend G, Hunter T, Ruoslahti E", "reference": { "type": "PubMed", "id": "9632134", "url": "https://pubmed.ncbi.nlm.nih.gov/9632134" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y243-1", "protein_name": "RAC-gamma serine/threonine-protein kinase", "gene_name": "AKT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30291-1", "protein_name": "Wee1-like protein kinase", "gene_name": "WEE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31751-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "AKT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDN4-1", "protein_name": "CDK5 and ABL1 enzyme substrate 1", "gene_name": "CABLES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30304-1", "protein_name": "M-phase inducer phosphatase 1", "gene_name": "CDC25A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9632134", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A new model of cell cycle-regulated transcription: repression of the cyclin A promoter by CDF-1 and anti-repression by E2F.", "journal": "Oncogene", "date": "1998", "authors": "Liu N, Lucibello FC, Engeland K, Muller R", "reference": { "type": "PubMed", "id": "9662327", "url": "https://pubmed.ncbi.nlm.nih.gov/9662327" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H211-1", "protein_name": "DNA replication factor Cdt1", "gene_name": "CDT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78396-1", "protein_name": "Cyclin-A1", "gene_name": "CCNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75419-1", "protein_name": "Cell division control protein 45 homolog", "gene_name": "CDC45", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04183-1", "protein_name": "Thymidine kinase, cytosolic", "gene_name": "TK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00374-1", "protein_name": "Dihydrofolate reductase", "gene_name": "DHFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKT4-1", "protein_name": "F-box only protein 5", "gene_name": "FBXO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99741-1", "protein_name": "DNA replication factor CDC6", "gene_name": "CDC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04818-1", "protein_name": "Thymidylate synthase", "gene_name": "TYMS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9662327", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of cell growth-dependent expression of mammalian CDC6 gene by the cell cycle transcription factor E2F.", "journal": "Oncogene", "date": "1998", "authors": "Ohtani K, Tsujimoto A, Ikeda M, Nakamura M", "reference": { "type": "PubMed", "id": "9778043", "url": "https://pubmed.ncbi.nlm.nih.gov/9778043" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11388-1", "protein_name": "DNA topoisomerase 2-alpha", "gene_name": "TOP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H211-1", "protein_name": "DNA replication factor Cdt1", "gene_name": "CDT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78396-1", "protein_name": "Cyclin-A1", "gene_name": "CCNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75419-1", "protein_name": "Cell division control protein 45 homolog", "gene_name": "CDC45", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04183-1", "protein_name": "Thymidine kinase, cytosolic", "gene_name": "TK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00374-1", "protein_name": "Dihydrofolate reductase", "gene_name": "DHFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKT4-1", "protein_name": "F-box only protein 5", "gene_name": "FBXO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99741-1", "protein_name": "DNA replication factor CDC6", "gene_name": "CDC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04818-1", "protein_name": "Thymidylate synthase", "gene_name": "TYMS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30304-1", "protein_name": "M-phase inducer phosphatase 1", "gene_name": "CDC25A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9778043", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 41 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rb inhibits the intrinsic kinase activity of TATA-binding protein-associated factor TAFII250.", "journal": "Mol. Cell. Biol.", "date": "1999", "authors": "Siegert J L, Robbins P D", "reference": { "type": "PubMed", "id": "9858607", "url": "https://pubmed.ncbi.nlm.nih.gov/9858607" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21675-2", "protein_name": "Transcription initiation factor TFIID subunit 1", "gene_name": "TAF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9858607", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retinoblastoma protein contains a C-terminal motif that targets it for phosphorylation by cyclin-cdk complexes.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Adams PD, Li X, Sellers WR, Baker KB, Leng X, Harper JW, Taya Y, Kaelin WG Jr", "reference": { "type": "PubMed", "id": "9891042", "url": "https://pubmed.ncbi.nlm.nih.gov/9891042" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y243-1", "protein_name": "RAC-gamma serine/threonine-protein kinase", "gene_name": "AKT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30291-1", "protein_name": "Wee1-like protein kinase", "gene_name": "WEE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31751-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "AKT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDN4-1", "protein_name": "CDK5 and ABL1 enzyme substrate 1", "gene_name": "CABLES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30304-1", "protein_name": "M-phase inducer phosphatase 1", "gene_name": "CDC25A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9891042", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RB1 gene mutations in peripheral blood DNA of patients with isolated unilateral retinoblastoma.", "journal": "American journal of human genetics", "date": "1999", "authors": "Klutz M, Horsthemke B, Lohmann DR", "reference": { "type": "PubMed", "id": "9973307", "url": "https://pubmed.ncbi.nlm.nih.gov/9973307" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9973307", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of RHOXF2 (PEPP2) as a cancer-promoting gene by expression cloning.", "journal": "International journal of oncology", "date": "2012", "authors": "Shibata-Minoshima F, Oki T, Doki N, Nakahara F, Kageyama S, Kitaura J, Fukuoka J, Kitamura T", "reference": { "type": "PubMed", "id": "21874235", "url": "https://pubmed.ncbi.nlm.nih.gov/21874235" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BQY4-1", "protein_name": "Rhox homeobox family member 2", "gene_name": "RHOXF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BQY4", "url": "https://www.uniprot.org/uniprotkb/Q9BQY4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21874235", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemical footprinting and kinetic assays reveal dual functions for highly conserved eukaryotic tRNA(His) guanylyltransferase residues.", "journal": "The Journal of biological chemistry", "date": "2019", "authors": "Matlock AO, Smith BA, Jackman JE", "reference": { "type": "PubMed", "id": "31000629", "url": "https://pubmed.ncbi.nlm.nih.gov/31000629" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BQY4-1", "protein_name": "Rhox homeobox family member 2", "gene_name": "RHOXF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BQY4", "url": "https://www.uniprot.org/uniprotkb/Q9BQY4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31000629", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in SCNM1 cause orofaciodigital syndrome due to minor intron splicing defects affecting primary cilia.", "journal": "American journal of human genetics", "date": "2022-10-06", "authors": "Iturrate Asier, Rivera-Barahona Ana, Flores Carmen-Lisset, Otaify Ghada A, Elhossini Rasha, Perez-Sanz Marina L, Nevado Juli\u00e1n, Tenorio-Castano Jair, Trivi\u00f1o Juan Carlos, Garcia-Gonzalo Francesc R, Piceci-Sparascio Francesca, De Luca Alessandro, Mart\u00ednez Leopoldo, Kalayc\u0131 Tugba, Lapunzina Pablo, Altunoglu Umut, Aglan Mona, Abdalla Ebtesam, Ruiz-Perez Victor L", "reference": { "type": "PubMed", "id": "36084634", "url": "https://pubmed.ncbi.nlm.nih.gov/36084634" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BWG6-1", "protein_name": "Sodium channel modifier 1", "gene_name": "SCNM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BWG6", "url": "https://www.uniprot.org/uniprotkb/Q9BWG6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36084634", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human BAHD1 promotes heterochromatic gene silencing.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Bierne H, Tham TN, Batsche E, Dumay A, Leguillou M, Kerneis-Golsteyn S, Regnault B, Seeler JS, Muchardt C, Feunteun J, Cossart P", "reference": { "type": "PubMed", "id": "19666599", "url": "https://pubmed.ncbi.nlm.nih.gov/19666599" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TBE0-1", "protein_name": "Bromo adjacent homology domain-containing 1 protein", "gene_name": "BAHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQL6-1", "protein_name": "Histone deacetylase 5", "gene_name": "HDAC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIS9-1", "protein_name": "Methyl-CpG-binding domain protein 1", "gene_name": "MBD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08047-1", "protein_name": "Transcription factor Sp1", "gene_name": "SP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TBE0", "url": "https://www.uniprot.org/uniprotkb/Q8TBE0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19666599", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A bacterial protein targets the BAHD1 chromatin complex to stimulate type III interferon response.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Lebreton A, Lakisic G, Job V, Fritsch L, Tham TN, Camejo A, Mattei PJ, Regnault B, Nahori MA, Cabanes D, Gautreau A, Ait-Si-Ali S, Dessen A, Cossart P, Bierne H", "reference": { "type": "PubMed", "id": "21252314", "url": "https://pubmed.ncbi.nlm.nih.gov/21252314" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TBE0-1", "protein_name": "Bromo adjacent homology domain-containing 1 protein", "gene_name": "BAHD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TBE0", "url": "https://www.uniprot.org/uniprotkb/Q8TBE0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21252314", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for the inhibition of the chromatin repressor BAHD1 by the bacterial nucleomodulin LntA.", "journal": "mBio", "date": "2014", "authors": "Lebreton A, Job V, Ragon M, Le Monnier A, Dessen A, Cossart P, Bierne H", "reference": { "type": "PubMed", "id": "24449750", "url": "https://pubmed.ncbi.nlm.nih.gov/24449750" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TBE0-1", "protein_name": "Bromo adjacent homology domain-containing 1 protein", "gene_name": "BAHD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TBE0", "url": "https://www.uniprot.org/uniprotkb/Q8TBE0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24449750", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Computational Prediction and Validation of BAHD1 as a Novel Molecule for Ulcerative Colitis.", "journal": "Scientific reports", "date": "2015", "authors": "Zhu H, Wan X, Li J, Han L, Bo X, Chen W, Lu C, Shen Z, Xu C, Chen L, Yu C, Xu G", "reference": { "type": "PubMed", "id": "26183847", "url": "https://pubmed.ncbi.nlm.nih.gov/26183847" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TBE0-1", "protein_name": "Bromo adjacent homology domain-containing 1 protein", "gene_name": "BAHD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TBE0", "url": "https://www.uniprot.org/uniprotkb/Q8TBE0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26183847", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAHD1 haploinsufficiency results in anxiety-like phenotypes in male mice.", "journal": "PloS one", "date": "2020", "authors": "Pourpre R, Naudon L, Meziane H, Lakisic G, Jouneau L, Varet H, Legendre R, Wendling O, Selloum M, Proux C, Coppee JY, Herault Y, Bierne H", "reference": { "type": "PubMed", "id": "32407325", "url": "https://pubmed.ncbi.nlm.nih.gov/32407325" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TBE0-1", "protein_name": "Bromo adjacent homology domain-containing 1 protein", "gene_name": "BAHD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TBE0", "url": "https://www.uniprot.org/uniprotkb/Q8TBE0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32407325", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FBXO11-mediated proteolysis of BAHD1 relieves PRC2-dependent transcriptional repression in erythropoiesis.", "journal": "Blood", "date": "2021", "authors": "Xu P, Scott DC, Xu B, Yao Y, Feng R, Cheng L, Mayberry K, Wang YD, Bi W, Palmer LE, King MT, Wang H, Li Y, Fan Y, Alpi AF, Li C, Peng J, Papizan J, Pruett-Miller SM, Spallek R, Bassermann F, Cheng Y, Schulman BA, Weiss MJ", "reference": { "type": "PubMed", "id": "33156908", "url": "https://pubmed.ncbi.nlm.nih.gov/33156908" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TBE0-1", "protein_name": "Bromo adjacent homology domain-containing 1 protein", "gene_name": "BAHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86XK2-1", "protein_name": "F-box only protein 11", "gene_name": "FBXO11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TBE0", "url": "https://www.uniprot.org/uniprotkb/Q8TBE0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33156908", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A conserved BAH module within mammalian BAHD1 connects H3K27me3 to Polycomb gene silencing.", "journal": "Nucleic acids research", "date": "2021", "authors": "Fan H, Guo Y, Tsai YH, Storey AJ, Kim A, Gong W, Edmondson RD, Mackintosh SG, Li H, Byrum SD, Tackett AJ, Cai L, Wang GG", "reference": { "type": "PubMed", "id": "33823544", "url": "https://pubmed.ncbi.nlm.nih.gov/33823544" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TBE0-1", "protein_name": "Bromo adjacent homology domain-containing 1 protein", "gene_name": "BAHD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TBE0", "url": "https://www.uniprot.org/uniprotkb/Q8TBE0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33823544", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAHD1 serves as a critical regulator of breast cancer cell proliferation and invasion.", "journal": "Breast cancer (Tokyo, Japan)", "date": "2022", "authors": "Yang ZY, Yin SP, Ren Q, Lu DW, Tang T, Li Y, Sun YZ, Mo HB, Yin TJ, Yi ZY, Zhu JP, Zhang F, Chen H", "reference": { "type": "PubMed", "id": "35048286", "url": "https://pubmed.ncbi.nlm.nih.gov/35048286" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TBE0-1", "protein_name": "Bromo adjacent homology domain-containing 1 protein", "gene_name": "BAHD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TBE0", "url": "https://www.uniprot.org/uniprotkb/Q8TBE0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35048286", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HCC-associated protein HCAP1, a variant of GEMIN4, interacts with zinc-finger proteins.", "journal": "J. Biochem.", "date": "2003", "authors": "Di Yujun, Li Jinjun, Zhang Yu, He Xianghuo, Lu Hong, Xu Dongbin, Ling Jiqiang, Huo Keke, Wan Dafang, Li Yu-Yang, Gu Jianren", "reference": { "type": "PubMed", "id": "12869526", "url": "https://pubmed.ncbi.nlm.nih.gov/12869526" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12869526", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Formation of nuclear foci of the herpes simplex virus type 1 regulatory protein ICP4 at early times of infection: localization, dynamics, recruitment of ICP27, and evidence for the de novo induction of ND10-like complexes.", "journal": "Journal of virology", "date": "2004", "authors": "Everett RD, Sourvinos G, Leiper C, Clements JB, Orr A", "reference": { "type": "PubMed", "id": "14747555", "url": "https://pubmed.ncbi.nlm.nih.gov/14747555" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14747555", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "T6BP and NDP52 are myosin VI binding partners with potential roles in cytokine signalling and cell adhesion.", "journal": "Journal of cell science", "date": "2007", "authors": "Morriswood B, Ryzhakov G, Puri C, Arden SD, Roberts R, Dendrou C, Kendrick-Jones J, Buss F", "reference": { "type": "PubMed", "id": "17635994", "url": "https://pubmed.ncbi.nlm.nih.gov/17635994" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 400, "end_pos": 400, "sequence_org": "C", "sequence_mut": "A", "comment": "Does not affect interaction with MYO6.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "17635994", "url": "https://pubmed.ncbi.nlm.nih.gov/17635994" } ], "uniprot_canonical_ac": "Q13137-1" }, { "start_pos": 425, "end_pos": 425, "sequence_org": "C", "sequence_mut": "A", "comment": "Fails interact with MYO6 and to promote maturation of autophagosomes.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "25771791", "url": "https://pubmed.ncbi.nlm.nih.gov/25771791" }, { "database": "PubMed", "id": "17635994", "url": "https://pubmed.ncbi.nlm.nih.gov/17635994" } ], "uniprot_canonical_ac": "Q13137-1" } ], "record_id": "pubmed.17635994", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Galectin 8 targets damaged vesicles for autophagy to defend cells against bacterial invasion.", "journal": "Nature", "date": "2012", "authors": "Thurston TL, Wandel MP, von Muhlinen N, Foeglein A, Randow F", "reference": { "type": "PubMed", "id": "22246324", "url": "https://pubmed.ncbi.nlm.nih.gov/22246324" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00214-1", "protein_name": "Galectin-8", "gene_name": "LGALS8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 190, "end_pos": 190, "sequence_org": "R", "sequence_mut": "H", "comment": "Does not affect localization to cytoplasmic vesicles in case of infection by S.typhimurium.", "evidence": [ { "database": "UniProtKB", "id": "O00214", "url": "https://www.uniprot.org/uniprotkb/O00214" }, { "database": "PubMed", "id": "22246324", "url": "https://pubmed.ncbi.nlm.nih.gov/22246324" } ], "uniprot_canonical_ac": "O00214-1" }, { "start_pos": 69, "end_pos": 69, "sequence_org": "R", "sequence_mut": "H", "comment": "Abolishes localization to cytoplasmic vesicles in case of infection by S.typhimurium.", "evidence": [ { "database": "UniProtKB", "id": "O00214", "url": "https://www.uniprot.org/uniprotkb/O00214" }, { "database": "PubMed", "id": "22246324", "url": "https://pubmed.ncbi.nlm.nih.gov/22246324" } ], "uniprot_canonical_ac": "O00214-1" } ], "record_id": "pubmed.22246324", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LC3C, bound selectively by a noncanonical LIR motif in NDP52, is required for antibacterial autophagy.", "journal": "Molecular cell", "date": "2012", "authors": "von Muhlinen N, Akutsu M, Ravenhill BJ, Foeglein A, Bloor S, Rutherford TJ, Freund SM, Komander D, Randow F", "reference": { "type": "PubMed", "id": "23022382", "url": "https://pubmed.ncbi.nlm.nih.gov/23022382" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXW4-1", "protein_name": "Microtubule-associated protein 1 light chain 3 gamma", "gene_name": "MAP1LC3C", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 136, "end_pos": 136, "sequence_org": "V", "sequence_mut": "S", "comment": "Abrogates the interaction with MAP1LC3C.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "23022382", "url": "https://pubmed.ncbi.nlm.nih.gov/23022382" } ], "uniprot_canonical_ac": "Q13137-1" } ], "record_id": "pubmed.23022382", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sterical hindrance promotes selectivity of the autophagy cargo receptor NDP52 for the danger receptor galectin-8 in antibacterial autophagy.", "journal": "Science signaling", "date": "2013", "authors": "Li S, Wandel MP, Li F, Liu Z, He C, Wu J, Shi Y, Randow F", "reference": { "type": "PubMed", "id": "23386746", "url": "https://pubmed.ncbi.nlm.nih.gov/23386746" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00214-1", "protein_name": "Galectin-8", "gene_name": "LGALS8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 374, "end_pos": 374, "sequence_org": "L", "sequence_mut": "A", "comment": "Severely reduces affinity for LGALS8.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "23386746", "url": "https://pubmed.ncbi.nlm.nih.gov/23386746" }, { "database": "PubMed", "id": "23511477", "url": "https://pubmed.ncbi.nlm.nih.gov/23511477" } ], "uniprot_canonical_ac": "Q13137-1" }, { "start_pos": 376, "end_pos": 376, "sequence_org": "Y", "sequence_mut": "A", "comment": "Severely reduces affinity for LGALS8.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "23386746", "url": "https://pubmed.ncbi.nlm.nih.gov/23386746" } ], "uniprot_canonical_ac": "Q13137-1" }, { "start_pos": 378, "end_pos": 378, "sequence_org": "N", "sequence_mut": "A", "comment": "Prevents interaction with LGALS8.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "23386746", "url": "https://pubmed.ncbi.nlm.nih.gov/23386746" } ], "uniprot_canonical_ac": "Q13137-1" }, { "start_pos": 380, "end_pos": 380, "sequence_org": "Y", "sequence_mut": "A", "comment": "Severely reduced affinity for LGALS8.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "23386746", "url": "https://pubmed.ncbi.nlm.nih.gov/23386746" }, { "database": "PubMed", "id": "23511477", "url": "https://pubmed.ncbi.nlm.nih.gov/23511477" } ], "uniprot_canonical_ac": "Q13137-1" }, { "start_pos": 380, "end_pos": 380, "sequence_org": "Y", "sequence_mut": "F", "comment": "Severely reduced affinity for LGALS8.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "23386746", "url": "https://pubmed.ncbi.nlm.nih.gov/23386746" }, { "database": "PubMed", "id": "23511477", "url": "https://pubmed.ncbi.nlm.nih.gov/23511477" } ], "uniprot_canonical_ac": "Q13137-1" } ], "record_id": "pubmed.23386746", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for recognition of autophagic receptor NDP52 by the sugar receptor galectin-8.", "journal": "Nature communications", "date": "2013", "authors": "Kim BW, Hong SB, Kim JH, Kwon DH, Song HK", "reference": { "type": "PubMed", "id": "23511477", "url": "https://pubmed.ncbi.nlm.nih.gov/23511477" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00214-1", "protein_name": "Galectin-8", "gene_name": "LGALS8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 374, "end_pos": 374, "sequence_org": "L", "sequence_mut": "A", "comment": "Severely reduces affinity for LGALS8.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "23386746", "url": "https://pubmed.ncbi.nlm.nih.gov/23386746" }, { "database": "PubMed", "id": "23511477", "url": "https://pubmed.ncbi.nlm.nih.gov/23511477" } ], "uniprot_canonical_ac": "Q13137-1" }, { "start_pos": 380, "end_pos": 380, "sequence_org": "Y", "sequence_mut": "A", "comment": "Severely reduced affinity for LGALS8.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "23386746", "url": "https://pubmed.ncbi.nlm.nih.gov/23386746" }, { "database": "PubMed", "id": "23511477", "url": "https://pubmed.ncbi.nlm.nih.gov/23511477" } ], "uniprot_canonical_ac": "Q13137-1" }, { "start_pos": 380, "end_pos": 380, "sequence_org": "Y", "sequence_mut": "F", "comment": "Severely reduced affinity for LGALS8.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "23386746", "url": "https://pubmed.ncbi.nlm.nih.gov/23386746" }, { "database": "PubMed", "id": "23511477", "url": "https://pubmed.ncbi.nlm.nih.gov/23511477" } ], "uniprot_canonical_ac": "Q13137-1" } ], "record_id": "pubmed.23511477", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The globally disseminated M1T1 clone of group A Streptococcus evades autophagy for intracellular replication.", "journal": "Cell host & microbe", "date": "2013", "authors": "Barnett TC, Liebl D, Seymour LM, Gillen CM, Lim JY, Larock CN, Davies MR, Schulz BL, Nizet V, Teasdale RD, Walker MJ", "reference": { "type": "PubMed", "id": "24331465", "url": "https://pubmed.ncbi.nlm.nih.gov/24331465" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14596-1", "protein_name": "Next to BRCA1 gene 1 protein", "gene_name": "NBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13501-1", "protein_name": "Sequestosome-1", "gene_name": "SQSTM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24331465", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autophagy receptor NDP52 regulates pathogen-containing autophagosome maturation.", "journal": "Cell host & microbe", "date": "2015", "authors": "Verlhac P, Gregoire IP, Azocar O, Petkova DS, Baguet J, Viret C, Faure M", "reference": { "type": "PubMed", "id": "25771791", "url": "https://pubmed.ncbi.nlm.nih.gov/25771791" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 203, "end_pos": 206, "sequence_org": "DYWE", "sequence_mut": "AAAA", "comment": "Abrogates interaction with MAPLC3A, MAPLC3B and GABARAPL2.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "25771791", "url": "https://pubmed.ncbi.nlm.nih.gov/25771791" } ], "uniprot_canonical_ac": "Q13137-1" }, { "start_pos": 425, "end_pos": 425, "sequence_org": "C", "sequence_mut": "A", "comment": "Fails interact with MYO6 and to promote maturation of autophagosomes.", "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" }, { "database": "PubMed", "id": "25771791", "url": "https://pubmed.ncbi.nlm.nih.gov/25771791" }, { "database": "PubMed", "id": "17635994", "url": "https://pubmed.ncbi.nlm.nih.gov/17635994" } ], "uniprot_canonical_ac": "Q13137-1" } ], "record_id": "pubmed.25771791", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanistic insights into the interactions of NAP1 with the SKICH domains of NDP52 and TAX1BP1.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2018", "authors": "Fu T, Liu J, Wang Y, Xie X, Hu S, Pan L", "reference": { "type": "PubMed", "id": "30459273", "url": "https://pubmed.ncbi.nlm.nih.gov/30459273" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6S1-1", "protein_name": "5-azacytidine-induced protein 2", "gene_name": "AZI2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30459273", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of Myosin VI/Tom1 complex reveals a cargo recognition mode of Myosin VI for tethering.", "journal": "Nat. Commun.", "date": "2019", "authors": "Hu Shichen, Guo Yujiao, Wang Yingli, Li Ying, Fu Tao, Zhou Zixuan, Wang Yaru, Liu Jianping, Pan Lifeng", "reference": { "type": "PubMed", "id": "31371777", "url": "https://pubmed.ncbi.nlm.nih.gov/31371777" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM54-3", "protein_name": "Unconventional myosin-VI", "gene_name": "MYO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60784-1", "protein_name": "Target of Myb1 membrane trafficking protein", "gene_name": "TOM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31371777", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NDP52 acts as a redox sensor in PINK1/Parkin-mediated mitophagy.", "journal": "The EMBO journal", "date": "2022-12-14", "authors": "Kataura Tetsushi, Otten Elsje G, Rabanal-Ruiz Yoana, Adriaenssens Elias, Urselli Francesca, Scialo Filippo, Fan Lanyu, Smith Graham R, Dawson William M, Chen Xingxiang, Yue Wyatt W, Bronowska Agnieszka K, Carroll Bernadette, Martens Sascha, Lazarou Michael, Korolchuk Viktor I", "reference": { "type": "PubMed", "id": "36514953", "url": "https://pubmed.ncbi.nlm.nih.gov/36514953" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36514953", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crotonylated BEX2 interacts with NDP52 and enhances mitophagy to modulate chemotherapeutic agent-induced apoptosis in non-small-cell lung cancer cells.", "journal": "Cell death & disease", "date": "2023-09-30", "authors": "Mu Ning, Wang Yu, Li Xiaopeng, Du Zhiyuan, Wu Yingdi, Su Min, Wang Yingying, Sun Xiaoyang, Su Ling, Liu Xiangguo", "reference": { "type": "PubMed", "id": "37777549", "url": "https://pubmed.ncbi.nlm.nih.gov/37777549" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY8-1", "protein_name": "Protein BEX2", "gene_name": "BEX2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37777549", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NDP52 SUMOylation contributes to low-dose X-rays-induced cardiac hypertrophy through PINK1/Parkin-mediated mitophagy via MUL1/SUMO2 signalling.", "journal": "Journal of cellular physiology", "date": "2024-01", "authors": "Gao Anbo, Wang Mengjie, Tang Xing, Shi Gangqing, Hou Kai, Fang Jinren, Zhou Linlin, Zhou Hong, Jiang Weimin, Li Yukun, Ouyang Fan", "reference": { "type": "PubMed", "id": "37942585", "url": "https://pubmed.ncbi.nlm.nih.gov/37942585" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37942585", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CALCOCO2/NDP52 associates with RAB9 to initiate an antiviral response to hepatitis B virus infection through a lysosomal degradation pathway.", "journal": "Autophagy", "date": "2024-09", "authors": "Cui Shuzhi, Faure Mathias, Wei Yu", "reference": { "type": "PubMed", "id": "38752371", "url": "https://pubmed.ncbi.nlm.nih.gov/38752371" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51151-1", "protein_name": "Ras-related protein Rab-9A", "gene_name": "RAB9A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38752371", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Vangl2 suppresses NF-\u03baB signaling and ameliorates sepsis by targeting p65 for NDP52-mediated autophagic degradation.", "journal": "eLife", "date": "2024-09-13", "authors": "Lu Jiansen, Zhang Jiahuan, Jiang Huaji, Hu Zhiqiang, Zhang Yufen, He Lian, Yang Jianwu, Xie Yingchao, Wu Dan, Li Hongyu, Zeng Ke, Tan Peng, Xiao Qingyue, Song Zijing, Pan Chenglong, Bai Xiaochun, Yu Xiao", "reference": { "type": "PubMed", "id": "39269442", "url": "https://pubmed.ncbi.nlm.nih.gov/39269442" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULK5-1", "protein_name": "Vang-like protein 2", "gene_name": "VANGL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2A6M5-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "Calcoco2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39269442", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of NDP52, a novel protein of the nuclear domain 10, which is redistributed upon virus infection and interferon treatment.", "journal": "J. Cell Biol.", "date": "1995", "authors": "Korioth F, Gieffers C, Maul GG, Frey J", "reference": { "type": "PubMed", "id": "7540613", "url": "https://pubmed.ncbi.nlm.nih.gov/7540613" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7540613", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cellular localization, expression, and structure of the nuclear dot protein 52.", "journal": "J. Cell Biol.", "date": "1997", "authors": "Sternsdorf T, Jensen K, Zuchner D, Will H", "reference": { "type": "PubMed", "id": "9230084", "url": "https://pubmed.ncbi.nlm.nih.gov/9230084" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13137-1", "protein_name": "Calcium-binding and coiled-coil domain-containing protein 2", "gene_name": "CALCOCO2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13137", "url": "https://www.uniprot.org/uniprotkb/Q13137" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9230084", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear import of sterol regulatory element-binding protein-2, a basic helix-loop-helix-leucine zipper (bHLH-Zip)-containing transcription factor, occurs through the direct interaction of importin beta with HLH-Zip.", "journal": "Molecular biology of the cell", "date": "1999", "authors": "Nagoshi E, Imamoto N, Sato R, Yoneda Y", "reference": { "type": "PubMed", "id": "10397761", "url": "https://pubmed.ncbi.nlm.nih.gov/10397761" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62826-1", "protein_name": "GTP-binding nuclear protein Ran", "gene_name": "RAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3U1N2-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "Srebf2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q12770-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43462-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14703-1", "protein_name": "Membrane-bound transcription factor site-1 protease", "gene_name": "MBTPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10397761", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autocatalytic processing of site-1 protease removes propeptide and permits cleavage of sterol regulatory element-binding proteins.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Espenshade PJ, Cheng D, Goldstein JL, Brown MS", "reference": { "type": "PubMed", "id": "10428864", "url": "https://pubmed.ncbi.nlm.nih.gov/10428864" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62826-1", "protein_name": "GTP-binding nuclear protein Ran", "gene_name": "RAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12770-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43462-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14703-1", "protein_name": "Membrane-bound transcription factor site-1 protease", "gene_name": "MBTPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10428864", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biosynthesis and enzymatic characterization of human SKI-1/S1P and the processing of its inhibitory prosegment.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Toure BB, Munzer JS, Basak A, Benjannet S, Rochemont J, Lazure C, Chretien M, Seidah NG", "reference": { "type": "PubMed", "id": "10644685", "url": "https://pubmed.ncbi.nlm.nih.gov/10644685" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62826-1", "protein_name": "GTP-binding nuclear protein Ran", "gene_name": "RAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12770-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43462-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14703-1", "protein_name": "Membrane-bound transcription factor site-1 protease", "gene_name": "MBTPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10644685", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Asparagine-proline sequence within membrane-spanning segment of SREBP triggers intramembrane cleavage by site-2 protease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Ye J, Dave UP, Grishin NV, Goldstein JL, Brown MS", "reference": { "type": "PubMed", "id": "10805775", "url": "https://pubmed.ncbi.nlm.nih.gov/10805775" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62826-1", "protein_name": "GTP-binding nuclear protein Ran", "gene_name": "RAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12770-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43462-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14703-1", "protein_name": "Membrane-bound transcription factor site-1 protease", "gene_name": "MBTPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 490, "end_pos": 491, "sequence_org": "LC", "sequence_mut": "NP", "comment": "Restores cleavage by S2P; when associated with F-495 and L-496. No effect on site of cleavage by S2P.", "evidence": [ { "database": "UniProtKB", "id": "Q12772", "url": "https://www.uniprot.org/uniprotkb/Q12772" }, { "database": "PubMed", "id": "10805775", "url": "https://pubmed.ncbi.nlm.nih.gov/10805775" } ], "uniprot_canonical_ac": "Q12772-1" }, { "start_pos": 495, "end_pos": 495, "sequence_org": "N", "sequence_mut": "F", "comment": "Reduced cleavage by S2P.", "evidence": [ { "database": "UniProtKB", "id": "Q12772", "url": "https://www.uniprot.org/uniprotkb/Q12772" }, { "database": "PubMed", "id": "10805775", "url": "https://pubmed.ncbi.nlm.nih.gov/10805775" } ], "uniprot_canonical_ac": "Q12772-1" }, { "start_pos": 495, "end_pos": 496, "sequence_org": "NP", "sequence_mut": "FL", "comment": "Loss of cleavage by S2P.", "evidence": [ { "database": "UniProtKB", "id": "Q12772", "url": "https://www.uniprot.org/uniprotkb/Q12772" }, { "database": "PubMed", "id": "10805775", "url": "https://pubmed.ncbi.nlm.nih.gov/10805775" } ], "uniprot_canonical_ac": "Q12772-1" }, { "start_pos": 496, "end_pos": 496, "sequence_org": "P", "sequence_mut": "L", "comment": "Reduced cleavage by S2P.", "evidence": [ { "database": "UniProtKB", "id": "Q12772", "url": "https://www.uniprot.org/uniprotkb/Q12772" }, { "database": "PubMed", "id": "10805775", "url": "https://pubmed.ncbi.nlm.nih.gov/10805775" } ], "uniprot_canonical_ac": "Q12772-1" } ], "record_id": "pubmed.10805775", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dimerization of sterol regulatory element-binding protein 2 via the helix-loop-helix-leucine zipper domain is a prerequisite for its nuclear localization mediated by importin beta.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Nagoshi E, Yoneda Y", "reference": { "type": "PubMed", "id": "11283257", "url": "https://pubmed.ncbi.nlm.nih.gov/11283257" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62826-1", "protein_name": "GTP-binding nuclear protein Ran", "gene_name": "RAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3U1N2-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "Srebf2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q12770-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43462-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14703-1", "protein_name": "Membrane-bound transcription factor site-1 protease", "gene_name": "MBTPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 369, "end_pos": 383, "sequence_org": "LQQVNHKLRQENMVL", "sequence_mut": "AQQVNHKARQENMVA", "comment": "In L1.2.3A mutant; reduced affinity for importin-beta.", "evidence": [ { "database": "UniProtKB", "id": "Q3U1N2", "url": "https://www.uniprot.org/uniprotkb/Q3U1N2" }, { "database": "PubMed", "id": "11283257", "url": "https://pubmed.ncbi.nlm.nih.gov/11283257" } ], "uniprot_canonical_ac": "Q3U1N2-1" } ], "record_id": "pubmed.11283257", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reduced expression of the insulin-induced protein 1 and p41 Arp2/3 complex genes in human gastric cancers.", "journal": "International journal of cancer", "date": "2002", "authors": "Kaneda A, Kaminishi M, Nakanishi Y, Sugimura T, Ushijima T", "reference": { "type": "PubMed", "id": "12115587", "url": "https://pubmed.ncbi.nlm.nih.gov/12115587" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12115587", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crucial step in cholesterol homeostasis: sterols promote binding of SCAP to INSIG-1, a membrane protein that facilitates retention of SREBPs in ER.", "journal": "Cell", "date": "2002", "authors": "Yang T, Espenshade PJ, Wright ME, Yabe D, Gong Y, Aebersold R, Goldstein JL, Brown MS", "reference": { "type": "PubMed", "id": "12202038", "url": "https://pubmed.ncbi.nlm.nih.gov/12202038" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36956-1", "protein_name": "Sterol regulatory element-binding protein 1", "gene_name": "SREBF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12202038", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Accelerated degradation of HMG CoA reductase mediated by binding of insig-1 to its sterol-sensing domain.", "journal": "Molecular cell", "date": "2003", "authors": "Sever N, Yang T, Brown MS, Goldstein JL, DeBose-Boyd RA", "reference": { "type": "PubMed", "id": "12535518", "url": "https://pubmed.ncbi.nlm.nih.gov/12535518" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12535518", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structure of importin-beta bound to SREBP-2: nuclear import of a transcription factor.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Lee SJ, Sekimoto T, Yamashita E, Nagoshi E, Nakagawa A, Imamoto N, Yoshimura M, Sakai H, Chong KT, Tsukihara T, Yoneda Y", "reference": { "type": "PubMed", "id": "14645851", "url": "https://pubmed.ncbi.nlm.nih.gov/14645851" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62826-1", "protein_name": "GTP-binding nuclear protein Ran", "gene_name": "RAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P70168-1", "protein_name": "Importin subunit beta-1", "gene_name": "Kpnb1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12770-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43462-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14703-1", "protein_name": "Membrane-bound transcription factor site-1 protease", "gene_name": "MBTPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14645851", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Membrane topology of human insig-1, a protein regulator of lipid synthesis.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Feramisco Jamison D, Goldstein Joseph L, Brown Michael S", "reference": { "type": "PubMed", "id": "14660594", "url": "https://pubmed.ncbi.nlm.nih.gov/14660594" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14660594", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation domains from both monomers contribute to transcriptional stimulation by sterol regulatory element-binding protein dimers.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Datta S, Osborne TF", "reference": { "type": "PubMed", "id": "15550381", "url": "https://pubmed.ncbi.nlm.nih.gov/15550381" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62826-1", "protein_name": "GTP-binding nuclear protein Ran", "gene_name": "RAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12770-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43462-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14703-1", "protein_name": "Membrane-bound transcription factor site-1 protease", "gene_name": "MBTPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15550381", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insig required for sterol-mediated inhibition of Scap/SREBP binding to COPII proteins in vitro.", "journal": "The Journal of biological chemistry", "date": "2005-07-15", "authors": "Sun Li-Ping, Li Lu, Goldstein Joseph L, Brown Michael S", "reference": { "type": "PubMed", "id": "15899885", "url": "https://pubmed.ncbi.nlm.nih.gov/15899885" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97260-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Chinese hamster" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 298, "end_pos": 298, "sequence_org": "Y", "sequence_mut": "C", "comment": "Loss of sterol-dependent ER retention due to loss of interaction with INSIG. Constitutive interaction with COPII coat and maturation of SREBF.", "evidence": [ { "database": "UniProtKB", "id": "P97260", "url": "https://www.uniprot.org/uniprotkb/P97260" }, { "database": "PubMed", "id": "15260976", "url": "https://pubmed.ncbi.nlm.nih.gov/15260976" }, { "database": "PubMed", "id": "12482938", "url": "https://pubmed.ncbi.nlm.nih.gov/12482938" }, { "database": "PubMed", "id": "15899885", "url": "https://pubmed.ncbi.nlm.nih.gov/15899885" }, { "database": "PubMed", "id": "10500160", "url": "https://pubmed.ncbi.nlm.nih.gov/10500160" } ], "uniprot_canonical_ac": "P97260-1" }, { "start_pos": 445, "end_pos": 446, "sequence_org": "RR", "sequence_mut": "AA", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P97260", "url": "https://www.uniprot.org/uniprotkb/P97260" }, { "database": "PubMed", "id": "15899885", "url": "https://pubmed.ncbi.nlm.nih.gov/15899885" } ], "uniprot_canonical_ac": "P97260-1" }, { "start_pos": 447, "end_pos": 448, "sequence_org": "ME", "sequence_mut": "AA", "comment": "Loss of SREBF maturation and interaction with COPII coat.", "evidence": [ { "database": "UniProtKB", "id": "P97260", "url": "https://www.uniprot.org/uniprotkb/P97260" }, { "database": "PubMed", "id": "15899885", "url": "https://pubmed.ncbi.nlm.nih.gov/15899885" } ], "uniprot_canonical_ac": "P97260-1" }, { "start_pos": 449, "end_pos": 449, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of SREBF maturation and interaction with COPII coat.", "evidence": [ { "database": "UniProtKB", "id": "P97260", "url": "https://www.uniprot.org/uniprotkb/P97260" }, { "database": "PubMed", "id": "15899885", "url": "https://pubmed.ncbi.nlm.nih.gov/15899885" } ], "uniprot_canonical_ac": "P97260-1" }, { "start_pos": 451, "end_pos": 452, "sequence_org": "DL", "sequence_mut": "AA", "comment": "Loss of SREBF maturation, interaction with COPII coat and recruitment into COPII-coated vesicles.", "evidence": [ { "database": "UniProtKB", "id": "P97260", "url": "https://www.uniprot.org/uniprotkb/P97260" }, { "database": "PubMed", "id": "15899885", "url": "https://pubmed.ncbi.nlm.nih.gov/15899885" } ], "uniprot_canonical_ac": "P97260-1" } ], "record_id": "pubmed.15899885", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two HLA-B14 subtypes (B*1402 and B*1403) differentially associated with ankylosing spondylitis differ substantially in peptide specificity but have limited peptide and T-cell epitope sharing with HLA-B27.", "journal": "The Journal of biological chemistry", "date": "2005-10-28", "authors": "Merino Elena, Montserrat Ver\u00f3nica, Paradela Alberto, L\u00f3pez de Castro Jos\u00e9 A", "reference": { "type": "PubMed", "id": "16115862", "url": "https://pubmed.ncbi.nlm.nih.gov/16115862" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15233-1", "protein_name": "Non-POU domain-containing octamer-binding protein", "gene_name": "NONO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14324-1", "protein_name": "Farnesyl pyrophosphate synthase", "gene_name": "FDPS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13588-1", "protein_name": "GRB2-related adapter protein", "gene_name": "GRAPL; GRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95169-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial", "gene_name": "NDUFB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10619-1", "protein_name": "Lysosomal protective protein", "gene_name": "CTSA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6W2J9-1", "protein_name": "BCL-6 corepressor", "gene_name": "BCOR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P265-1", "protein_name": "Disco-interacting protein 2 homolog B", "gene_name": "DIP2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13200-1", "protein_name": "26S proteasome non-ATPase regulatory subunit 2", "gene_name": "PSMD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY97-1", "protein_name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2", "gene_name": "B3GNT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43242-1", "protein_name": "26S proteasome non-ATPase regulatory subunit 3", "gene_name": "PSMD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAY7-1", "protein_name": "WD40 repeat-containing protein SMU1", "gene_name": "SMU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13098-4", "protein_name": "COP9 signalosome complex subunit 1", "gene_name": "GPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15027-1", "protein_name": "Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1", "gene_name": "ACAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68104-1", "protein_name": "Elongation factor 1-alpha 1", "gene_name": "EEF1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC16-1", "protein_name": "DNA dC->dU-editing enzyme APOBEC-3G", "gene_name": "APOBEC3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAQ9-1", "protein_name": "DDB1- and CUL4-associated factor 8", "gene_name": "DCAF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A5YKK6-1", "protein_name": "CCR4-NOT transcription complex subunit 1", "gene_name": "CNOT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTJ3-1", "protein_name": "Structural maintenance of chromosomes protein 4", "gene_name": "SMC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N9W6-1", "protein_name": "Protein boule-like", "gene_name": "BOLL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33076-1", "protein_name": "MHC class II transactivator", "gene_name": "CIITA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15382-1", "protein_name": "GTP-binding protein Rheb", "gene_name": "RHEB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41091-1", "protein_name": "Eukaryotic translation initiation factor 2 subunit 3", "gene_name": "EIF2S3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5E2-1", "protein_name": "Protocadherin beta-7", "gene_name": "PCDHB7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15155-1", "protein_name": "BOS complex subunit NOMO1", "gene_name": "NOMO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13564-1", "protein_name": "NEDD8-activating enzyme E1 regulatory subunit", "gene_name": "NAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UX7-1", "protein_name": "Fermitin family homolog 3", "gene_name": "FERMT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIQ6-1", "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "LNPEP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EN8-1", "protein_name": "Molybdenum cofactor sulfurase", "gene_name": "MOCOS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75083-1", "protein_name": "WD repeat-containing protein 1", "gene_name": "WDR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61978-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein K", "gene_name": "HNRNPK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16115862", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gp78, a membrane-anchored ubiquitin ligase, associates with Insig-1 and couples sterol-regulated ubiquitination to degradation of HMG CoA reductase.", "journal": "Molecular cell", "date": "2005", "authors": "Song BL, Sever N, DeBose-Boyd RA", "reference": { "type": "PubMed", "id": "16168377", "url": "https://pubmed.ncbi.nlm.nih.gov/16168377" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKV5-1", "protein_name": "E3 ubiquitin-protein ligase AMFR", "gene_name": "AMFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54727-1", "protein_name": "Lysine-specific demethylase RAD23B", "gene_name": "RAD23B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62191-1", "protein_name": "26S proteasome regulatory subunit 4", "gene_name": "PSMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04323-1", "protein_name": "UBX domain-containing protein 1", "gene_name": "UBXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUN8-1", "protein_name": "Derlin-1", "gene_name": "DERL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IV0-1", "protein_name": "Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase", "gene_name": "NGLY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55072-1", "protein_name": "Transitional endoplasmic reticulum ATPase", "gene_name": "VCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14697-1", "protein_name": "Neutral alpha-glucosidase AB", "gene_name": "GANAB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14314-1", "protein_name": "Glucosidase 2 subunit beta", "gene_name": "PRKCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14165-1", "protein_name": "Malectin", "gene_name": "MLEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13724-1", "protein_name": "Mannosyl-oligosaccharide glucosidase", "gene_name": "MOGS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFI3-1", "protein_name": "Cytosolic endo-beta-N-acetylglucosaminidase", "gene_name": "ENGASE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 356, "end_pos": 356, "sequence_org": "C", "sequence_mut": "A", "comment": "Decreased palmitoylation. No degradation of HMGCR.", "evidence": [ { "database": "UniProtKB", "id": "Q9UKV5", "url": "https://www.uniprot.org/uniprotkb/Q9UKV5" }, { "database": "PubMed", "id": "16168377", "url": "https://pubmed.ncbi.nlm.nih.gov/16168377" }, { "database": "PubMed", "id": "22728137", "url": "https://pubmed.ncbi.nlm.nih.gov/22728137" } ], "uniprot_canonical_ac": "Q9UKV5-1" }, { "start_pos": 251, "end_pos": 251, "sequence_org": "K", "sequence_mut": "Q", "comment": "Impairs ERAD degradation of HMGCR and does not inhibit interaction with RHBDD1; when associated with Q-524.", "evidence": [ { "database": "UniProtKB", "id": "P55072", "url": "https://www.uniprot.org/uniprotkb/P55072" }, { "database": "PubMed", "id": "16168377", "url": "https://pubmed.ncbi.nlm.nih.gov/16168377" }, { "database": "PubMed", "id": "22795130", "url": "https://pubmed.ncbi.nlm.nih.gov/22795130" } ], "uniprot_canonical_ac": "P55072-1" }, { "start_pos": 524, "end_pos": 524, "sequence_org": "K", "sequence_mut": "A", "comment": "Impairs catalytic activity of RNF19A toward SOD1 mutant. Does not inhibit interaction with RHBDD1; when associated with A-251.", "evidence": [ { "database": "UniProtKB", "id": "P55072", "url": "https://www.uniprot.org/uniprotkb/P55072" }, { "database": "PubMed", "id": "16168377", "url": "https://pubmed.ncbi.nlm.nih.gov/16168377" }, { "database": "PubMed", "id": "22795130", "url": "https://pubmed.ncbi.nlm.nih.gov/22795130" }, { "database": "PubMed", "id": "15456787", "url": "https://pubmed.ncbi.nlm.nih.gov/15456787" } ], "uniprot_canonical_ac": "P55072-1" }, { "start_pos": 524, "end_pos": 524, "sequence_org": "K", "sequence_mut": "Q", "comment": "Impairs ERAD degradation of HMGCR; when associated with Q-251.", "evidence": [ { "database": "UniProtKB", "id": "P55072", "url": "https://www.uniprot.org/uniprotkb/P55072" }, { "database": "PubMed", "id": "16168377", "url": "https://pubmed.ncbi.nlm.nih.gov/16168377" }, { "database": "PubMed", "id": "22795130", "url": "https://pubmed.ncbi.nlm.nih.gov/22795130" }, { "database": "PubMed", "id": "15456787", "url": "https://pubmed.ncbi.nlm.nih.gov/15456787" } ], "uniprot_canonical_ac": "P55072-1" } ], "record_id": "pubmed.16168377", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sterol-regulated ubiquitination and degradation of Insig-1 creates a convergent mechanism for feedback control of cholesterol synthesis and uptake.", "journal": "Cell metabolism", "date": "2006", "authors": "Gong Y, Lee JN, Lee PC, Goldstein JL, Brown MS, Ye J", "reference": { "type": "PubMed", "id": "16399501", "url": "https://pubmed.ncbi.nlm.nih.gov/16399501" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 156, "end_pos": 156, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of ubiquitination and degradation.", "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" }, { "database": "PubMed", "id": "16399501", "url": "https://pubmed.ncbi.nlm.nih.gov/16399501" } ], "uniprot_canonical_ac": "O15503-1" }, { "start_pos": 158, "end_pos": 158, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of ubiquitination and degradation.", "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" }, { "database": "PubMed", "id": "16399501", "url": "https://pubmed.ncbi.nlm.nih.gov/16399501" } ], "uniprot_canonical_ac": "O15503-1" } ], "record_id": "pubmed.16399501", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Juxtamembranous aspartic acid in Insig-1 and Insig-2 is required for cholesterol homeostasis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Gong Y, Lee JN, Brown MS, Goldstein JL, Ye J", "reference": { "type": "PubMed", "id": "16606821", "url": "https://pubmed.ncbi.nlm.nih.gov/16606821" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 205, "end_pos": 205, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of ability to suppress the cleavage of SREBP2 and to accelerate the degradation of HMGCR.", "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" }, { "database": "PubMed", "id": "16606821", "url": "https://pubmed.ncbi.nlm.nih.gov/16606821" } ], "uniprot_canonical_ac": "O15503-1" }, { "start_pos": 149, "end_pos": 149, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of ability to suppress the cleavage of SREBP2 and to accelerate the degradation of HMGCR. Abolished interaction with SCAP without affecting binding to 25-hydroxycholesterol.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y5U4", "url": "https://www.uniprot.org/uniprotkb/Q9Y5U4" }, { "database": "PubMed", "id": "16606821", "url": "https://pubmed.ncbi.nlm.nih.gov/16606821" }, { "database": "PubMed", "id": "26160948", "url": "https://pubmed.ncbi.nlm.nih.gov/26160948" }, { "database": "PubMed", "id": "17428920", "url": "https://pubmed.ncbi.nlm.nih.gov/17428920" } ], "uniprot_canonical_ac": "Q9Y5U4-1" } ], "record_id": "pubmed.16606821", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sterol-regulated degradation of Insig-1 mediated by the membrane-bound ubiquitin ligase gp78.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Lee JN, Song B, DeBose-Boyd RA, Ye J", "reference": { "type": "PubMed", "id": "17043353", "url": "https://pubmed.ncbi.nlm.nih.gov/17043353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKV5-1", "protein_name": "E3 ubiquitin-protein ligase AMFR", "gene_name": "AMFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 214, "end_pos": 214, "sequence_org": "E", "sequence_mut": "A", "comment": "Promotes ubiquitination by AMFR/gp78, which does not take place normally.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y5U4", "url": "https://www.uniprot.org/uniprotkb/Q9Y5U4" }, { "database": "PubMed", "id": "17043353", "url": "https://pubmed.ncbi.nlm.nih.gov/17043353" } ], "uniprot_canonical_ac": "Q9Y5U4-1" } ], "record_id": "pubmed.17043353", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The TRC8 ubiquitin ligase is sterol regulated and interacts with lipid and protein biosynthetic pathways.", "journal": "Molecular cancer research : MCR", "date": "2010", "authors": "Lee JP, Brauweiler A, Rudolph M, Hooper JE, Drabkin HA, Gemmill RM", "reference": { "type": "PubMed", "id": "20068067", "url": "https://pubmed.ncbi.nlm.nih.gov/20068067" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WU17-1", "protein_name": "E3 ubiquitin-protein ligase RNF139", "gene_name": "RNF139", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15372-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit H", "gene_name": "EIF3H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00303-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit F", "gene_name": "EIF3F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7KRW1-1", "protein_name": "Protein TRC8 homolog", "gene_name": "Trc8", "tax_name": "Fruit fly" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 547, "end_pos": 550, "sequence_org": "CAIC", "sequence_mut": "SAIS", "comment": "Abolishes ubiquitination activity. Increases proliferation. Does not phosphorylate CHEK2 on T-68. Does not phosphorylate ATM on S-1981. Rescues MHC class I to the cell surface. Suppresses SREBF2 processing in the presence or absence of sterols. Fails to down-regulate SREBF1 and SREBF2. Decreases INSIG1 ubiquitination.", "evidence": [ { "database": "UniProtKB", "id": "Q8WU17", "url": "https://www.uniprot.org/uniprotkb/Q8WU17" }, { "database": "PubMed", "id": "19720873", "url": "https://pubmed.ncbi.nlm.nih.gov/19720873" }, { "database": "PubMed", "id": "17016439", "url": "https://pubmed.ncbi.nlm.nih.gov/17016439" }, { "database": "PubMed", "id": "20068067", "url": "https://pubmed.ncbi.nlm.nih.gov/20068067" }, { "database": "PubMed", "id": "19706601", "url": "https://pubmed.ncbi.nlm.nih.gov/19706601" } ], "uniprot_canonical_ac": "Q8WU17-1" }, { "start_pos": 547, "end_pos": 586, "sequence_org": "CAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCH", "sequence_mut": "", "comment": "Increases proliferation. Rescues MHC class I to the cell surface. Fails to down-regulate SREBF1 and SREBF2.", "evidence": [ { "database": "UniProtKB", "id": "Q8WU17", "url": "https://www.uniprot.org/uniprotkb/Q8WU17" }, { "database": "PubMed", "id": "19720873", "url": "https://pubmed.ncbi.nlm.nih.gov/19720873" }, { "database": "PubMed", "id": "17016439", "url": "https://pubmed.ncbi.nlm.nih.gov/17016439" }, { "database": "PubMed", "id": "20068067", "url": "https://pubmed.ncbi.nlm.nih.gov/20068067" }, { "database": "PubMed", "id": "19706601", "url": "https://pubmed.ncbi.nlm.nih.gov/19706601" } ], "uniprot_canonical_ac": "Q8WU17-1" } ], "record_id": "pubmed.20068067", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sterol-induced degradation of HMG CoA reductase depends on interplay of two Insigs and two ubiquitin ligases, gp78 and Trc8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Jo Y, Lee PC, Sguigna PV, DeBose-Boyd RA", "reference": { "type": "PubMed", "id": "22143767", "url": "https://pubmed.ncbi.nlm.nih.gov/22143767" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKV5-1", "protein_name": "E3 ubiquitin-protein ligase AMFR", "gene_name": "AMFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WU17-1", "protein_name": "E3 ubiquitin-protein ligase RNF139", "gene_name": "RNF139", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22143767", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rules for the recognition of dilysine retrieval motifs by coatomer.", "journal": "EMBO J.", "date": "2013", "authors": "Ma Wenfu, Goldberg Jonathan", "reference": { "type": "PubMed", "id": "23481256", "url": "https://pubmed.ncbi.nlm.nih.gov/23481256" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33767-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1", "gene_name": "WBP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23481256", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cholesterol and fatty acids regulate cysteine ubiquitylation of ACAT2 through competitive oxidation.", "journal": "Nature cell biology", "date": "2017", "authors": "Wang YJ, Bian Y, Luo J, Lu M, Xiong Y, Guo SY, Yin HY, Lin X, Li Q, Chang CCY, Chang TY, Li BL, Song BL", "reference": { "type": "PubMed", "id": "28604676", "url": "https://pubmed.ncbi.nlm.nih.gov/28604676" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKV5-1", "protein_name": "E3 ubiquitin-protein ligase AMFR", "gene_name": "AMFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O88908-1", "protein_name": "Sterol O-acyltransferase 2", "gene_name": "Soat2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O75908-1", "protein_name": "Sterol O-acyltransferase 2", "gene_name": "SOAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 100, "end_pos": 100, "sequence_org": "K", "sequence_mut": "R", "comment": "In K-null mutant; does not affect ubiquitination and sterol-regulated stabilization; when associated with R-49, R-80, R-102, R-108, R-242 and R-299.", "evidence": [ { "database": "UniProtKB", "id": "O75908", "url": "https://www.uniprot.org/uniprotkb/O75908" }, { "database": "PubMed", "id": "28604676", "url": "https://pubmed.ncbi.nlm.nih.gov/28604676" } ], "uniprot_canonical_ac": "O75908-1" }, { "start_pos": 102, "end_pos": 102, "sequence_org": "K", "sequence_mut": "R", "comment": "In K-null mutant; does not affect ubiquitination and sterol-regulated stabilization; when associated with R-49, R-80, R-100, R-108, R-242 and R-299.", "evidence": [ { "database": "UniProtKB", "id": "O75908", "url": "https://www.uniprot.org/uniprotkb/O75908" }, { "database": "PubMed", "id": "28604676", "url": "https://pubmed.ncbi.nlm.nih.gov/28604676" } ], "uniprot_canonical_ac": "O75908-1" }, { "start_pos": 108, "end_pos": 108, "sequence_org": "K", "sequence_mut": "R", "comment": "In K-null mutant; does not affect ubiquitination and sterol-regulated stabilization; when associated with R-49, R-80, R-100, R-102, R-242 and R-299.", "evidence": [ { "database": "UniProtKB", "id": "O75908", "url": "https://www.uniprot.org/uniprotkb/O75908" }, { "database": "PubMed", "id": "28604676", "url": "https://pubmed.ncbi.nlm.nih.gov/28604676" } ], "uniprot_canonical_ac": "O75908-1" }, { "start_pos": 242, "end_pos": 242, "sequence_org": "K", "sequence_mut": "R", "comment": "In K-null mutant; does not affect ubiquitination and sterol-regulated stabilization; when associated with R-49, R-80, R-100, R-102, R-108 and R-299.", "evidence": [ { "database": "UniProtKB", "id": "O75908", "url": "https://www.uniprot.org/uniprotkb/O75908" }, { "database": "PubMed", "id": "28604676", "url": "https://pubmed.ncbi.nlm.nih.gov/28604676" } ], "uniprot_canonical_ac": "O75908-1" }, { "start_pos": 254, "end_pos": 254, "sequence_org": "T", "sequence_mut": "A", "comment": "Does not affect ubiquitination and sterol-regulated stabilization; when associated with R-279.", "evidence": [ { "database": "UniProtKB", "id": "O75908", "url": "https://www.uniprot.org/uniprotkb/O75908" }, { "database": "PubMed", "id": "28604676", "url": "https://pubmed.ncbi.nlm.nih.gov/28604676" } ], "uniprot_canonical_ac": "O75908-1" }, { "start_pos": 267, "end_pos": 270, "sequence_org": "SFSS", "sequence_mut": "AFAA", "comment": "Does not affect ubiquitination and sterol-regulated stabilization.", "evidence": [ { "database": "UniProtKB", "id": "O75908", "url": "https://www.uniprot.org/uniprotkb/O75908" }, { "database": "PubMed", "id": "28604676", "url": "https://pubmed.ncbi.nlm.nih.gov/28604676" } ], "uniprot_canonical_ac": "O75908-1" }, { "start_pos": 277, "end_pos": 277, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolished ubiquitination and sterol-regulated stabilization.", "evidence": [ { "database": "UniProtKB", "id": "O75908", "url": "https://www.uniprot.org/uniprotkb/O75908" }, { "database": "PubMed", "id": "28604676", "url": "https://pubmed.ncbi.nlm.nih.gov/28604676" } ], "uniprot_canonical_ac": "O75908-1" }, { "start_pos": 279, "end_pos": 279, "sequence_org": "T", "sequence_mut": "A", "comment": "Does not affect ubiquitination and sterol-regulated stabilization; when associated with R-54.", "evidence": [ { "database": "UniProtKB", "id": "O75908", "url": "https://www.uniprot.org/uniprotkb/O75908" }, { "database": "PubMed", "id": "28604676", "url": "https://pubmed.ncbi.nlm.nih.gov/28604676" } ], "uniprot_canonical_ac": "O75908-1" }, { "start_pos": 299, "end_pos": 299, "sequence_org": "K", "sequence_mut": "R", "comment": "In K-null mutant; does not affect ubiquitination and sterol-regulated stabilization; when associated with R-49, R-80, R-100, R-102, R-108 and R-242.", "evidence": [ { "database": "UniProtKB", "id": "O75908", "url": "https://www.uniprot.org/uniprotkb/O75908" }, { "database": "PubMed", "id": "28604676", "url": "https://pubmed.ncbi.nlm.nih.gov/28604676" } ], "uniprot_canonical_ac": "O75908-1" }, { "start_pos": 49, "end_pos": 49, "sequence_org": "K", "sequence_mut": "R", "comment": "In K-null mutant; does not affect ubiquitination and sterol-regulated stabilization; when associated with R-80, R-100, R-102, R-108, R-242 and R-299.", "evidence": [ { "database": "UniProtKB", "id": "O75908", "url": "https://www.uniprot.org/uniprotkb/O75908" }, { "database": "PubMed", "id": "28604676", "url": "https://pubmed.ncbi.nlm.nih.gov/28604676" } ], "uniprot_canonical_ac": "O75908-1" }, { "start_pos": 80, "end_pos": 80, "sequence_org": "K", "sequence_mut": "R", "comment": "In K-null mutant; does not affect ubiquitination and sterol-regulated stabilization; when associated with R-49, R-100, R-102, R-108, R-242 and R-299.", "evidence": [ { "database": "UniProtKB", "id": "O75908", "url": "https://www.uniprot.org/uniprotkb/O75908" }, { "database": "PubMed", "id": "28604676", "url": "https://pubmed.ncbi.nlm.nih.gov/28604676" } ], "uniprot_canonical_ac": "O75908-1" } ], "record_id": "pubmed.28604676", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Corrigendum: Cholesterol and fatty acids regulate cysteine ubiquitylation of ACAT2 through competitive oxidation.", "journal": "Nat. Cell Biol.", "date": "2017", "authors": "Wang Yong-Jian, Bian Yan, Luo Jie, Lu Ming, Xiong Ying, Guo Shu-Yuan, Yong Hui, Lin Xu, Li Qin, Chang Catherine C Y, Chang Ta-Yuan, Li Bo-Liang, Song Bao-Liang", "reference": { "type": "PubMed", "id": "29184177", "url": "https://pubmed.ncbi.nlm.nih.gov/29184177" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKV5-1", "protein_name": "E3 ubiquitin-protein ligase AMFR", "gene_name": "AMFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O88908-1", "protein_name": "Sterol O-acyltransferase 2", "gene_name": "Soat2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O75908-1", "protein_name": "Sterol O-acyltransferase 2", "gene_name": "SOAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29184177", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ring finger protein 145 (RNF145) is a ubiquitin ligase for sterol-induced degradation of HMG-CoA reductase.", "journal": "J. Biol. Chem.", "date": "2018", "authors": "Jiang LY, Jiang W, Tian N, Xiong YN, Liu J, Wei J, Wu KY, Luo J, Shi XJ, Song BL", "reference": { "type": "PubMed", "id": "29374057", "url": "https://pubmed.ncbi.nlm.nih.gov/29374057" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SWK7-1", "protein_name": "RING finger protein 145", "gene_name": "Rnf145", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P00347-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Chinese hamster" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 537, "end_pos": 537, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes E3 ubiquitin ligase activity. Impairs ubiquitination of SCAP and functional regulation of cholesterol biosynthesis. Impairs sterol-induced ubiquitination and degradation of HMGCR.", "evidence": [ { "database": "UniProtKB", "id": "Q5SWK7", "url": "https://www.uniprot.org/uniprotkb/Q5SWK7" }, { "database": "PubMed", "id": "29374057", "url": "https://pubmed.ncbi.nlm.nih.gov/29374057" }, { "database": "PubMed", "id": "29068315", "url": "https://pubmed.ncbi.nlm.nih.gov/29068315" } ], "uniprot_canonical_ac": "Q5SWK7-1" }, { "start_pos": 81, "end_pos": 84, "sequence_org": "YLYF", "sequence_mut": "AAAA", "comment": "Impairs interaction with INSIG1.", "evidence": [ { "database": "UniProtKB", "id": "Q5SWK7", "url": "https://www.uniprot.org/uniprotkb/Q5SWK7" }, { "database": "PubMed", "id": "29374057", "url": "https://pubmed.ncbi.nlm.nih.gov/29374057" } ], "uniprot_canonical_ac": "Q5SWK7-1" } ], "record_id": "pubmed.29374057", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutant huntingtin interacts with the sterol regulatory element-binding proteins and impairs their nuclear import.", "journal": "Human molecular genetics", "date": "2020", "authors": "Di Pardo A, Monyror J, Morales LC, Kadam V, Lingrell S, Maglione V, Wozniak RW, Sipione S", "reference": { "type": "PubMed", "id": "31875875", "url": "https://pubmed.ncbi.nlm.nih.gov/31875875" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62826-1", "protein_name": "GTP-binding nuclear protein Ran", "gene_name": "RAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12770-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43462-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14703-1", "protein_name": "Membrane-bound transcription factor site-1 protease", "gene_name": "MBTPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31875875", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The gluconeogenic enzyme PCK1 phosphorylates INSIG1/2 for lipogenesis.", "journal": "Nature", "date": "2020", "authors": "Xu D, Wang Z, Xia Y, Shao F, Xia W, Wei Y, Li X, Qian X, Lee JH, Du L, Zheng Y, Lv G, Leu JS, Wang H, Xing D, Liang T, Hung MC, Lu Z", "reference": { "type": "PubMed", "id": "32322062", "url": "https://pubmed.ncbi.nlm.nih.gov/32322062" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35558-1", "protein_name": "Phosphoenolpyruvate carboxykinase, cytosolic [GTP]", "gene_name": "PCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36956-1", "protein_name": "Sterol regulatory element-binding protein 1", "gene_name": "SREBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 207, "end_pos": 207, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished phosphorylation by PCK1, does not affect oxysterol-binding, does not affect the interaction with SCAP.", "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" }, { "database": "PubMed", "id": "32322062", "url": "https://pubmed.ncbi.nlm.nih.gov/32322062" } ], "uniprot_canonical_ac": "O15503-1" }, { "start_pos": 207, "end_pos": 207, "sequence_org": "S", "sequence_mut": "E", "comment": "Phosphomimetic mutant, reduced binding to oxysterol.", "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" }, { "database": "PubMed", "id": "32322062", "url": "https://pubmed.ncbi.nlm.nih.gov/32322062" } ], "uniprot_canonical_ac": "O15503-1" }, { "start_pos": 288, "end_pos": 288, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolished both phosphoenolpyruvate carboxykinase and protein kinase activities.", "evidence": [ { "database": "UniProtKB", "id": "P35558", "url": "https://www.uniprot.org/uniprotkb/P35558" }, { "database": "PubMed", "id": "32322062", "url": "https://pubmed.ncbi.nlm.nih.gov/32322062" } ], "uniprot_canonical_ac": "P35558-1" }, { "start_pos": 90, "end_pos": 90, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished phosphorylation by AKT1, interaction with INSIG proteins (INSIG1 and INSIG2) and ability to regulate lipogenesis.", "evidence": [ { "database": "UniProtKB", "id": "P35558", "url": "https://www.uniprot.org/uniprotkb/P35558" }, { "database": "PubMed", "id": "32322062", "url": "https://pubmed.ncbi.nlm.nih.gov/32322062" } ], "uniprot_canonical_ac": "P35558-1" }, { "start_pos": 90, "end_pos": 90, "sequence_org": "S", "sequence_mut": "E", "comment": "Phosphomimetic mutant, promotes the serine protein kinase activity by reducing the binding affinity to oxaloacetate.", "evidence": [ { "database": "UniProtKB", "id": "P35558", "url": "https://www.uniprot.org/uniprotkb/P35558" }, { "database": "PubMed", "id": "32322062", "url": "https://pubmed.ncbi.nlm.nih.gov/32322062" } ], "uniprot_canonical_ac": "P35558-1" }, { "start_pos": 151, "end_pos": 151, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished phosphorylation by PCK1, does not affect oxysterol-binding, does not affect the interaction with SCAP.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y5U4", "url": "https://www.uniprot.org/uniprotkb/Q9Y5U4" }, { "database": "PubMed", "id": "32322062", "url": "https://pubmed.ncbi.nlm.nih.gov/32322062" } ], "uniprot_canonical_ac": "Q9Y5U4-1" }, { "start_pos": 151, "end_pos": 151, "sequence_org": "S", "sequence_mut": "E", "comment": "Phosphomimetic mutant, reduced binding to oxysterol.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y5U4", "url": "https://www.uniprot.org/uniprotkb/Q9Y5U4" }, { "database": "PubMed", "id": "32322062", "url": "https://pubmed.ncbi.nlm.nih.gov/32322062" } ], "uniprot_canonical_ac": "Q9Y5U4-1" } ], "phosphorylation": [ { "start_pos": 207, "end_pos": 207, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PCK1", "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" }, { "database": "iPTMnet", "id": "O15503", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15503" }, { "database": "PubMed", "id": "32322062", "url": "https://pubmed.ncbi.nlm.nih.gov/32322062" } ], "site_lbl": "Ser207", "uniprot_canonical_ac": "O15503-1" }, { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKB/AKT1", "evidence": [ { "database": "UniProtKB", "id": "P35558", "url": "https://www.uniprot.org/uniprotkb/P35558" }, { "database": "iPTMnet", "id": "P35558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35558" }, { "database": "PubMed", "id": "32809272", "url": "https://pubmed.ncbi.nlm.nih.gov/32809272" }, { "database": "PubMed", "id": "32322062", "url": "https://pubmed.ncbi.nlm.nih.gov/32322062" } ], "site_lbl": "Ser90", "uniprot_canonical_ac": "P35558-1" }, { "start_pos": 151, "end_pos": 151, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PCK1", "evidence": [ { "database": "UniProtKB", "id": "Q9Y5U4", "url": "https://www.uniprot.org/uniprotkb/Q9Y5U4" }, { "database": "iPTMnet", "id": "Q9Y5U4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Y5U4" }, { "database": "PubMed", "id": "32322062", "url": "https://pubmed.ncbi.nlm.nih.gov/32322062" } ], "site_lbl": "Ser151", "uniprot_canonical_ac": "Q9Y5U4-1" } ], "record_id": "pubmed.32322062", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Suppression of insulin-induced gene 1 (INSIG1) function promotes hepatic lipid remodelling and restrains NASH progression.", "journal": "Molecular metabolism", "date": "2021", "authors": "Azzu V, Vacca M, Kamzolas I, Hall Z, Leslie J, Carobbio S, Virtue S, Davies SE, Lukasik A, Dale M, Bohlooly-Y M, Acharjee A, Linden D, Bidault G, Petsalaki E, Griffin JL, Oakley F, Allison MED, Vidal-Puig A", "reference": { "type": "PubMed", "id": "33722690", "url": "https://pubmed.ncbi.nlm.nih.gov/33722690" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BGI3-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "Insig1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33722690", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Propensity of the Human Liver to Form Large Lipid Droplets Is Associated with PNPLA3 Polymorphism, Reduced INSIG1 and NPC1L1 Expression and Increased Fibrogenetic Capacity.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Ferri F, Carotti S, Carpino G, Mischitelli M, Cantafora A, Molinaro A, Argenziano ME, Parisse S, Corsi A, Riminucci M, Lai Q, Mennini G, Spadetta G, Pugliese F, Rossi M, Morini S, Gaudio E, Ginanni Corradini S", "reference": { "type": "PubMed", "id": "34198853", "url": "https://pubmed.ncbi.nlm.nih.gov/34198853" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34198853", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insulin-induced genes INSIG1 and INSIG2 mediate oxysterol-dependent activation of the PERK-eIF2alpha-ATF4 axis.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Watanabe Y, Sasaki T, Miyoshi S, Shimizu M, Yamauchi Y, Sato R", "reference": { "type": "PubMed", "id": "34298014", "url": "https://pubmed.ncbi.nlm.nih.gov/34298014" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34298014", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel protein encoded by circINSIG1 reprograms cholesterol metabolism by promoting the ubiquitin-dependent degradation of INSIG1 in colorectal cancer.", "journal": "Molecular cancer", "date": "2023-04-22", "authors": "Xiong Li, Liu Hua-Shan, Zhou Chi, Yang Xin, Huang Liang, Jie Hai-Qing, Zeng Zi-Wei, Zheng Xiao-Bin, Li Wen-Xin, Liu Zhan-Zhen, Kang Liang, Liang Zhen-Xing", "reference": { "type": "PubMed", "id": "37087475", "url": "https://pubmed.ncbi.nlm.nih.gov/37087475" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37087475", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sterol-regulated release of SREBP-2 from cell membranes requires two sequential cleavages, one within a transmembrane segment.", "journal": "Cell", "date": "1996", "authors": "Sakai J, Duncan EA, Rawson RB, Hua X, Brown MS, Goldstein JL", "reference": { "type": "PubMed", "id": "8674110", "url": "https://pubmed.ncbi.nlm.nih.gov/8674110" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62826-1", "protein_name": "GTP-binding nuclear protein Ran", "gene_name": "RAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12770-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43462-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14703-1", "protein_name": "Membrane-bound transcription factor site-1 protease", "gene_name": "MBTPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8674110", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, human chromosomal assignment, and adipose and hepatic expression of the CL-6/INSIG1 gene.", "journal": "Genomics", "date": "1997", "authors": "Peng Y, Schwarz EJ, Lazar MA, Genin A, Spinner NB, Taub R", "reference": { "type": "PubMed", "id": "9268630", "url": "https://pubmed.ncbi.nlm.nih.gov/9268630" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9268630", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cleavage of sterol regulatory element-binding proteins (SREBPs) at site-1 requires interaction with SREBP cleavage-activating protein. Evidence from in vivo competition studies.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Sakai J, Nohturfft A, Goldstein JL, Brown MS", "reference": { "type": "PubMed", "id": "9488713", "url": "https://pubmed.ncbi.nlm.nih.gov/9488713" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62826-1", "protein_name": "GTP-binding nuclear protein Ran", "gene_name": "RAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12770-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43462-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14703-1", "protein_name": "Membrane-bound transcription factor site-1 protease", "gene_name": "MBTPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97260-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Chinese hamster" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9488713", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Co-crystal structure of sterol regulatory element binding protein 1a at 2.3 A resolution.", "journal": "Structure (London, England : 1993)", "date": "1998", "authors": "Parraga A, Bellsolell L, Ferre-D'Amare AR, Burley SK", "reference": { "type": "PubMed", "id": "9634703", "url": "https://pubmed.ncbi.nlm.nih.gov/9634703" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62826-1", "protein_name": "GTP-binding nuclear protein Ran", "gene_name": "RAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12770-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36956-1", "protein_name": "Sterol regulatory element-binding protein 1", "gene_name": "SREBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43462-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14703-1", "protein_name": "Membrane-bound transcription factor site-1 protease", "gene_name": "MBTPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9634703", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complementation cloning of S2P, a gene encoding a putative metalloprotease required for intramembrane cleavage of SREBPs.", "journal": "Molecular cell", "date": "1997", "authors": "Rawson RB, Zelenski NG, Nijhawan D, Ye J, Sakai J, Hasan MT, Chang TY, Brown MS, Goldstein JL", "reference": { "type": "PubMed", "id": "9659902", "url": "https://pubmed.ncbi.nlm.nih.gov/9659902" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O15503-1", "protein_name": "Insulin-induced gene 1 protein", "gene_name": "INSIG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62826-1", "protein_name": "GTP-binding nuclear protein Ran", "gene_name": "RAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12770-1", "protein_name": "Sterol regulatory element-binding protein cleavage-activating protein", "gene_name": "SCAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U4-1", "protein_name": "Insulin-induced gene 2 protein", "gene_name": "INSIG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43462-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14703-1", "protein_name": "Membrane-bound transcription factor site-1 protease", "gene_name": "MBTPS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O54862-1", "protein_name": "Membrane-bound transcription factor site-2 protease", "gene_name": "MBTPS2", "tax_name": "Chinese hamster" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15503", "url": "https://www.uniprot.org/uniprotkb/O15503" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 171, "end_pos": 171, "sequence_org": "H", "sequence_mut": "F", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "O43462", "url": "https://www.uniprot.org/uniprotkb/O43462" }, { "database": "PubMed", "id": "9659902", "url": "https://pubmed.ncbi.nlm.nih.gov/9659902" } ], "uniprot_canonical_ac": "O43462-1" }, { "start_pos": 172, "end_pos": 172, "sequence_org": "E", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "O43462", "url": "https://www.uniprot.org/uniprotkb/O43462" }, { "database": "PubMed", "id": "9659902", "url": "https://pubmed.ncbi.nlm.nih.gov/9659902" } ], "uniprot_canonical_ac": "O43462-1" }, { "start_pos": 172, "end_pos": 172, "sequence_org": "E", "sequence_mut": "D", "comment": "Partial loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "O43462", "url": "https://www.uniprot.org/uniprotkb/O43462" }, { "database": "PubMed", "id": "9659902", "url": "https://pubmed.ncbi.nlm.nih.gov/9659902" } ], "uniprot_canonical_ac": "O43462-1" }, { "start_pos": 172, "end_pos": 172, "sequence_org": "E", "sequence_mut": "Q", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "O43462", "url": "https://www.uniprot.org/uniprotkb/O43462" }, { "database": "PubMed", "id": "9659902", "url": "https://pubmed.ncbi.nlm.nih.gov/9659902" } ], "uniprot_canonical_ac": "O43462-1" }, { "start_pos": 175, "end_pos": 175, "sequence_org": "H", "sequence_mut": "F", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "O43462", "url": "https://www.uniprot.org/uniprotkb/O43462" }, { "database": "PubMed", "id": "9659902", "url": "https://pubmed.ncbi.nlm.nih.gov/9659902" } ], "uniprot_canonical_ac": "O43462-1" }, { "start_pos": 467, "end_pos": 467, "sequence_org": "D", "sequence_mut": "N", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "O43462", "url": "https://www.uniprot.org/uniprotkb/O43462" }, { "database": "PubMed", "id": "9659902", "url": "https://pubmed.ncbi.nlm.nih.gov/9659902" } ], "uniprot_canonical_ac": "O43462-1" } ], "record_id": "pubmed.9659902", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EHD2, EHD3, and EHD4 encode novel members of a highly conserved family of EH domain-containing proteins.", "journal": "Genomics", "date": "2000", "authors": "Pohl U, Smith JS, Tachibana I, Ueki K, Lee HK, Ramaswamy S, Wu Q, Mohrenweiser HW, Jenkins RB, Louis DN", "reference": { "type": "PubMed", "id": "10673336", "url": "https://pubmed.ncbi.nlm.nih.gov/10673336" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZN4-1", "protein_name": "EH domain-containing protein 2", "gene_name": "EHD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H223-1", "protein_name": "EH domain-containing protein 4", "gene_name": "EHD4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10673336", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EHD3: a protein that resides in recycling tubular and vesicular membrane structures and interacts with EHD1.", "journal": "Traffic", "date": "2002", "authors": "Galperin E, Benjamin S, Rapaport D, Rotem-Yehudar R, Tolchinsky S, Horowitz M", "reference": { "type": "PubMed", "id": "12121420", "url": "https://pubmed.ncbi.nlm.nih.gov/12121420" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QXY6-1", "protein_name": "EH domain-containing protein 3", "gene_name": "Ehd3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9WVK4-1", "protein_name": "EH domain-containing protein 1", "gene_name": "Ehd1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12121420", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Shared as well as distinct roles of EHD proteins revealed by biochemical and functional comparisons in mammalian cells and C. elegans.", "journal": "BMC cell biology", "date": "2007", "authors": "George M, Ying G, Rainey MA, Solomon A, Parikh PT, Gao Q, Band V, Band H", "reference": { "type": "PubMed", "id": "17233914", "url": "https://pubmed.ncbi.nlm.nih.gov/17233914" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZN4-1", "protein_name": "EH domain-containing protein 2", "gene_name": "EHD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M9-1", "protein_name": "EH domain-containing protein 1", "gene_name": "EHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H223-1", "protein_name": "EH domain-containing protein 4", "gene_name": "EHD4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17233914", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A role for EHD4 in the regulation of early endosomal transport.", "journal": "Traffic", "date": "2008", "authors": "Sharma M, Naslavsky N, Caplan S", "reference": { "type": "PubMed", "id": "18331452", "url": "https://pubmed.ncbi.nlm.nih.gov/18331452" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M9-1", "protein_name": "EH domain-containing protein 1", "gene_name": "EHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H223-1", "protein_name": "EH domain-containing protein 4", "gene_name": "EHD4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18331452", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EHD3 regulates early-endosome-to-Golgi transport and preserves Golgi morphology.", "journal": "Journal of cell science", "date": "2009", "authors": "Naslavsky N, McKenzie J, Altan-Bonnet N, Sheff D, Caplan S", "reference": { "type": "PubMed", "id": "19139087", "url": "https://pubmed.ncbi.nlm.nih.gov/19139087" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19139087", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling.", "journal": "Mol. Biol. Cell", "date": "2009", "authors": "Sharma M, Giridharan SS, Rahajeng J, Naslavsky N, Caplan S", "reference": { "type": "PubMed", "id": "19864458", "url": "https://pubmed.ncbi.nlm.nih.gov/19864458" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "E1BBG2-1", "protein_name": "MICAL-like protein 1", "gene_name": "MICALL1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "P61006-1", "protein_name": "Ras-related protein Rab-8A", "gene_name": "RAB8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5E9R3-1", "protein_name": "EH domain-containing protein 1", "gene_name": "EHD1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "Q9H4M9-1", "protein_name": "EH domain-containing protein 1", "gene_name": "EHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3F8-1", "protein_name": "MICAL-like protein 1", "gene_name": "MICALL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 22, "end_pos": 22, "sequence_org": "T", "sequence_mut": "N", "comment": "Loss of interaction with MICAL1. Loss of GRAF1/ARHGAP26 and GRAF2/ARHGAP10 tubular localization. Loss of E-cadherin and MMP14 export. Stimulates interaction with RPGR.", "evidence": [ { "database": "UniProtKB", "id": "P61006", "url": "https://www.uniprot.org/uniprotkb/P61006" }, { "database": "PubMed", "id": "19864458", "url": "https://pubmed.ncbi.nlm.nih.gov/19864458" }, { "database": "PubMed", "id": "20631154", "url": "https://pubmed.ncbi.nlm.nih.gov/20631154" } ], "uniprot_canonical_ac": "P61006-1" }, { "start_pos": 67, "end_pos": 67, "sequence_org": "Q", "sequence_mut": "L", "comment": "Probable constitutively active mutant locked in the active GTP-bound form. Stimulates interaction with MICALL1. Increased WDR44-positive tubulation. No change in interaction with RPGR, compared to wild-type.", "evidence": [ { "database": "UniProtKB", "id": "P61006", "url": "https://www.uniprot.org/uniprotkb/P61006" }, { "database": "PubMed", "id": "19864458", "url": "https://pubmed.ncbi.nlm.nih.gov/19864458" }, { "database": "PubMed", "id": "32344433", "url": "https://pubmed.ncbi.nlm.nih.gov/32344433" }, { "database": "PubMed", "id": "20631154", "url": "https://pubmed.ncbi.nlm.nih.gov/20631154" } ], "uniprot_canonical_ac": "P61006-1" }, { "start_pos": 483, "end_pos": 483, "sequence_org": "K", "sequence_mut": "E", "comment": "Loss of accumulation at the ciliary pocket. Loss of function in ciliogenesis. Loss of association with tubulovesicular structures and altered MICALL1 localization. No effect on MICALL1 localization; when associated with A-485.", "evidence": [ { "database": "UniProtKB", "id": "Q9H4M9", "url": "https://www.uniprot.org/uniprotkb/Q9H4M9" }, { "database": "PubMed", "id": "25686250", "url": "https://pubmed.ncbi.nlm.nih.gov/25686250" }, { "database": "PubMed", "id": "19864458", "url": "https://pubmed.ncbi.nlm.nih.gov/19864458" } ], "uniprot_canonical_ac": "Q9H4M9-1" }, { "start_pos": 485, "end_pos": 485, "sequence_org": "W", "sequence_mut": "A", "comment": "Loss of accumulation at the ciliary pocket. Loss of function in ciliogenesis. Abolishes interaction with RAB11FIP2. No effect on MICALL1 localization; when associated with E-483.", "evidence": [ { "database": "UniProtKB", "id": "Q9H4M9", "url": "https://www.uniprot.org/uniprotkb/Q9H4M9" }, { "database": "PubMed", "id": "25686250", "url": "https://pubmed.ncbi.nlm.nih.gov/25686250" }, { "database": "PubMed", "id": "19864458", "url": "https://pubmed.ncbi.nlm.nih.gov/19864458" }, { "database": "PubMed", "id": "16251358", "url": "https://pubmed.ncbi.nlm.nih.gov/16251358" } ], "uniprot_canonical_ac": "Q9H4M9-1" }, { "start_pos": 425, "end_pos": 427, "sequence_org": "NPF", "sequence_mut": "APA", "comment": "Partial loss of interaction with EHD1. Complete loss of interaction with EHD1; when associated with 633-A--A-635.", "evidence": [ { "database": "UniProtKB", "id": "Q8N3F8", "url": "https://www.uniprot.org/uniprotkb/Q8N3F8" }, { "database": "PubMed", "id": "19864458", "url": "https://pubmed.ncbi.nlm.nih.gov/19864458" } ], "uniprot_canonical_ac": "Q8N3F8-1" }, { "start_pos": 633, "end_pos": 635, "sequence_org": "NPF", "sequence_mut": "APA", "comment": "No effect on interaction with EHD1. Complete loss of interaction with EHD1; when associated with 425-A--A-427.", "evidence": [ { "database": "UniProtKB", "id": "Q8N3F8", "url": "https://www.uniprot.org/uniprotkb/Q8N3F8" }, { "database": "PubMed", "id": "19864458", "url": "https://pubmed.ncbi.nlm.nih.gov/19864458" } ], "uniprot_canonical_ac": "Q8N3F8-1" }, { "start_pos": 721, "end_pos": 726, "sequence_org": "MLVDWF", "sequence_mut": "AAAAAA", "comment": "Altered association with membranes.", "evidence": [ { "database": "UniProtKB", "id": "Q8N3F8", "url": "https://www.uniprot.org/uniprotkb/Q8N3F8" }, { "database": "PubMed", "id": "19864458", "url": "https://pubmed.ncbi.nlm.nih.gov/19864458" } ], "uniprot_canonical_ac": "Q8N3F8-1" } ], "record_id": "pubmed.19864458", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EH domain proteins regulate cardiac membrane protein targeting.", "journal": "Circulation research", "date": "2010", "authors": "Gudmundsson H, Hund TJ, Wright PJ, Kline CF, Snyder JS, Qian L, Koval OM, Cunha SR, George M, Rainey MA, Kashef FE, Dun W, Boyden PA, Anderson ME, Band H, Mohler PJ", "reference": { "type": "PubMed", "id": "20489164", "url": "https://pubmed.ncbi.nlm.nih.gov/20489164" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QXY6-1", "protein_name": "EH domain-containing protein 3", "gene_name": "Ehd3", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20489164", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Endocytosis promotes rapid dopaminergic signaling.", "journal": "Neuron", "date": "2011", "authors": "Kotowski SJ, Hopf FW, Seif T, Bonci A, von Zastrow M", "reference": { "type": "PubMed", "id": "21791287", "url": "https://pubmed.ncbi.nlm.nih.gov/21791287" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21791287", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemical shift assignments of the C-terminal Eps15 homology domain-3 EH domain.", "journal": "Biomol. NMR. Assign.", "date": "2014", "authors": "Spagnol Gaelle, Reiling Calliste, Kieken Fabien, Caplan Steve, Sorgen Paul L", "reference": { "type": "PubMed", "id": "23754701", "url": "https://pubmed.ncbi.nlm.nih.gov/23754701" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23754701", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "\u0391v\u03b23-integrin-mediated adhesion is regulated through an AAK1L- and EHD3-dependent rapid-recycling pathway.", "journal": "Journal of cell science", "date": "2013-08-15", "authors": "Waxmonsky Nicole C, Conner Sean D", "reference": { "type": "PubMed", "id": "23781025", "url": "https://pubmed.ncbi.nlm.nih.gov/23781025" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23781025", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential roles of C-terminal Eps15 homology domain proteins as vesiculators and tubulators of recycling endosomes.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Cai B, Giridharan SS, Zhang J, Saxena S, Bahl K, Schmidt JA, Sorgen PL, Guo W, Naslavsky N, Caplan S", "reference": { "type": "PubMed", "id": "24019528", "url": "https://pubmed.ncbi.nlm.nih.gov/24019528" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M9-1", "protein_name": "EH domain-containing protein 1", "gene_name": "EHD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24019528", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.", "journal": "Nature cell biology", "date": "2015", "authors": "Lu Q, Insinna C, Ott C, Stauffer J, Pintado PA, Rahajeng J, Baxa U, Walia V, Cuenca A, Hwang YS, Daar IO, Lopes S, Lippincott-Schwartz J, Jackson PK, Caplan S, Westlake CJ", "reference": { "type": "PubMed", "id": "25686250", "url": "https://pubmed.ncbi.nlm.nih.gov/25686250" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95721-1", "protein_name": "Synaptosomal-associated protein 29", "gene_name": "SNAP29", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TYP7-1", "protein_name": "EH domain-containing protein 3", "gene_name": "ehd3", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q9H4M9-1", "protein_name": "EH domain-containing protein 1", "gene_name": "EHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QXY6-1", "protein_name": "EH domain-containing protein 3", "gene_name": "Ehd3", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 483, "end_pos": 483, "sequence_org": "K", "sequence_mut": "E", "comment": "Loss of accumulation at the ciliary pocket. Loss of function in ciliogenesis. Loss of association with tubulovesicular structures and altered MICALL1 localization. No effect on MICALL1 localization; when associated with A-485.", "evidence": [ { "database": "UniProtKB", "id": "Q9H4M9", "url": "https://www.uniprot.org/uniprotkb/Q9H4M9" }, { "database": "PubMed", "id": "25686250", "url": "https://pubmed.ncbi.nlm.nih.gov/25686250" }, { "database": "PubMed", "id": "19864458", "url": "https://pubmed.ncbi.nlm.nih.gov/19864458" } ], "uniprot_canonical_ac": "Q9H4M9-1" }, { "start_pos": 485, "end_pos": 485, "sequence_org": "W", "sequence_mut": "A", "comment": "Loss of accumulation at the ciliary pocket. Loss of function in ciliogenesis. Abolishes interaction with RAB11FIP2. No effect on MICALL1 localization; when associated with E-483.", "evidence": [ { "database": "UniProtKB", "id": "Q9H4M9", "url": "https://www.uniprot.org/uniprotkb/Q9H4M9" }, { "database": "PubMed", "id": "25686250", "url": "https://pubmed.ncbi.nlm.nih.gov/25686250" }, { "database": "PubMed", "id": "19864458", "url": "https://pubmed.ncbi.nlm.nih.gov/19864458" }, { "database": "PubMed", "id": "16251358", "url": "https://pubmed.ncbi.nlm.nih.gov/16251358" } ], "uniprot_canonical_ac": "Q9H4M9-1" } ], "record_id": "pubmed.25686250", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SUMOylation of EHD3 Modulates Tubulation of the Endocytic Recycling Compartment.", "journal": "PloS one", "date": "2015", "authors": "Cabasso O, Pekar O, Horowitz M", "reference": { "type": "PubMed", "id": "26226295", "url": "https://pubmed.ncbi.nlm.nih.gov/26226295" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 315, "end_pos": 315, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes sumoylation and localization to tubular structures of the ERC, impairs fast recycling activity from the ERC, no effect on homooligomerization; when associated with R-511.", "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" }, { "database": "PubMed", "id": "26226295", "url": "https://pubmed.ncbi.nlm.nih.gov/26226295" } ], "uniprot_canonical_ac": "Q9NZN3-1" }, { "start_pos": 511, "end_pos": 511, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes sumoylation localization to tubular structures of the ERC, impairs fast recycling activity from the ERC, no effect on homooligomerization;; when associated with R-315.", "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" }, { "database": "PubMed", "id": "26226295", "url": "https://pubmed.ncbi.nlm.nih.gov/26226295" } ], "uniprot_canonical_ac": "Q9NZN3-1" } ], "record_id": "pubmed.26226295", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spatio-temporal regulation of EGFR signaling by the Eps15 homology domain-containing protein 3 (EHD3).", "journal": "Oncotarget", "date": "2016", "authors": "Amessou M, Ebrahim AS, Dilly A, Joseph M, Tabolina M, Chukkapalli S, Meroueh L, Syed JT, Liddane A, Lang SL, Al-Katib A, Kandouz M", "reference": { "type": "PubMed", "id": "27811356", "url": "https://pubmed.ncbi.nlm.nih.gov/27811356" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZN3-1", "protein_name": "EH domain-containing protein 3", "gene_name": "EHD3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZN3", "url": "https://www.uniprot.org/uniprotkb/Q9NZN3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27811356", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of CREB in axon-induced Schwann cell proliferation.", "journal": "Journal of neuroscience research", "date": "1999", "authors": "Lee MM, Badache A, DeVries GH", "reference": { "type": "PubMed", "id": "10220111", "url": "https://pubmed.ncbi.nlm.nih.gov/10220111" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15742-1", "protein_name": "NGFI-A-binding protein 2", "gene_name": "NAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SQ4-1", "protein_name": "Adhesion G protein-coupled receptor G6", "gene_name": "ADGRG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56693-1", "protein_name": "Transcription factor SOX-10", "gene_name": "SOX10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG9-1", "protein_name": "Adhesion G protein-coupled receptor V1", "gene_name": "ADGRV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SK9-1", "protein_name": "Stearoyl-CoA desaturase 5", "gene_name": "SCD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14118-1", "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07942-1", "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24043-1", "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11047-1", "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46939-1", "protein_name": "Utrophin", "gene_name": "UTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01453-1", "protein_name": "Peripheral myelin protein 22", "gene_name": "PMP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20916-1", "protein_name": "Myelin-associated glycoprotein", "gene_name": "MAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02686-1", "protein_name": "Myelin basic protein", "gene_name": "MBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16850-1", "protein_name": "Lanosterol 14-alpha demethylase", "gene_name": "CYP51A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13506-1", "protein_name": "NGFI-A-binding protein 1", "gene_name": "NAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM0-1", "protein_name": "Periaxin", "gene_name": "PRX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25189-1", "protein_name": "Myelin protein P0", "gene_name": "MPZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03052-1", "protein_name": "POU domain, class 3, transcription factor 1", "gene_name": "POU3F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28347-1", "protein_name": "Transcriptional enhancer factor TEF-1", "gene_name": "TEAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13474-1", "protein_name": "Dystrophin-related protein 2", "gene_name": "DRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20265-1", "protein_name": "POU domain, class 3, transcription factor 2", "gene_name": "POU3F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11161-1", "protein_name": "E3 SUMO-protein ligase EGR2", "gene_name": "EGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15742", "url": "https://www.uniprot.org/uniprotkb/Q15742" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10220111", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Myelin synthesis in the peripheral nervous system.", "journal": "Progress in neurobiology", "date": "2000", "authors": "Garbay B, Heape AM, Sargueil F, Cassagne C", "reference": { "type": "PubMed", "id": "10727776", "url": "https://pubmed.ncbi.nlm.nih.gov/10727776" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15742-1", "protein_name": "NGFI-A-binding protein 2", "gene_name": "NAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SQ4-1", "protein_name": "Adhesion G protein-coupled receptor G6", "gene_name": "ADGRG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56693-1", "protein_name": "Transcription factor SOX-10", "gene_name": "SOX10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG9-1", "protein_name": "Adhesion G protein-coupled receptor V1", "gene_name": "ADGRV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SK9-1", "protein_name": "Stearoyl-CoA desaturase 5", "gene_name": "SCD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14118-1", "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07942-1", "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24043-1", "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11047-1", "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46939-1", "protein_name": "Utrophin", "gene_name": "UTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01453-1", "protein_name": "Peripheral myelin protein 22", "gene_name": "PMP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20916-1", "protein_name": "Myelin-associated glycoprotein", "gene_name": "MAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02686-1", "protein_name": "Myelin basic protein", "gene_name": "MBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16850-1", "protein_name": "Lanosterol 14-alpha demethylase", "gene_name": "CYP51A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13506-1", "protein_name": "NGFI-A-binding protein 1", "gene_name": "NAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM0-1", "protein_name": "Periaxin", "gene_name": "PRX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25189-1", "protein_name": "Myelin protein P0", "gene_name": "MPZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03052-1", "protein_name": "POU domain, class 3, transcription factor 1", "gene_name": "POU3F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28347-1", "protein_name": "Transcriptional enhancer factor TEF-1", "gene_name": "TEAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13474-1", "protein_name": "Dystrophin-related protein 2", "gene_name": "DRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20265-1", "protein_name": "POU domain, class 3, transcription factor 2", "gene_name": "POU3F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11161-1", "protein_name": "E3 SUMO-protein ligase EGR2", "gene_name": "EGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15742", "url": "https://www.uniprot.org/uniprotkb/Q15742" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10727776", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein zero gene expression is regulated by the glial transcription factor Sox10.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Peirano RI, Goerich DE, Riethmacher D, Wegner M", "reference": { "type": "PubMed", "id": "10757804", "url": "https://pubmed.ncbi.nlm.nih.gov/10757804" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15742-1", "protein_name": "NGFI-A-binding protein 2", "gene_name": "NAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SQ4-1", "protein_name": "Adhesion G protein-coupled receptor G6", "gene_name": "ADGRG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56693-1", "protein_name": "Transcription factor SOX-10", "gene_name": "SOX10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG9-1", "protein_name": "Adhesion G protein-coupled receptor V1", "gene_name": "ADGRV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SK9-1", "protein_name": "Stearoyl-CoA desaturase 5", "gene_name": "SCD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14118-1", "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07942-1", "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24043-1", "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11047-1", "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46939-1", "protein_name": "Utrophin", "gene_name": "UTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01453-1", "protein_name": "Peripheral myelin protein 22", "gene_name": "PMP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20916-1", "protein_name": "Myelin-associated glycoprotein", "gene_name": "MAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02686-1", "protein_name": "Myelin basic protein", "gene_name": "MBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16850-1", "protein_name": "Lanosterol 14-alpha demethylase", "gene_name": "CYP51A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13506-1", "protein_name": "NGFI-A-binding protein 1", "gene_name": "NAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM0-1", "protein_name": "Periaxin", "gene_name": "PRX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25189-1", "protein_name": "Myelin protein P0", "gene_name": "MPZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03052-1", "protein_name": "POU domain, class 3, transcription factor 1", "gene_name": "POU3F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28347-1", "protein_name": "Transcriptional enhancer factor TEF-1", "gene_name": "TEAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13474-1", "protein_name": "Dystrophin-related protein 2", "gene_name": "DRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20265-1", "protein_name": "POU domain, class 3, transcription factor 2", "gene_name": "POU3F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11161-1", "protein_name": "E3 SUMO-protein ligase EGR2", "gene_name": "EGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15742", "url": "https://www.uniprot.org/uniprotkb/Q15742" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10757804", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A distal Schwann cell-specific enhancer mediates axonal regulation of the Oct-6 transcription factor during peripheral nerve development and regeneration.", "journal": "The EMBO journal", "date": "2000", "authors": "Mandemakers W, Zwart R, Jaegle M, Walbeehm E, Visser P, Grosveld F, Meijer D", "reference": { "type": "PubMed", "id": "10856243", "url": "https://pubmed.ncbi.nlm.nih.gov/10856243" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15742-1", "protein_name": "NGFI-A-binding protein 2", "gene_name": "NAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SQ4-1", "protein_name": "Adhesion G protein-coupled receptor G6", "gene_name": "ADGRG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56693-1", "protein_name": "Transcription factor SOX-10", "gene_name": "SOX10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG9-1", "protein_name": "Adhesion G protein-coupled receptor V1", "gene_name": "ADGRV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SK9-1", "protein_name": "Stearoyl-CoA desaturase 5", "gene_name": "SCD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14118-1", "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07942-1", "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24043-1", "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11047-1", "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46939-1", "protein_name": "Utrophin", "gene_name": "UTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01453-1", "protein_name": "Peripheral myelin protein 22", "gene_name": "PMP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20916-1", "protein_name": "Myelin-associated glycoprotein", "gene_name": "MAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02686-1", "protein_name": "Myelin basic protein", "gene_name": "MBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16850-1", "protein_name": "Lanosterol 14-alpha demethylase", "gene_name": "CYP51A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13506-1", "protein_name": "NGFI-A-binding protein 1", "gene_name": "NAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM0-1", "protein_name": "Periaxin", "gene_name": "PRX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25189-1", "protein_name": "Myelin protein P0", "gene_name": "MPZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03052-1", "protein_name": "POU domain, class 3, transcription factor 1", "gene_name": "POU3F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28347-1", "protein_name": "Transcriptional enhancer factor TEF-1", "gene_name": "TEAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13474-1", "protein_name": "Dystrophin-related protein 2", "gene_name": "DRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20265-1", "protein_name": "POU domain, class 3, transcription factor 2", "gene_name": "POU3F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11161-1", "protein_name": "E3 SUMO-protein ligase EGR2", "gene_name": "EGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15742", "url": "https://www.uniprot.org/uniprotkb/Q15742" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10856243", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A sarcoglycan-dystroglycan complex anchors Dp116 and utrophin in the peripheral nervous system.", "journal": "Human molecular genetics", "date": "2000", "authors": "Imamura M, Araishi K, Noguchi S, Ozawa E", "reference": { "type": "PubMed", "id": "11115854", "url": "https://pubmed.ncbi.nlm.nih.gov/11115854" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15742-1", "protein_name": "NGFI-A-binding protein 2", "gene_name": "NAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SQ4-1", "protein_name": "Adhesion G protein-coupled receptor G6", "gene_name": "ADGRG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56693-1", "protein_name": "Transcription factor SOX-10", "gene_name": "SOX10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG9-1", "protein_name": "Adhesion G protein-coupled receptor V1", "gene_name": "ADGRV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SK9-1", "protein_name": "Stearoyl-CoA desaturase 5", "gene_name": "SCD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14118-1", "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07942-1", "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24043-1", "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11047-1", "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46939-1", "protein_name": "Utrophin", "gene_name": "UTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01453-1", "protein_name": "Peripheral myelin protein 22", "gene_name": "PMP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20916-1", "protein_name": "Myelin-associated glycoprotein", "gene_name": "MAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02686-1", "protein_name": "Myelin basic protein", "gene_name": "MBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16850-1", "protein_name": "Lanosterol 14-alpha demethylase", "gene_name": "CYP51A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13506-1", "protein_name": "NGFI-A-binding protein 1", "gene_name": "NAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM0-1", "protein_name": "Periaxin", "gene_name": "PRX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25189-1", "protein_name": "Myelin protein P0", "gene_name": "MPZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03052-1", "protein_name": "POU domain, class 3, transcription factor 1", "gene_name": "POU3F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28347-1", "protein_name": "Transcriptional enhancer factor TEF-1", "gene_name": "TEAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13474-1", "protein_name": "Dystrophin-related protein 2", "gene_name": "DRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20265-1", "protein_name": "POU domain, class 3, transcription factor 2", "gene_name": "POU3F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11161-1", "protein_name": "E3 SUMO-protein ligase EGR2", "gene_name": "EGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15742", "url": "https://www.uniprot.org/uniprotkb/Q15742" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11115854", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Periaxin mutations cause recessive Dejerine-Sottas neuropathy.", "journal": "American journal of human genetics", "date": "2001", "authors": "Boerkoel CF, Takashima H, Stankiewicz P, Garcia CA, Leber SM, Rhee-Morris L, Lupski JR", "reference": { "type": "PubMed", "id": "11133365", "url": "https://pubmed.ncbi.nlm.nih.gov/11133365" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15742-1", "protein_name": "NGFI-A-binding protein 2", "gene_name": "NAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SQ4-1", "protein_name": "Adhesion G protein-coupled receptor G6", "gene_name": "ADGRG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56693-1", "protein_name": "Transcription factor SOX-10", "gene_name": "SOX10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG9-1", "protein_name": "Adhesion G protein-coupled receptor V1", "gene_name": "ADGRV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SK9-1", "protein_name": "Stearoyl-CoA desaturase 5", "gene_name": "SCD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14118-1", "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07942-1", "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24043-1", "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11047-1", "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46939-1", "protein_name": "Utrophin", "gene_name": "UTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01453-1", "protein_name": "Peripheral myelin protein 22", "gene_name": "PMP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20916-1", "protein_name": "Myelin-associated glycoprotein", "gene_name": "MAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02686-1", "protein_name": "Myelin basic protein", "gene_name": "MBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16850-1", "protein_name": "Lanosterol 14-alpha demethylase", "gene_name": "CYP51A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13506-1", "protein_name": "NGFI-A-binding protein 1", "gene_name": "NAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM0-1", "protein_name": "Periaxin", "gene_name": "PRX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25189-1", "protein_name": "Myelin protein P0", "gene_name": "MPZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03052-1", "protein_name": "POU domain, class 3, transcription factor 1", "gene_name": "POU3F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28347-1", "protein_name": "Transcriptional enhancer factor TEF-1", "gene_name": "TEAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13474-1", "protein_name": "Dystrophin-related protein 2", "gene_name": "DRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20265-1", "protein_name": "POU domain, class 3, transcription factor 2", "gene_name": "POU3F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11161-1", "protein_name": "E3 SUMO-protein ligase EGR2", "gene_name": "EGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15742", "url": "https://www.uniprot.org/uniprotkb/Q15742" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11133365", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mutation in periaxin is responsible for CMT4F, an autosomal recessive form of Charcot-Marie-Tooth disease.", "journal": "Human molecular genetics", "date": "2001", "authors": "Guilbot A, Williams A, Ravise N, Verny C, Brice A, Sherman DL, Brophy PJ, LeGuern E, Delague V, Bareil C, Megarbane A, Claustres M", "reference": { "type": "PubMed", "id": "11157804", "url": "https://pubmed.ncbi.nlm.nih.gov/11157804" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15742-1", "protein_name": "NGFI-A-binding protein 2", "gene_name": "NAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SQ4-1", "protein_name": "Adhesion G protein-coupled receptor G6", "gene_name": "ADGRG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56693-1", "protein_name": "Transcription factor SOX-10", "gene_name": "SOX10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG9-1", "protein_name": "Adhesion G protein-coupled receptor V1", "gene_name": "ADGRV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SK9-1", "protein_name": "Stearoyl-CoA desaturase 5", "gene_name": "SCD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14118-1", "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07942-1", "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24043-1", "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11047-1", "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46939-1", "protein_name": "Utrophin", "gene_name": "UTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01453-1", "protein_name": "Peripheral myelin protein 22", "gene_name": "PMP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20916-1", "protein_name": "Myelin-associated glycoprotein", "gene_name": "MAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02686-1", "protein_name": "Myelin basic protein", "gene_name": "MBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16850-1", "protein_name": "Lanosterol 14-alpha demethylase", "gene_name": "CYP51A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13506-1", "protein_name": "NGFI-A-binding protein 1", "gene_name": "NAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM0-1", "protein_name": "Periaxin", "gene_name": "PRX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25189-1", "protein_name": "Myelin protein P0", "gene_name": "MPZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03052-1", "protein_name": "POU domain, class 3, transcription factor 1", "gene_name": "POU3F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28347-1", "protein_name": "Transcriptional enhancer factor TEF-1", "gene_name": "TEAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13474-1", "protein_name": "Dystrophin-related protein 2", "gene_name": "DRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20265-1", "protein_name": "POU domain, class 3, transcription factor 2", "gene_name": "POU3F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11161-1", "protein_name": "E3 SUMO-protein ligase EGR2", "gene_name": "EGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15742", "url": "https://www.uniprot.org/uniprotkb/Q15742" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11157804", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A distal upstream enhancer from the myelin basic protein gene regulates expression in myelin-forming schwann cells.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2001", "authors": "Forghani R, Garofalo L, Foran DR, Farhadi HF, Lepage P, Hudson TJ, Tretjakoff I, Valera P, Peterson A", "reference": { "type": "PubMed", "id": "11356866", "url": "https://pubmed.ncbi.nlm.nih.gov/11356866" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15742-1", "protein_name": "NGFI-A-binding protein 2", "gene_name": "NAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SQ4-1", "protein_name": "Adhesion G protein-coupled receptor G6", "gene_name": "ADGRG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56693-1", "protein_name": "Transcription factor SOX-10", "gene_name": "SOX10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG9-1", "protein_name": "Adhesion G protein-coupled receptor V1", "gene_name": "ADGRV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SK9-1", "protein_name": "Stearoyl-CoA desaturase 5", "gene_name": "SCD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14118-1", "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07942-1", "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24043-1", "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11047-1", "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46939-1", "protein_name": "Utrophin", "gene_name": "UTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01453-1", "protein_name": "Peripheral myelin protein 22", "gene_name": "PMP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20916-1", "protein_name": "Myelin-associated glycoprotein", "gene_name": "MAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02686-1", "protein_name": "Myelin basic protein", "gene_name": "MBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16850-1", "protein_name": "Lanosterol 14-alpha demethylase", "gene_name": "CYP51A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13506-1", "protein_name": "NGFI-A-binding protein 1", "gene_name": "NAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM0-1", "protein_name": "Periaxin", "gene_name": "PRX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25189-1", "protein_name": "Myelin protein P0", "gene_name": "MPZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03052-1", "protein_name": "POU domain, class 3, transcription factor 1", "gene_name": "POU3F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28347-1", "protein_name": "Transcriptional enhancer factor TEF-1", "gene_name": "TEAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13474-1", "protein_name": "Dystrophin-related protein 2", "gene_name": "DRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20265-1", "protein_name": "POU domain, class 3, transcription factor 2", "gene_name": "POU3F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11161-1", "protein_name": "E3 SUMO-protein ligase EGR2", "gene_name": "EGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15742", "url": "https://www.uniprot.org/uniprotkb/Q15742" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11356866", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EGR2 mutations in inherited neuropathies dominant-negatively inhibit myelin gene expression.", "journal": "Neuron", "date": "2001", "authors": "Nagarajan R, Svaren J, Le N, Araki T, Watson M, Milbrandt J", "reference": { "type": "PubMed", "id": "11394999", "url": "https://pubmed.ncbi.nlm.nih.gov/11394999" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15742-1", "protein_name": "NGFI-A-binding protein 2", "gene_name": "NAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SQ4-1", "protein_name": "Adhesion G protein-coupled receptor G6", "gene_name": "ADGRG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56693-1", "protein_name": "Transcription factor SOX-10", "gene_name": "SOX10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG9-1", "protein_name": "Adhesion G protein-coupled receptor V1", "gene_name": "ADGRV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SK9-1", "protein_name": "Stearoyl-CoA desaturase 5", "gene_name": "SCD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14118-1", "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07942-1", "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24043-1", "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11047-1", "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46939-1", "protein_name": "Utrophin", "gene_name": "UTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01453-1", "protein_name": "Peripheral myelin protein 22", "gene_name": "PMP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20916-1", "protein_name": "Myelin-associated glycoprotein", "gene_name": "MAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02686-1", "protein_name": "Myelin basic protein", "gene_name": "MBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16850-1", "protein_name": "Lanosterol 14-alpha demethylase", "gene_name": "CYP51A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13506-1", "protein_name": "NGFI-A-binding protein 1", "gene_name": "NAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM0-1", "protein_name": "Periaxin", "gene_name": "PRX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25189-1", "protein_name": "Myelin protein P0", "gene_name": "MPZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03052-1", "protein_name": "POU domain, class 3, transcription factor 1", "gene_name": "POU3F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28347-1", "protein_name": "Transcriptional enhancer factor TEF-1", "gene_name": "TEAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13474-1", "protein_name": "Dystrophin-related protein 2", "gene_name": "DRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20265-1", "protein_name": "POU domain, class 3, transcription factor 2", "gene_name": "POU3F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11161-1", "protein_name": "E3 SUMO-protein ligase EGR2", "gene_name": "EGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15742", "url": "https://www.uniprot.org/uniprotkb/Q15742" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11394999", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Do Schwann cells stop, DR(o)P2, and roll?", "journal": "Neuron", "date": "2001", "authors": "Wrabetz L, Feltri ML", "reference": { "type": "PubMed", "id": "11430795", "url": "https://pubmed.ncbi.nlm.nih.gov/11430795" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15742-1", "protein_name": "NGFI-A-binding protein 2", "gene_name": "NAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SQ4-1", "protein_name": "Adhesion G protein-coupled receptor G6", "gene_name": "ADGRG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56693-1", "protein_name": "Transcription factor SOX-10", "gene_name": "SOX10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG9-1", "protein_name": "Adhesion G protein-coupled receptor V1", "gene_name": "ADGRV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SK9-1", "protein_name": "Stearoyl-CoA desaturase 5", "gene_name": "SCD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14118-1", "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07942-1", "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24043-1", "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11047-1", "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46939-1", "protein_name": "Utrophin", "gene_name": "UTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01453-1", "protein_name": "Peripheral myelin protein 22", "gene_name": "PMP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20916-1", "protein_name": "Myelin-associated glycoprotein", "gene_name": "MAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02686-1", "protein_name": "Myelin basic protein", "gene_name": "MBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16850-1", "protein_name": "Lanosterol 14-alpha demethylase", "gene_name": "CYP51A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13506-1", "protein_name": "NGFI-A-binding protein 1", "gene_name": "NAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM0-1", "protein_name": "Periaxin", "gene_name": "PRX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25189-1", "protein_name": "Myelin protein P0", "gene_name": "MPZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03052-1", "protein_name": "POU domain, class 3, transcription factor 1", "gene_name": "POU3F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28347-1", "protein_name": "Transcriptional enhancer factor TEF-1", "gene_name": "TEAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13474-1", "protein_name": "Dystrophin-related protein 2", "gene_name": "DRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20265-1", "protein_name": "POU domain, class 3, transcription factor 2", "gene_name": "POU3F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11161-1", "protein_name": "E3 SUMO-protein ligase EGR2", "gene_name": "EGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15742", "url": "https://www.uniprot.org/uniprotkb/Q15742" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11430795", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human Connexin 32, a gap junction protein altered in the X-linked form of Charcot-Marie-Tooth disease, is directly regulated by the transcription factor SOX10.", "journal": "Human molecular genetics", "date": "2001", "authors": "Bondurand N, Girard M, Pingault V, Lemort N, Dubourg O, Goossens M", "reference": { "type": "PubMed", "id": "11734543", "url": "https://pubmed.ncbi.nlm.nih.gov/11734543" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15742-1", "protein_name": "NGFI-A-binding protein 2", "gene_name": "NAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SQ4-1", "protein_name": "Adhesion G protein-coupled receptor G6", "gene_name": "ADGRG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56693-1", "protein_name": "Transcription factor SOX-10", "gene_name": "SOX10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG9-1", "protein_name": "Adhesion G protein-coupled receptor V1", "gene_name": "ADGRV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SK9-1", "protein_name": "Stearoyl-CoA desaturase 5", "gene_name": "SCD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12772-1", "protein_name": "Sterol regulatory element-binding protein 2", "gene_name": "SREBF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14118-1", "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07942-1", "protein_name": "Laminin subunit beta-1", "gene_name": "LAMB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24043-1", "protein_name": "Laminin subunit alpha-2", "gene_name": "LAMA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11047-1", "protein_name": "Laminin subunit gamma-1", "gene_name": "LAMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46939-1", "protein_name": "Utrophin", "gene_name": "UTRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01453-1", "protein_name": "Peripheral myelin protein 22", "gene_name": "PMP22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20916-1", "protein_name": "Myelin-associated glycoprotein", "gene_name": "MAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02686-1", "protein_name": "Myelin basic protein", "gene_name": "MBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16850-1", "protein_name": "Lanosterol 14-alpha demethylase", "gene_name": "CYP51A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13506-1", "protein_name": "NGFI-A-binding protein 1", "gene_name": "NAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM0-1", "protein_name": "Periaxin", "gene_name": "PRX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25189-1", "protein_name": "Myelin protein P0", "gene_name": "MPZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03052-1", "protein_name": "POU domain, class 3, transcription factor 1", "gene_name": "POU3F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28347-1", "protein_name": "Transcriptional enhancer factor TEF-1", "gene_name": "TEAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13474-1", "protein_name": "Dystrophin-related protein 2", "gene_name": "DRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20265-1", "protein_name": "POU domain, class 3, transcription factor 2", "gene_name": "POU3F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11161-1", "protein_name": "E3 SUMO-protein ligase EGR2", "gene_name": "EGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15742", "url": "https://www.uniprot.org/uniprotkb/Q15742" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11734543", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]